Summary

A6QL64

Homolog: Q9D504.
Function: Ankyrin repeat domain-containing protein 7.

Statistics

Total GO Annotation: 791
Unique PROST Go: 78
Unique BLAST Go: 705

Total Homologs: 682
Unique PROST Homologs: 43
Unique BLAST Homologs: 634

Structures and Sequence Alignment

The best structural homolog that predicted by 3. B was Q9D504 (Ankyrin repeat domain-containing protein 7) with a FATCAT P-Value: 3.8e-08 and RMSD of 1.82 angstrom. The sequence alignment identity is 5.8%.
Structural alignment shown in left. Query protein A6QL64 colored as red in alignment, homolog Q9D504 colored as blue. Query protein A6QL64 is also shown in right top, homolog Q9D504 showed in right bottom. They are colored based on secondary structures. 

  A6QL64 MED-----GKRE---------RWP-TLME----RLCSDGFAFPQYPIKPYHLKRIHRAVLHGNLEKLK-YLLLTYYDANKRDRKERTALHLACATGQPEM 80
  Q9D504 MKKFFPFRGKRKTDDSHSHSSEVPISLAKTAPPSLSIGG----GYHLRDKHLKKLHKAATIGNEQKLKDYLERKKYNVNGRDKRSRTPLHLACANGYTNI 96

  A6QL64 VHLLVSRRCELNLCDREDRTPLIKAVQLRQEACATLLLQNGANPNITDFFGRTALHYAVYNEDTSMIEKLLSHGTNIEECSKCEYQPLLFAVSRRKVKMV 180
  Q9D504 VSLLIENQCKINVQDSENRTPLIKAVECQQESCATVLLLHGADPNLVDVYSNTALHYAVCGQNISLANKLLQYKANLEAKNKDGHTPLLLAVAENNENMV 196

  A6QL64 EFLLKKKANVNAIDYLGRSALIHAVTLGEKDIVILLLQHNIDVLSRDAFRKIAGDYAIEAKNRVIFDLIYEYERKRYEDLPINSNPVSSQK--QPALKAT 278
  Q9D504 KFLLKKGADVNASDKNHRTAIMIALIVEPTSSVKLLLQQDTDLAHKDIYGFTAEEYA--SFNG--FTM--------YHHITAN-NE-NKKKTEQTAY--- 279

  A6QL64 SGKEDSISNIATEIKDGQKSGTVSSQKQPALKDTSDKDDSVSNTATEIKDEQKSGTVLPAVEQCLNRSLYRPDAVAQPVTENEFSLESEIISKLYIPKRK 378
  Q9D504 ---------------------------------------------------------------------------------------------------- 279

  A6QL64 IISPRSIKDVLPPVEEAVDRCLYLLDRFAQPVTKDKFALESENISEPYFTNRRTISQQSAENLDAACGIDKTENGNMFEDQNVDKEGKALPATGQKANVS 478
  Q9D504 ---------------------------------------------------------------------------------------------------- 279

  A6QL64 PEQPPLFTHTVKDRDHISTRFLGGMDSLTSSEESSERPPLSTLTLKEADPSSKAAMRRKDSPPPGKVSSQKQPAEKATSDDKDSVSNIATEIKEGPISGT 578
  Q9D504 ---------------------------------------------------------------------------------------------------- 279

  A6QL64 VSSQKQPAEKATSDEKDSVSNIATEIKKGQQSGTVSPQKQSAWKVIFKKKVSLLNIATRIMGGGKSGTVSSQKQPASKATSDKTDSALNIATEIKDGLQC 678
  Q9D504 ---------------------------------------------------------------------------------------------------- 279

  A6QL64 GTVSSQKQPALKATTDEEDSVSNIATEIKDGEKSGTVSSQKQPALKATTDEEDSVSNIATEIKDGEKSGTVSSQKQPALKATTDEKDSVSNIATEIKDGE 778
  Q9D504 ---------------------------------------------------------------------------------------------------- 279

  A6QL64 KSGTVSSQKPPALTATSDEEGSVLSIARENKDGEKSRTVSSRKKPALKATSDEKDSFSNITRGKKDGEISRKVSSQKPPTLKGTSDEEDSVLGIARENKD 878
  Q9D504 ---------------------------------------------------------------------------------------------------- 279

  A6QL64 GEKSRTVSSEKPPGLKASSAEKDSVLNIARGKKDGEKTKRVSSRKKPSLEATSDEKDSFSNITREKKDGEISRKVSSQKPPALKGTSDEEDSVLGIAREN 978
  Q9D504 ---------------------------------------------------------------------------------------------------- 279

  A6QL64 KDGEKSRTVSSEKPPGLKATSDEKDSVLNIARGKKDGEKTRTVSSQKPPTLKATSDEEDSVLSIARENKDGEKSRTVSSEKPSGLKATSAEKDSVLNIAR 1078
  Q9D504 ---------------------------------------------------------------------------------------------------- 279

  A6QL64 GKKYGEKTKRVSSRKKPALKATSDEKDSVLYIAREKKDGEKSRTVSSPKQPALKAICDKEDSVPNMATEKKDEQISGTVSCQKQPALKATSDKKDSVSNI 1178
  Q9D504 ---------------------------------------------------------------------------------------------------- 279

  A6QL64 PTEIKDGQQSGTVSSQKQPAWKATSVKKDSVSNIATEIKDGQIRGTVSPQKQSAQKVIFKKKVSLLNIATRITGGWKSGTEYPENLPTLKATIENKNSVL 1278
  Q9D504 ---------------------------------------------------------------------------------------------------- 279

  A6QL64 NTATKMKDVQTSTPAEQDLEMASEGEQKRLEEYENNQPQVKNQIHSRDDLDDIIQSSQTVSEDGDSLCCNCKNVILLIDQHEMKCKDCVHLLKIKNTFCL 1378
  Q9D504 ---------------------------------------------------------------------------------------------------- 279

  A6QL64 WKRLIKLKDNHCEQLRVKIRKLKNKASVLQKRISEKEEIKSQLKHEILELEKELCSLRFAIQQEKKKRRNVEEVHQKVREKLRITEEQYRIEADVTKPIK 1478
  Q9D504 ---------------------------------------------------------------------------------------------------- 279

  A6QL64 PALKSAEVELKTGGNNSNQVSETDEKEDLLHENRLMQDEIARLRLEKDTIKNQNLEKKYLKDFEIVKRKHEDLQKALKRNGETLAKTIACYSGQLAALTD 1578
  Q9D504 ---------------------------------------------------------------------------------------------------- 279

  A6QL64 ENTTLRSKLEKQRESRQRLETEMQSYHCRLNAARCDHDQSHSSKRDQELAFQGTVDKCRHLQENLNSHVLILSLQLSKAESKSRVLKTELHYTGEALKEK 1678
  Q9D504 ---------------------------------------------------------------------------------------------------- 279

  A6QL64 ALVFEHVQSELKQKQSQMKDIEKMYKSGYNTMEKCIEKQERFCQLKKQNMLLQQQLDDARNKADNQEKAILNIQARCDARVQNLQAECRKHRLLLEEDNK 1778
  Q9D504 ---------------------------------------------------------------------------------------------------- 279

  A6QL64 MLVNELNHSKEKECQYEKEKAEREVAVRQLQQKRDDVLNKGSATKALLDASSRHCTYLENGMQDSRKKLDQMRSQFQEIQDQLTATIRCTKEMEGDTQKL 1878
  Q9D504 ---------------------------------------------------------------------------------------------------- 279

