Summary

A6NNX1

Homolog: Q3KNY5.
Function: RIIa domain-containing protein 1.

Statistics

Total GO Annotation: 16
Unique PROST Go: 9
Unique BLAST Go: 7

Total Homologs: 8
Unique PROST Homologs: 1
Unique BLAST Homologs: 4

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q3KNY5 (RIIa domain-containing protein 1) with a FATCAT P-Value: 1.11e-16 and RMSD of 1.08 angstrom. The sequence alignment identity is 60.0%.
Structural alignment shown in left. Query protein A6NNX1 colored as red in alignment, homolog Q3KNY5 colored as blue. Query protein A6NNX1 is also shown in right top, homolog Q3KNY5 showed in right bottom. They are colored based on secondary structures. 

  A6NNX1 ---------------------------METL-PGLLQRPDPGALSAAQLEQLRKFKIQTRIANEKYLRTHKEVEWLISGFFREIFLKRPDNILEFAADYF 72
  Q3KNY5 MECSASAPEGREEAWISFGKHNNRVCLMETRGHGIV-GPDPGTLNPEQLEQLRDFKIQTRIANEKYLRTHKEVSLLISGFFREMFLKRPDNILEFAAHYF 99

  A6NNX1 TDPRLPNKIHMQLIKDKKAA 92
  Q3KNY5 TDPRLPSRIHMQLIKEKKGT 119

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0048188 Set1C/COMPASS complex
2. P GO:0044666 MLL3/4 complex
2. P GO:0006348
2. P GO:0005802 trans-Golgi network
2. P GO:0051568 histone H3-K4 methylation
2. P GO:0035097 histone methyltransferase complex
2. P GO:0000781 chromosome, telomeric region
2. P GO:0016197 endosomal transport
2. P GO:0042803 protein homodimerization activity
3. B GO:0005634 nucleus
3. B GO:0030041 actin filament polymerization
3. B GO:0005886 plasma membrane
3. B GO:0015629 actin cytoskeleton
3. B GO:0060271 cilium assembly
3. B GO:0061371 determination of heart left/right asymmetry
3. B GO:0044782 cilium organization

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q32PB2 RIIa domain-containing protein 1 2.44e-15 1.66e-34 2.05e-45
1. PB Q3KNY5 RIIa domain-containing protein 1 1.11e-16 2.82e-10 1.17e-45
1. PB A6NNX1 RIIa domain-containing protein 1 0 7.69e-133 2.15e-63
2. P Q8K3E7 Protein dpy-30 homolog 9.00e-05 1.51e-02 NA
3. B M0RAU5 Ciliogenesis-associated TTC17-interacting protein 5.64e-02 NA 0.020
3. B Q08CH6 Ciliogenesis-associated TTC17-interacting protein 2.62e-03 NA 0.018
3. B Q0IHI3 Ciliogenesis-associated TTC17-interacting protein 7.30e-03 NA 1.20e-05
3. B Q7Z7H3 Ciliogenesis-associated TTC17-interacting protein 1.52e-02 NA 1.90e-04