  A6QL64 EVEHVMMRKIIKKQDDQIERLEKILQHSSLMLQVFES 1915
  Q9D504 ------------------------------------- 279

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0009925 basal plasma membrane
1. PB GO:0070972 protein localization to endoplasmic reticulum
1. PB GO:0043086 negative regulation of catalytic activity
1. PB GO:0008157 protein phosphatase 1 binding
1. PB GO:0008093 cytoskeletal anchor activity
1. PB GO:0042994 cytoplasmic sequestering of transcription factor
1. PB GO:0035308 negative regulation of protein dephosphorylation
1. PB GO:0030017 sarcomere
2. P GO:0032886 regulation of microtubule-based process
2. P GO:0010469 regulation of signaling receptor activity
2. P GO:0032039 integrator complex
2. P GO:0002853 negative regulation of T cell mediated cytotoxicity directed against tumor cell target
2. P GO:0019226 transmission of nerve impulse
2. P GO:0003756 protein disulfide isomerase activity
2. P GO:1903573 negative regulation of response to endoplasmic reticulum stress
2. P GO:0080115 myosin XI tail binding
2. P GO:0030844 positive regulation of intermediate filament depolymerization
2. P GO:0048858 cell projection morphogenesis
2. P GO:0007091 metaphase/anaphase transition of mitotic cell cycle
2. P GO:0034472 snRNA 3'-end processing
2. P GO:0030953 astral microtubule organization
2. P GO:0005796 Golgi lumen
2. P GO:0071215 cellular response to abscisic acid stimulus
2. P GO:0090281 negative regulation of calcium ion import
2. P GO:0031589 cell-substrate adhesion
2. P GO:2000179 positive regulation of neural precursor cell proliferation
2. P GO:0000128 flocculation
2. P GO:1990441 negative regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress
2. P GO:0008366 axon ensheathment
2. P GO:0005854 nascent polypeptide-associated complex
2. P GO:0048012 hepatocyte growth factor receptor signaling pathway
2. P GO:0031730 CCR5 chemokine receptor binding
2. P GO:0042306 regulation of protein import into nucleus
2. P GO:0051764 actin crosslink formation
2. P GO:0030414 peptidase inhibitor activity
2. P GO:0050817 coagulation
2. P GO:0001953 negative regulation of cell-matrix adhesion
2. P GO:0031076 embryonic camera-type eye development
2. P GO:1903917 positive regulation of endoplasmic reticulum stress-induced eIF2 alpha dephosphorylation
2. P GO:0009277 fungal-type cell wall
2. P GO:0032515 negative regulation of phosphoprotein phosphatase activity
2. P GO:0022027 interkinetic nuclear migration
2. P GO:0046914 transition metal ion binding
2. P GO:1901318 negative regulation of flagellated sperm motility
2. P GO:0001533 cornified envelope
2. P GO:0110148 biomineralization
2. P GO:0019215 intermediate filament binding
2. P GO:0072089 stem cell proliferation
2. P GO:0007420 brain development
2. P GO:0030054 cell junction
2. P GO:0048240 sperm capacitation
2. P GO:0031528 microvillus membrane
2. P GO:0045943 positive regulation of transcription by RNA polymerase I
2. P GO:0010466 negative regulation of peptidase activity
2. P GO:0032516 positive regulation of phosphoprotein phosphatase activity
2. P GO:0031424 keratinization
2. P GO:0031225 anchored component of membrane
2. P GO:0032290 peripheral nervous system myelin formation
2. P GO:0022408 negative regulation of cell-cell adhesion
2. P GO:1902850 microtubule cytoskeleton organization involved in mitosis
2. P GO:0034614 cellular response to reactive oxygen species
2. P GO:0039503 suppression by virus of host innate immune response
2. P GO:0007288 sperm axoneme assembly
2. P GO:0043484 regulation of RNA splicing
2. P GO:0001520 outer dense fiber
2. P GO:0110143 magnetosome
2. P GO:0009566 fertilization
2. P GO:0032287 peripheral nervous system myelin maintenance
2. P GO:1900005 positive regulation of serine-type endopeptidase activity
2. P GO:0017022 myosin binding
2. P GO:0032184 SUMO polymer binding
2. P GO:0005537 mannose binding
2. P GO:0005882 intermediate filament
2. P GO:0060236 regulation of mitotic spindle organization
2. P GO:0004791 thioredoxin-disulfide reductase activity
2. P GO:0030176 integral component of endoplasmic reticulum membrane
2. P GO:0000164 protein phosphatase type 1 complex
2. P GO:0036496 regulation of translational initiation by eIF2 alpha dephosphorylation
2. P GO:1902310 positive regulation of peptidyl-serine dephosphorylation
2. P GO:0005741 mitochondrial outer membrane
2. P GO:0060734 regulation of endoplasmic reticulum stress-induced eIF2 alpha phosphorylation
2. P GO:0042628 mating plug formation
2. P GO:0005176 ErbB-2 class receptor binding
2. P GO:0070262 peptidyl-serine dephosphorylation
2. P GO:1903912 negative regulation of endoplasmic reticulum stress-induced eIF2 alpha phosphorylation
2. P GO:0009789 positive regulation of abscisic acid-activated signaling pathway
3. B GO:0005770 late endosome
3. B GO:0034765 regulation of ion transmembrane transport
3. B GO:0071625 vocalization behavior
3. B GO:0000122 negative regulation of transcription by RNA polymerase II
3. B GO:0048337 positive regulation of mesodermal cell fate specification
3. B GO:0050729 positive regulation of inflammatory response
3. B GO:0090037 positive regulation of protein kinase C signaling
3. B GO:0048709 oligodendrocyte differentiation
3. B GO:0006511 ubiquitin-dependent protein catabolic process
3. B GO:0043011 myeloid dendritic cell differentiation
3. B GO:0035148 tube formation
3. B GO:0032456 endocytic recycling
3. B GO:0007507 heart development
3. B GO:0001701 in utero embryonic development
3. B GO:0072104 glomerular capillary formation
3. B GO:1903779 regulation of cardiac conduction
3. B GO:0042088 T-helper 1 type immune response
3. B GO:0070563 negative regulation of vitamin D receptor signaling pathway
3. B GO:0030334 regulation of cell migration
3. B GO:0032421 stereocilium bundle
3. B GO:0003270 Notch signaling pathway involved in regulation of secondary heart field cardioblast proliferation
3. B GO:0010812 negative regulation of cell-substrate adhesion
3. B GO:0001756 somitogenesis
3. B GO:2001259 positive regulation of cation channel activity
3. B GO:0051247 positive regulation of protein metabolic process
3. B GO:0021514 ventral spinal cord interneuron differentiation
3. B GO:1903522 regulation of blood circulation
3. B GO:0070372 regulation of ERK1 and ERK2 cascade
3. B GO:0060412 ventricular septum morphogenesis
3. B GO:0045663 positive regulation of myoblast differentiation
3. B GO:0014044 Schwann cell development
3. B GO:0006306 DNA methylation
3. B GO:0097190 apoptotic signaling pathway
3. B GO:0106310 protein serine kinase activity
3. B GO:0019903 protein phosphatase binding
3. B GO:0003252 negative regulation of cell proliferation involved in heart valve morphogenesis
3. B GO:0085020 protein K6-linked ubiquitination
3. B GO:0006959 humoral immune response
3. B GO:0004842 ubiquitin-protein transferase activity
3. B GO:0047499 calcium-independent phospholipase A2 activity
3. B GO:0043403 skeletal muscle tissue regeneration
3. B GO:0007140 male meiotic nuclear division
3. B GO:0001837 epithelial to mesenchymal transition
3. B GO:0051494 negative regulation of cytoskeleton organization
3. B GO:0048259 regulation of receptor-mediated endocytosis
3. B GO:0045070 positive regulation of viral genome replication
3. B GO:0003950 NAD+ ADP-ribosyltransferase activity
3. B GO:0032420 stereocilium
3. B GO:0035264 multicellular organism growth
3. B GO:0021519 spinal cord association neuron specification
3. B GO:0015095 magnesium ion transmembrane transporter activity
3. B GO:0045611 negative regulation of hemocyte differentiation
3. B GO:0051489 regulation of filopodium assembly
3. B GO:0035622 intrahepatic bile duct development
3. B GO:0045737 positive regulation of cyclin-dependent protein serine/threonine kinase activity
3. B GO:0045036 protein targeting to chloroplast
3. B GO:0033257 Bcl3/NF-kappaB2 complex
3. B GO:0016571 histone methylation
3. B GO:0043254 regulation of protein-containing complex assembly
3. B GO:0010765 positive regulation of sodium ion transport
3. B GO:0035304 regulation of protein dephosphorylation
3. B GO:0071546 pi-body
3. B GO:0010557 positive regulation of macromolecule biosynthetic process
3. B GO:0003162 atrioventricular node development
3. B GO:0035690
3. B GO:0007283 spermatogenesis
3. B GO:0007492 endoderm development
3. B GO:0048549 positive regulation of pinocytosis
3. B GO:2001214 positive regulation of vasculogenesis
3. B GO:0030534 adult behavior
3. B GO:0031069 hair follicle morphogenesis
3. B GO:0072659 protein localization to plasma membrane
3. B GO:0086015 SA node cell action potential
3. B GO:1990404 protein ADP-ribosylase activity
3. B GO:0005903 brush border
3. B GO:0061073 ciliary body morphogenesis
3. B GO:0051092 positive regulation of NF-kappaB transcription factor activity
3. B GO:0007520 myoblast fusion
3. B GO:0003151 outflow tract morphogenesis
3. B GO:0036464 cytoplasmic ribonucleoprotein granule
3. B GO:0006913 nucleocytoplasmic transport
3. B GO:0072014 proximal tubule development
3. B GO:0002437 inflammatory response to antigenic stimulus
3. B GO:0002039 p53 binding
3. B GO:0031286 negative regulation of sorocarp stalk cell differentiation
3. B GO:0002052 positive regulation of neuroblast proliferation
3. B GO:0042734 presynaptic membrane
3. B GO:0050953 sensory perception of light stimulus
3. B GO:1902309 negative regulation of peptidyl-serine dephosphorylation
3. B GO:0070417 cellular response to cold
3. B GO:0031462 Cul2-RING ubiquitin ligase complex
3. B GO:0048715 negative regulation of oligodendrocyte differentiation
3. B GO:0010564 regulation of cell cycle process
3. B GO:0034142 toll-like receptor 4 signaling pathway
3. B GO:1990433 CSL-Notch-Mastermind transcription factor complex
3. B GO:0005123 death receptor binding
3. B GO:0032426 stereocilium tip
3. B GO:0043409 negative regulation of MAPK cascade
3. B GO:0001886 endothelial cell morphogenesis
3. B GO:0043008 ATP-dependent protein binding
3. B GO:0048056 R3/R4 cell differentiation
3. B GO:0003160 endocardium morphogenesis
3. B GO:0022011 myelination in peripheral nervous system
3. B GO:0007249 I-kappaB kinase/NF-kappaB signaling
3. B GO:0050894 determination of affect
3. B GO:0045638 negative regulation of myeloid cell differentiation
3. B GO:0001709 cell fate determination
3. B GO:0000209 protein polyubiquitination
3. B GO:0097546 ciliary base
3. B GO:0001947 heart looping
3. B GO:0035116 embryonic hindlimb morphogenesis
3. B GO:0090201 negative regulation of release of cytochrome c from mitochondria
3. B GO:0002027 regulation of heart rate
3. B GO:2000178 negative regulation of neural precursor cell proliferation
3. B GO:1904970 brush border assembly
3. B GO:0044325 transmembrane transporter binding
3. B GO:0008593 regulation of Notch signaling pathway
3. B GO:0030496 midbody
3. B GO:0005634 nucleus
3. B GO:0072116 pronephros formation
3. B GO:0072574 hepatocyte proliferation
3. B GO:1990760 osmolarity-sensing cation channel activity
3. B GO:0019888 protein phosphatase regulator activity
3. B GO:0046875 ephrin receptor binding
3. B GO:0010366 negative regulation of ethylene biosynthetic process
3. B GO:0001763 morphogenesis of a branching structure
3. B GO:0030660 Golgi-associated vesicle membrane
3. B GO:0002789 negative regulation of antifungal peptide production
3. B GO:0072044 collecting duct development
3. B GO:0046826 negative regulation of protein export from nucleus
3. B GO:1900246 positive regulation of RIG-I signaling pathway
3. B GO:1904901 positive regulation of myosin II filament organization
3. B GO:0070528 protein kinase C signaling
3. B GO:0060999 positive regulation of dendritic spine development
3. B GO:0007253 cytoplasmic sequestering of NF-kappaB
3. B GO:0005516 calmodulin binding
3. B GO:0045603 positive regulation of endothelial cell differentiation
3. B GO:0010875 positive regulation of cholesterol efflux
3. B GO:0045746 negative regulation of Notch signaling pathway
3. B GO:0035774 positive regulation of insulin secretion involved in cellular response to glucose stimulus
3. B GO:0097604 temperature-gated cation channel activity
3. B GO:0070213 protein auto-ADP-ribosylation
3. B GO:0004672 protein kinase activity
3. B GO:0046427 positive regulation of receptor signaling pathway via JAK-STAT
3. B GO:0043330 response to exogenous dsRNA
3. B GO:0055016 hypochord development
3. B GO:0031877 somatostatin receptor binding
3. B GO:0048812 neuron projection morphogenesis
3. B GO:0033292 T-tubule organization
3. B GO:0005769 early endosome
3. B GO:0010923 negative regulation of phosphatase activity
3. B GO:0071356 cellular response to tumor necrosis factor
3. B GO:0045665 negative regulation of neuron differentiation
3. B GO:0048699 generation of neurons
3. B GO:0071372 cellular response to follicle-stimulating hormone stimulus
3. B GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
3. B GO:1904108 protein localization to ciliary inversin compartment
3. B GO:0009950 dorsal/ventral axis specification
3. B GO:0005525 GTP binding
3. B GO:1900245 positive regulation of MDA-5 signaling pathway
3. B GO:0045747 positive regulation of Notch signaling pathway
3. B GO:0006915 apoptotic process
3. B GO:0035924 cellular response to vascular endothelial growth factor stimulus
3. B GO:0106311
3. B GO:0014832 urinary bladder smooth muscle contraction
3. B GO:0071889 14-3-3 protein binding
3. B GO:0006606 protein import into nucleus
3. B GO:0090521 glomerular visceral epithelial cell migration
3. B GO:0031436 BRCA1-BARD1 complex
3. B GO:0045944 positive regulation of transcription by RNA polymerase II
3. B GO:0050768 negative regulation of neurogenesis
3. B GO:0030307 positive regulation of cell growth
3. B GO:0099092 postsynaptic density, intracellular component
3. B GO:0045893 positive regulation of transcription, DNA-templated
3. B GO:0005249 voltage-gated potassium channel activity
3. B GO:0045211 postsynaptic membrane
3. B GO:0010838 positive regulation of keratinocyte proliferation
3. B GO:0010976 positive regulation of neuron projection development
3. B GO:0031941 filamentous actin
3. B GO:0032270 positive regulation of cellular protein metabolic process
3. B GO:0043491 protein kinase B signaling
3. B GO:0005902 microvillus
3. B GO:0036336 dendritic cell migration
3. B GO:0016055 Wnt signaling pathway
3. B GO:0048873 homeostasis of number of cells within a tissue
3. B GO:0051967 negative regulation of synaptic transmission, glutamatergic
3. B GO:0061195 taste bud formation
3. B GO:0018345 protein palmitoylation
3. B GO:1904106 protein localization to microvillus
3. B GO:0032288 myelin assembly
3. B GO:0021515 cell differentiation in spinal cord
3. B GO:0015271 outward rectifier potassium channel activity
3. B GO:0002011 morphogenesis of an epithelial sheet
3. B GO:0071212 subsynaptic reticulum
3. B GO:0014807 regulation of somitogenesis
3. B GO:0031670 cellular response to nutrient
3. B GO:0090090 negative regulation of canonical Wnt signaling pathway
3. B GO:0030279 negative regulation of ossification
3. B GO:0048663 neuron fate commitment
3. B GO:0030016 myofibril
3. B GO:0006584 catecholamine metabolic process
3. B GO:0060743 epithelial cell maturation involved in prostate gland development
3. B GO:0003182 coronary sinus valve morphogenesis
3. B GO:0055117 regulation of cardiac muscle contraction
3. B GO:1902339 positive regulation of apoptotic process involved in morphogenesis
3. B GO:0044605 phosphocholine transferase activity
3. B GO:0006929 substrate-dependent cell migration
3. B GO:0030424 axon
3. B GO:0035307 positive regulation of protein dephosphorylation
3. B GO:0007409 axonogenesis
3. B GO:0051146 striated muscle cell differentiation
3. B GO:0035255 ionotropic glutamate receptor binding
3. B GO:0003714 transcription corepressor activity
3. B GO:0043069 negative regulation of programmed cell death
3. B GO:1902260 negative regulation of delayed rectifier potassium channel activity
3. B GO:0031013 troponin I binding
3. B GO:0031430 M band
3. B GO:0050678 regulation of epithelial cell proliferation
3. B GO:0043046 DNA methylation involved in gamete generation
3. B GO:0070198 protein localization to chromosome, telomeric region
3. B GO:0090238 positive regulation of arachidonic acid secretion
3. B GO:0045751 negative regulation of Toll signaling pathway
3. B GO:0072576 liver morphogenesis
3. B GO:0007030 Golgi organization
3. B GO:0045838 positive regulation of membrane potential
3. B GO:0005929 cilium
3. B GO:1902263 apoptotic process involved in embryonic digit morphogenesis
3. B GO:0036371 protein localization to T-tubule
3. B GO:0035172 hemocyte proliferation
3. B GO:0003344 pericardium morphogenesis
3. B GO:0060076 excitatory synapse
3. B GO:0070742 C2H2 zinc finger domain binding
3. B GO:0140627 ubiquitin-dependent protein catabolic process via the C-end degron rule pathway
3. B GO:0003208 cardiac ventricle morphogenesis
3. B GO:0003214 cardiac left ventricle morphogenesis
3. B GO:2000812 regulation of barbed-end actin filament capping
3. B GO:0010424 DNA methylation on cytosine within a CG sequence
3. B GO:0051101 regulation of DNA binding
3. B GO:0014731 spectrin-associated cytoskeleton
3. B GO:0005737 cytoplasm
3. B GO:0098978 glutamatergic synapse
3. B GO:2000001 regulation of DNA damage checkpoint
3. B GO:0055013 cardiac muscle cell development
3. B GO:0072114 pronephros morphogenesis
3. B GO:0061630 ubiquitin protein ligase activity
3. B GO:0010882 regulation of cardiac muscle contraction by calcium ion signaling
3. B GO:0043005 neuron projection
3. B GO:0098871 postsynaptic actin cytoskeleton
3. B GO:0097435 supramolecular fiber organization
3. B GO:0035153 epithelial cell type specification, open tracheal system
3. B GO:0046331 lateral inhibition
3. B GO:0014704 intercalated disc
3. B GO:0042995 cell projection
3. B GO:0019901 protein kinase binding
3. B GO:0046959 habituation
3. B GO:0001955 blood vessel maturation
3. B GO:0010225 response to UV-C
3. B GO:0099519 dense core granule cytoskeletal transport
3. B GO:0007219 Notch signaling pathway
3. B GO:0035994 response to muscle stretch
3. B GO:0038023 signaling receptor activity
3. B GO:0060354 negative regulation of cell adhesion molecule production
3. B GO:0010881 regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion
3. B GO:0031441 negative regulation of mRNA 3'-end processing
3. B GO:0032232 negative regulation of actin filament bundle assembly
3. B GO:0034638 phosphatidylcholine catabolic process
3. B GO:0021546 rhombomere development
3. B GO:0003332 negative regulation of extracellular matrix constituent secretion
3. B GO:0046976 histone methyltransferase activity (H3-K27 specific)
3. B GO:1905274 regulation of modification of postsynaptic actin cytoskeleton
3. B GO:0005856 cytoskeleton
3. B GO:0031047 gene silencing by RNA
3. B GO:0042048 olfactory behavior
3. B GO:0071222 cellular response to lipopolysaccharide
3. B GO:0071447 cellular response to hydroperoxide
3. B GO:0032580 Golgi cisterna membrane
3. B GO:0035914 skeletal muscle cell differentiation
3. B GO:0016529 sarcoplasmic reticulum
3. B GO:0071800 podosome assembly
3. B GO:0060288 formation of a compartment boundary
3. B GO:0051497 negative regulation of stress fiber assembly
3. B GO:0005096 GTPase activator activity
3. B GO:0030034 microvillar actin bundle assembly
3. B GO:1901222 regulation of NIK/NF-kappaB signaling
3. B GO:0045672 positive regulation of osteoclast differentiation
3. B GO:1904743 negative regulation of telomeric DNA binding
3. B GO:0071347 cellular response to interleukin-1
3. B GO:1900383 regulation of synaptic plasticity by receptor localization to synapse
3. B GO:0003241 growth involved in heart morphogenesis
3. B GO:0072660 maintenance of protein location in plasma membrane
3. B GO:0015629 actin cytoskeleton
3. B GO:0009967 positive regulation of signal transduction
3. B GO:0086004 regulation of cardiac muscle cell contraction
3. B GO:0055007 cardiac muscle cell differentiation
3. B GO:0060289 compartment boundary maintenance
3. B GO:0031674 I band
3. B GO:2000134 negative regulation of G1/S transition of mitotic cell cycle
3. B GO:0043197 dendritic spine
3. B GO:0005112 Notch binding
3. B GO:0003198 epithelial to mesenchymal transition involved in endocardial cushion formation
3. B GO:0102991 myristoyl-CoA hydrolase activity
3. B GO:1901187 regulation of ephrin receptor signaling pathway
3. B GO:0010378 temperature compensation of the circadian clock
3. B GO:0061028 establishment of endothelial barrier
3. B GO:0001889 liver development
3. B GO:0008285 negative regulation of cell population proliferation
3. B GO:0045197 establishment or maintenance of epithelial cell apical/basal polarity
3. B GO:0060674 placenta blood vessel development
3. B GO:0033209 tumor necrosis factor-mediated signaling pathway
3. B GO:0036309 protein localization to M-band
3. B GO:0065001 specification of axis polarity
3. B GO:0050750 low-density lipoprotein particle receptor binding
3. B GO:0060317 cardiac epithelial to mesenchymal transition
3. B GO:0060948 cardiac vascular smooth muscle cell development
3. B GO:0086069 bundle of His cell to Purkinje myocyte communication
3. B GO:0045732 positive regulation of protein catabolic process
3. B GO:0034446 substrate adhesion-dependent cell spreading
3. B GO:0002357 defense response to tumor cell
3. B GO:0002070 epithelial cell maturation
3. B GO:0031432 titin binding
3. B GO:0034112 positive regulation of homotypic cell-cell adhesion
3. B GO:0060442 branching involved in prostate gland morphogenesis
3. B GO:0006471 protein ADP-ribosylation
3. B GO:0070531 BRCA1-A complex
3. B GO:0030154 cell differentiation
3. B GO:0060842 arterial endothelial cell differentiation
3. B GO:0086070 SA node cell to atrial cardiac muscle cell communication
3. B GO:0042327 positive regulation of phosphorylation
3. B GO:0045955 negative regulation of calcium ion-dependent exocytosis
3. B GO:0090160 Golgi to lysosome transport
3. B GO:2001027 negative regulation of endothelial cell chemotaxis
3. B GO:0043268 positive regulation of potassium ion transport
3. B GO:0035518 histone H2A monoubiquitination
3. B GO:0042981 regulation of apoptotic process
3. B GO:0031267 small GTPase binding
3. B GO:0016021 integral component of membrane
3. B GO:0060035 notochord cell development
3. B GO:0002193 MAML1-RBP-Jkappa- ICN1 complex
3. B GO:0046579 positive regulation of Ras protein signal transduction
3. B GO:0045685 regulation of glial cell differentiation
3. B GO:0030513 positive regulation of BMP signaling pathway
3. B GO:2000737 negative regulation of stem cell differentiation
3. B GO:0048754 branching morphogenesis of an epithelial tube
3. B GO:0010001 glial cell differentiation
3. B GO:0000062 fatty-acyl-CoA binding
3. B GO:1902531 regulation of intracellular signal transduction
3. B GO:1900827 positive regulation of membrane depolarization during cardiac muscle cell action potential
3. B GO:0031960 response to corticosteroid
3. B GO:0060074 synapse maturation
3. B GO:0003256 regulation of transcription from RNA polymerase II promoter involved in myocardial precursor cell differentiation
3. B GO:1901201 regulation of extracellular matrix assembly
3. B GO:0048892 lateral line nerve development
3. B GO:0032049 cardiolipin biosynthetic process
3. B GO:0010667 negative regulation of cardiac muscle cell apoptotic process
3. B GO:0038061 NIK/NF-kappaB signaling
3. B GO:0019730 antimicrobial humoral response
3. B GO:0005938 cell cortex
3. B GO:0042802 identical protein binding
3. B GO:0005654 nucleoplasm
3. B GO:0048708 astrocyte differentiation
3. B GO:0001708 cell fate specification
3. B GO:0030674 protein-macromolecule adaptor activity
3. B GO:0034058 endosomal vesicle fusion
3. B GO:0003222 ventricular trabecula myocardium morphogenesis
3. B GO:0030326 embryonic limb morphogenesis
3. B GO:0060740 prostate gland epithelium morphogenesis
3. B GO:0030837 negative regulation of actin filament polymerization
3. B GO:0071286 cellular response to magnesium ion
3. B GO:1905938 positive regulation of germ cell proliferation
3. B GO:0060411 cardiac septum morphogenesis
3. B GO:0050775 positive regulation of dendrite morphogenesis
3. B GO:0032717 negative regulation of interleukin-8 production
3. B GO:0060113 inner ear receptor cell differentiation
3. B GO:0045967 negative regulation of growth rate
3. B GO:0043034 costamere
3. B GO:0021986 habenula development
3. B GO:0018230 peptidyl-L-cysteine S-palmitoylation
3. B GO:0032791 lead ion binding
3. B GO:0030046 parallel actin filament bundle assembly
3. B GO:0046843 dorsal appendage formation
3. B GO:0016567 protein ubiquitination
3. B GO:0051059 NF-kappaB binding
3. B GO:0036166 phenotypic switching
3. B GO:0046469 platelet activating factor metabolic process
3. B GO:0007605 sensory perception of sound
3. B GO:0044877 protein-containing complex binding
3. B GO:0070986 left/right axis specification
3. B GO:0005576 extracellular region
3. B GO:0019887 protein kinase regulator activity
3. B GO:0046974 histone methyltransferase activity (H3-K9 specific)
3. B GO:0098908 regulation of neuronal action potential
3. B GO:0018024 histone-lysine N-methyltransferase activity
3. B GO:0010468 regulation of gene expression
3. B GO:0021915 neural tube development
3. B GO:0030018 Z disc
3. B GO:0002467 germinal center formation
3. B GO:0036377 arbuscular mycorrhizal association
3. B GO:0046473 phosphatidic acid metabolic process
3. B GO:0007221 positive regulation of transcription of Notch receptor target
3. B GO:0099612 protein localization to axon
3. B GO:1902041 regulation of extrinsic apoptotic signaling pathway via death domain receptors
3. B GO:0005524 ATP binding
3. B GO:0061419 positive regulation of transcription from RNA polymerase II promoter in response to hypoxia
3. B GO:0045669 positive regulation of osteoblast differentiation
3. B GO:0042686 regulation of cardioblast cell fate specification
3. B GO:0046338 phosphatidylethanolamine catabolic process
3. B GO:0071260 cellular response to mechanical stimulus
3. B GO:0097422 tubular endosome
3. B GO:0018027 peptidyl-lysine dimethylation
3. B GO:0010960 magnesium ion homeostasis
3. B GO:2001204 regulation of osteoclast development
3. B GO:0001650 fibrillar center
3. B GO:0048536 spleen development
3. B GO:0042826 histone deacetylase binding
3. B GO:1990090 cellular response to nerve growth factor stimulus
3. B GO:0140261 BCOR complex
3. B GO:0035418 protein localization to synapse
3. B GO:0042325 regulation of phosphorylation
3. B GO:0010614 negative regulation of cardiac muscle hypertrophy
3. B GO:0021675 nerve development
3. B GO:0035646 endosome to melanosome transport
3. B GO:0044232 organelle membrane contact site
3. B GO:0001841 neural tube formation
3. B GO:0048899 anterior lateral line development
3. B GO:0033147 negative regulation of intracellular estrogen receptor signaling pathway
3. B GO:0062043 positive regulation of cardiac epithelial to mesenchymal transition
3. B GO:0001222 transcription corepressor binding
3. B GO:0045316 negative regulation of compound eye photoreceptor development
3. B GO:0007009 plasma membrane organization
3. B GO:0045607 regulation of inner ear auditory receptor cell differentiation
3. B GO:0043292 contractile fiber
3. B GO:0042691 positive regulation of crystal cell differentiation
3. B GO:0032996 Bcl3-Bcl10 complex
3. B GO:0043517 positive regulation of DNA damage response, signal transduction by p53 class mediator
3. B GO:0019843 rRNA binding
3. B GO:0070212 protein poly-ADP-ribosylation
3. B GO:2000048 negative regulation of cell-cell adhesion mediated by cadherin
3. B GO:1904058 positive regulation of sensory perception of pain
3. B GO:0060979 vasculogenesis involved in coronary vascular morphogenesis
3. B GO:0007160 cell-matrix adhesion
3. B GO:0000151 ubiquitin ligase complex
3. B GO:0030160 synaptic receptor adaptor activity
3. B GO:2000209 regulation of anoikis
3. B GO:0045662 negative regulation of myoblast differentiation
3. B GO:0019228 neuronal action potential
3. B GO:0072017 distal tubule development
3. B GO:0007440 foregut morphogenesis
3. B GO:0048711 positive regulation of astrocyte differentiation
3. B GO:0072073 kidney epithelium development
3. B GO:0045859 regulation of protein kinase activity
3. B GO:0051569 regulation of histone H3-K4 methylation
3. B GO:0004622 lysophospholipase activity
3. B GO:0035023 regulation of Rho protein signal transduction
3. B GO:0072357 PTW/PP1 phosphatase complex
3. B GO:0007386 compartment pattern specification
3. B GO:0010650 positive regulation of cell communication by electrical coupling
3. B GO:0003181 atrioventricular valve morphogenesis
3. B GO:0090051 negative regulation of cell migration involved in sprouting angiogenesis
3. B GO:0042663 regulation of endodermal cell fate specification
3. B GO:0007478 leg disc morphogenesis
3. B GO:0010638 positive regulation of organelle organization
3. B GO:0060768 regulation of epithelial cell proliferation involved in prostate gland development
3. B GO:0060998 regulation of dendritic spine development
3. B GO:2000811 negative regulation of anoikis
3. B GO:0006897 endocytosis
3. B GO:0032934 sterol binding
3. B GO:0070650 actin filament bundle distribution
3. B GO:0045608 negative regulation of inner ear auditory receptor cell differentiation
3. B GO:0055008 cardiac muscle tissue morphogenesis
3. B GO:1901339 regulation of store-operated calcium channel activity
3. B GO:0014066 regulation of phosphatidylinositol 3-kinase signaling
3. B GO:0006887 exocytosis
3. B GO:0071314 cellular response to cocaine
3. B GO:0000242 pericentriolar material
3. B GO:2000096 positive regulation of Wnt signaling pathway, planar cell polarity pathway
3. B GO:0003197 endocardial cushion development
3. B GO:0016604 nuclear body
3. B GO:0003723 RNA binding
3. B GO:0098685 Schaffer collateral - CA1 synapse
3. B GO:0042665 regulation of ectodermal cell fate specification
3. B GO:1903589 positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis
3. B GO:0098907 regulation of SA node cell action potential
3. B GO:0003203 endocardial cushion morphogenesis
3. B GO:0003408 optic cup formation involved in camera-type eye development
3. B GO:1905667 negative regulation of protein localization to endosome
3. B GO:1900026 positive regulation of substrate adhesion-dependent cell spreading
3. B GO:0035965 cardiolipin acyl-chain remodeling
3. B GO:0003677 DNA binding
3. B GO:0048471 perinuclear region of cytoplasm
3. B GO:0030155 regulation of cell adhesion
3. B GO:0086014 atrial cardiac muscle cell action potential
3. B GO:0016409 palmitoyltransferase activity
3. B GO:0008270 zinc ion binding
3. B GO:0003184 pulmonary valve morphogenesis
3. B GO:0046957 negative phototaxis
3. B GO:0030507 spectrin binding
3. B GO:0043518 negative regulation of DNA damage response, signal transduction by p53 class mediator
3. B GO:0003169 coronary vein morphogenesis
3. B GO:1904908 negative regulation of maintenance of mitotic sister chromatid cohesion, telomeric
3. B GO:0060528 secretory columnal luminar epithelial cell differentiation involved in prostate glandular acinus development
3. B GO:0002315 marginal zone B cell differentiation
3. B GO:0010832 negative regulation of myotube differentiation
3. B GO:0071532 ankyrin repeat binding
3. B GO:0070682 proteasome regulatory particle assembly
3. B GO:0070936 protein K48-linked ubiquitination
3. B GO:0070412 R-SMAD binding
3. B GO:0140439 protein-cysteine S-stearoyltransferase activity
3. B GO:0051438 regulation of ubiquitin-protein transferase activity
3. B GO:0045648 positive regulation of erythrocyte differentiation
3. B GO:0031143 pseudopodium
3. B GO:0051017 actin filament bundle assembly
3. B GO:1900087 positive regulation of G1/S transition of mitotic cell cycle
3. B GO:0032495 response to muramyl dipeptide
3. B GO:0007368 determination of left/right symmetry
3. B GO:0071244 cellular response to carbon dioxide
3. B GO:0060982 coronary artery morphogenesis
3. B GO:0007616 long-term memory
3. B GO:0045687 positive regulation of glial cell differentiation
3. B GO:0014069 postsynaptic density
3. B GO:0070431 nucleotide-binding oligomerization domain containing 2 signaling pathway
3. B GO:0001954 positive regulation of cell-matrix adhesion
3. B GO:0051726 regulation of cell cycle
3. B GO:0002268 follicular dendritic cell differentiation
3. B GO:0014912 negative regulation of smooth muscle cell migration
3. B GO:0031359 integral component of chloroplast outer membrane
3. B GO:0010780 meiotic DNA double-strand break formation involved in reciprocal meiotic recombination
3. B GO:0071407 cellular response to organic cyclic compound
3. B GO:0031867 EP4 subtype prostaglandin E2 receptor binding
3. B GO:0015248 sterol transporter activity
3. B GO:0048103 somatic stem cell division
3. B GO:0043266 regulation of potassium ion transport
3. B GO:0050955 thermoception
3. B GO:0060843 venous endothelial cell differentiation
3. B GO:2000651 positive regulation of sodium ion transmembrane transporter activity
3. B GO:0006528 asparagine metabolic process
3. B GO:0032496 response to lipopolysaccharide
3. B GO:0014065 phosphatidylinositol 3-kinase signaling
3. B GO:0140031 phosphorylation-dependent protein binding
3. B GO:0001934 positive regulation of protein phosphorylation
3. B GO:0050957 equilibrioception
3. B GO:0003207 cardiac chamber formation
3. B GO:0061384 heart trabecula morphogenesis
3. B GO:0043619 regulation of transcription from RNA polymerase II promoter in response to oxidative stress
3. B GO:0048060 negative gravitaxis
3. B GO:0072015 glomerular visceral epithelial cell development
3. B GO:2000304 positive regulation of ceramide biosynthetic process
3. B GO:0070171 negative regulation of tooth mineralization
3. B GO:0034703 cation channel complex
3. B GO:0019208 phosphatase regulator activity
3. B GO:0030315 T-tubule
3. B GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
3. B GO:0043280 positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
3. B GO:0003209 cardiac atrium morphogenesis
3. B GO:0090263 positive regulation of canonical Wnt signaling pathway
3. B GO:0048052 R1/R6 cell differentiation
3. B GO:1903670 regulation of sprouting angiogenesis
3. B GO:0021531 spinal cord radial glial cell differentiation
3. B GO:0010888 negative regulation of lipid storage
3. B GO:0010761 fibroblast migration
3. B GO:0005262 calcium channel activity
3. B GO:0017020 myosin phosphatase regulator activity
3. B GO:0008290 F-actin capping protein complex
3. B GO:0102545 phosphatidyl phospholipase B activity
3. B GO:0097062 dendritic spine maintenance
3. B GO:0031901 early endosome membrane
3. B GO:0031672 A band
3. B GO:0003213 cardiac right atrium morphogenesis
3. B GO:0045602 negative regulation of endothelial cell differentiation
3. B GO:0090575 RNA polymerase II transcription regulator complex
3. B GO:0050793 regulation of developmental process
3. B GO:0098910 regulation of atrial cardiac muscle cell action potential
3. B GO:0043194 axon initial segment
3. B GO:0009912 auditory receptor cell fate commitment
3. B GO:0030941 chloroplast targeting sequence binding
3. B GO:0099527 postsynapse to nucleus signaling pathway
3. B GO:0046849 bone remodeling
3. B GO:2000249 regulation of actin cytoskeleton reorganization
3. B GO:0048265 response to pain
3. B GO:0016279 protein-lysine N-methyltransferase activity
3. B GO:0043066 negative regulation of apoptotic process
3. B GO:0007165 signal transduction
3. B GO:1904355 positive regulation of telomere capping
3. B GO:0010745 negative regulation of macrophage derived foam cell differentiation
3. B GO:0033270 paranode region of axon
3. B GO:0001895 retina homeostasis
3. B GO:0031466 Cul5-RING ubiquitin ligase complex
3. B GO:1901223 negative regulation of NIK/NF-kappaB signaling
3. B GO:0097543 ciliary inversin compartment
3. B GO:0017124 SH3 domain binding
3. B GO:0003847 1-alkyl-2-acetylglycerophosphocholine esterase activity
3. B GO:0046822 regulation of nucleocytoplasmic transport
3. B GO:0003219 cardiac right ventricle formation
3. B GO:0001658 branching involved in ureteric bud morphogenesis
3. B GO:0017171 serine hydrolase activity
3. B GO:0072144 glomerular mesangial cell development
3. B GO:0016235 aggresome
3. B GO:0060956 endocardial cell differentiation
3. B GO:0042383 sarcolemma
3. B GO:1901189 positive regulation of ephrin receptor signaling pathway
3. B GO:0070427 nucleotide-binding oligomerization domain containing 1 signaling pathway
3. B GO:0030030 cell projection organization
3. B GO:0050931 pigment cell differentiation
3. B GO:0060038 cardiac muscle cell proliferation
3. B GO:0030029 actin filament-based process
3. B GO:0032212 positive regulation of telomere maintenance via telomerase
3. B GO:0002040 sprouting angiogenesis
3. B GO:0007569 cell aging
3. B GO:0045064 T-helper 2 cell differentiation
3. B GO:0061001 regulation of dendritic spine morphogenesis
3. B GO:2000279 negative regulation of DNA biosynthetic process
3. B GO:0045596 negative regulation of cell differentiation
3. B GO:0061025 membrane fusion
3. B GO:0051386 regulation of neurotrophin TRK receptor signaling pathway
3. B GO:1990393 3M complex
3. B GO:0060803 BMP signaling pathway involved in mesodermal cell fate specification
3. B GO:0045618 positive regulation of keratinocyte differentiation
3. B GO:0003180 aortic valve morphogenesis
3. B GO:1990705 cholangiocyte proliferation
3. B GO:0060013 righting reflex
3. B GO:0050968 detection of chemical stimulus involved in sensory perception of pain
3. B GO:0042246 tissue regeneration
3. B GO:0003157 endocardium development
3. B GO:0007229 integrin-mediated signaling pathway
3. B GO:0002455 humoral immune response mediated by circulating immunoglobulin
3. B GO:1903343 positive regulation of meiotic DNA double-strand break formation
3. B GO:0046533 negative regulation of photoreceptor cell differentiation
3. B GO:0097150 neuronal stem cell population maintenance
3. B GO:0060045 positive regulation of cardiac muscle cell proliferation
3. B GO:0048013 ephrin receptor signaling pathway
3. B GO:1901019 regulation of calcium ion transmembrane transporter activity
3. B GO:0035171 lamellocyte differentiation
3. B GO:0031625 ubiquitin protein ligase binding
3. B GO:1903849 positive regulation of aorta morphogenesis
3. B GO:0003713 transcription coactivator activity
3. B GO:0045162 clustering of voltage-gated sodium channels
3. B GO:0060413 atrial septum morphogenesis
3. B GO:0051865 protein autoubiquitination
3. B GO:0003192 mitral valve formation
3. B GO:0043065 positive regulation of apoptotic process
3. B GO:0008139 nuclear localization sequence binding
3. B GO:0030027 lamellipodium
3. B GO:0000415 negative regulation of histone H3-K36 methylation
3. B GO:0033268 node of Ranvier
3. B GO:0048665 neuron fate specification
3. B GO:0090200 positive regulation of release of cytochrome c from mitochondria
3. B GO:0003264 regulation of cardioblast proliferation
3. B GO:0019705 protein-cysteine S-myristoyltransferase activity
3. B GO:0010613 positive regulation of cardiac muscle hypertrophy
3. B GO:0001835 blastocyst hatching
3. B GO:0061314 Notch signaling involved in heart development
3. B GO:0008361 regulation of cell size
3. B GO:0071709 membrane assembly
3. B GO:0015278 calcium-release channel activity
3. B GO:0045921 positive regulation of exocytosis
3. B GO:0043422 protein kinase B binding
3. B GO:1990756 ubiquitin ligase-substrate adaptor activity
3. B GO:0060992 response to fungicide
3. B GO:2000463 positive regulation of excitatory postsynaptic potential
3. B GO:0016290 palmitoyl-CoA hydrolase activity
3. B GO:0014732 skeletal muscle atrophy
3. B GO:0030673 axolemma
3. B GO:0019899 enzyme binding
3. B GO:0060361 flight
3. B GO:0099173 postsynapse organization
3. B GO:0051570 regulation of histone H3-K9 methylation
3. B GO:0045466 R7 cell differentiation
3. B GO:0034587 piRNA metabolic process
3. B GO:0004857 enzyme inhibitor activity
3. B GO:2000974 negative regulation of pro-B cell differentiation
3. B GO:0060997 dendritic spine morphogenesis
3. B GO:0048845 venous blood vessel morphogenesis
3. B GO:1901018 positive regulation of potassium ion transmembrane transporter activity
3. B GO:0050714 positive regulation of protein secretion
3. B GO:0060135 maternal process involved in female pregnancy
3. B GO:0031663 lipopolysaccharide-mediated signaling pathway
3. B GO:2000311 regulation of AMPA receptor activity
3. B GO:0043055 maintenance of dauer
3. B GO:0086066 atrial cardiac muscle cell to AV node cell communication
3. B GO:1901021 positive regulation of calcium ion transmembrane transporter activity
3. B GO:1901224 positive regulation of NIK/NF-kappaB signaling
3. B GO:0060253 negative regulation of glial cell proliferation
3. B GO:0005925 focal adhesion
3. B GO:0050966 detection of mechanical stimulus involved in sensory perception of pain
3. B GO:0021707 cerebellar granule cell differentiation
3. B GO:0033256 I-kappaB/NF-kappaB complex
3. B GO:0014031 mesenchymal cell development
3. B GO:0051151 negative regulation of smooth muscle cell differentiation
3. B GO:0032991 protein-containing complex
3. B GO:0005829 cytosol
3. B GO:0046872 metal ion binding
3. B GO:0035544 negative regulation of SNARE complex assembly
3. B GO:0035508 positive regulation of myosin-light-chain-phosphatase activity
3. B GO:0097553 calcium ion transmembrane import into cytosol
3. B GO:0000139 Golgi membrane
3. B GO:0035556 intracellular signal transduction
3. B GO:0019706 protein-cysteine S-palmitoyltransferase activity
3. B GO:0003273 cell migration involved in endocardial cushion formation
3. B GO:0051572 negative regulation of histone H3-K4 methylation
3. B GO:1903793 positive regulation of anion transport
3. B GO:0070168 negative regulation of biomineral tissue development
3. B GO:0044354 macropinosome
3. B GO:0035507 regulation of myosin-light-chain-phosphatase activity
3. B GO:1904357 negative regulation of telomere maintenance via telomere lengthening
3. B GO:0061344 regulation of cell adhesion involved in heart morphogenesis
3. B GO:0032088 negative regulation of NF-kappaB transcription factor activity

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q5JPF3 Ankyrin repeat domain-containing protein 36C 3.86e-07 9.86e-90 0.0
1. PB Q9BXX3 Ankyrin repeat domain-containing protein 30A 2.07e-05 4.30e-26 2.58e-82
1. PB A6QL64 Ankyrin repeat domain-containing protein 36A 0 6.42e-164 0.0
1. PB Q8N2N9 Ankyrin repeat domain-containing protein 36B 1.61e-06 9.94e-40 0.0
1. PB Q9BXX2 Ankyrin repeat domain-containing protein 30B 3.90e-05 8.97e-25 5.78e-69
2. P A6NJ88 Putative SAGE1-like protein 9.19e-01 7.42e-03 NA
2. P Q8NA70 Protein FAM47B 9.41e-01 1.08e-05 NA
2. P Q08696 Axoneme-associated protein mst101(2) 4.34e-03 1.64e-02 NA
2. P E1BM58 Periaxin 5.89e-01 1.32e-02 NA
2. P P24710 Involucrin 2.78e-02 1.47e-05 NA
2. P Q5JRC9 Protein FAM47A 6.42e-01 4.27e-03 NA
2. P Q9JJ11 Transforming acidic coiled-coil-containing protein 3 2.13e-01 1.40e-04 NA
2. P E9Q6E9 SUMO-interacting motif-containing protein 1 9.06e-01 4.31e-03 NA
2. P Q2KI51 Protein phosphatase 1 regulatory subunit 15A 4.71e-01 1.32e-02 NA
2. P P39712 Flocculation protein FLO9 8.63e-01 2.67e-02 NA
2. P P17564 Protein phosphatase 1 regulatory subunit 15A 8.66e-01 3.41e-03 NA
2. P Q5HY64 Putative protein FAM47C 9.84e-01 6.96e-03 NA
2. P F1LWT0 SUMO-interacting motif-containing protein 1 7.84e-01 4.63e-05 NA
2. P O88492 Perilipin-4 4.40e-01 1.07e-07 NA
2. P P22006 Seminal vesicle secretory protein 2 8.32e-01 1.38e-03 NA
2. P P97347 Repetin 7.92e-02 1.59e-04 NA
2. P Q25060 LWamide neuropeptides 6.43e-01 8.82e-04 NA
2. P F4JZY1 COP1-interactive protein 1 2.18e-02 1.43e-02 NA
2. P Q28298 Ribosome-binding protein 1 1.46e-03 8.59e-03 NA
2. P O15069 NAC-alpha domain-containing protein 1 2.89e-01 6.28e-08 NA
2. P Q9BXM0 Periaxin 2.94e-01 2.28e-04 NA
2. P Q77Z83 Immediate-early protein 2 NA 9.74e-03 NA
2. P Q8XYE3 TAL effector protein Brg11 5.59e-01 1.76e-02 NA
2. P P21263 Nestin 2.70e-01 8.24e-03 NA
2. P F4HXQ7 Myosin-binding protein 1 4.31e-01 1.52e-03 NA
2. P Q9D9R9 Protein FAM186A 6.34e-01 3.38e-05 NA
2. P Q4ZJY7 Mucin-like protein Glc1.8b NA 1.52e-02 NA
2. P V6F519 Magnetosome-associated protein MamJ 7.99e-01 1.81e-03 NA
2. P Q99PL5 Ribosome-binding protein 1 9.57e-04 2.01e-02 NA
2. P P38894 Flocculation protein FLO5 8.72e-01 5.34e-03 NA
2. P Q8JZM8 Mucin-4 NA 3.92e-02 NA
2. P P0DKL2 Protein OPAQUE10 4.40e-01 4.42e-02 NA
2. P Q95337 Involucrin 2.56e-02 1.39e-02 NA
2. P Q8N307 Mucin-20 9.76e-01 4.93e-02 NA
2. P P18175 Involucrin 8.22e-03 7.26e-03 NA
2. P O36421 Uncharacterized gene 73 protein NA 2.05e-02 NA
2. P Q54G05 Putative leucine-rich repeat-containing protein DDB_G0290503 1.51e-03 4.44e-06 NA
2. P O55103 Periaxin 3.11e-01 1.03e-02 NA
2. P Q9C0Y2 Putative cell agglutination protein SPAPB2C8.01 1.00e+00 8.07e-03 NA
2. P Q9Z1Q1 Nestin (Fragments) 2.82e-01 1.52e-02 NA
2. P Q9URU4 Putative cell agglutination protein pfl5 9.81e-01 4.20e-02 NA
2. P Q35142 Uncharacterized mitochondrial protein urf-N 2.86e-02 6.33e-03 NA
2. P Q6P902 Thioredoxin domain-containing protein 2 4.71e-01 2.23e-02 NA
3. B Q9H560 Putative ankyrin repeat domain-containing protein 19 1.30e-05 NA 8.18e-63
3. B Q8BX02 KN motif and ankyrin repeat domain-containing protein 2 6.80e-01 NA 1.81e-04
3. B Q8VHS6 Ankyrin repeat and SOCS box protein 15 8.00e-03 NA 0.004
3. B Q5URB9 Putative ankyrin repeat protein R840 NA NA 0.004
3. B Q8IZ07 Ankyrin repeat domain-containing protein 13A 6.25e-01 NA 0.021
3. B Q9J5H9 Putative ankyrin repeat protein FPV022 NA NA 0.007
3. B Q8IUH5 Palmitoyltransferase ZDHHC17 1.21e-03 NA 1.12e-09
3. B Q54KA7 Ankyrin repeat, PH and SEC7 domain containing protein secG 2.30e-02 NA 1.84e-18
3. B Q0V8G2 GA-binding protein subunit beta-2 3.45e-02 NA 4.24e-13
3. B Q3MJ40 Coiled-coil domain-containing protein 144B 4.01e-01 NA 3.95e-22
3. B P59672 Ankyrin repeat and SAM domain-containing protein 1A 3.74e-02 NA 1.58e-05
3. B Q6AFL2 Putative ankyrin-containing lipoprotein Lxx09580 1.82e-03 NA 0.030
3. B O14974 Protein phosphatase 1 regulatory subunit 12A 2.25e-02 NA 1.85e-05
3. B Q99NH0 Ankyrin repeat domain-containing protein 17 1.02e-01 NA 6.39e-11
3. B Q7ZYD9 Ankyrin repeat domain-containing protein 13C-B 6.39e-01 NA 0.041
3. B A9JR78 Tonsoku-like protein 5.30e-01 NA 1.65e-04
3. B P57078 Receptor-interacting serine/threonine-protein kinase 4 3.22e-03 NA 1.97e-08
3. B Q6P9J5 KN motif and ankyrin repeat domain-containing protein 4 5.19e-01 NA 1.20e-06
3. B Q499M5 Ankyrin repeat domain-containing protein 16 1.45e-03 NA 2.99e-06
3. B Q3TYL0 IQ motif and ankyrin repeat domain-containing protein 1 8.73e-02 NA 0.022
3. B Q9Y575 Ankyrin repeat and SOCS box protein 3 3.78e-04 NA 6.94e-12
3. B Q1LZC5 Ankyrin repeat domain-containing protein 54 3.19e-01 NA 2.82e-06
3. B P0C6P7 Protein fem-1 homolog B 3.19e-02 NA 6.99e-06
3. B Q8CEF1 Protein fem-1 homolog C 2.32e-02 NA 0.004
3. B Q9WV74 Ankyrin repeat and SOCS box protein 1 4.85e-03 NA 0.011
3. B Q9J5H8 Putative ankyrin repeat protein FPV023 NA NA 2.66e-04
3. B D3J162 Protein VAPYRIN 3.74e-02 NA 1.16e-05
3. B Q0P5B9 Ankyrin repeat domain-containing protein 39 3.17e-02 NA 2.15e-06
3. B Q4UJ75 Putative ankyrin repeat domain-containing protein 20A4 6.10e-03 NA 2.84e-59
3. B Q06527 Ankyrin homolog 2.43e-04 NA 7.74e-09
3. B Q8N7Z5 Ankyrin repeat domain-containing protein 31 3.07e-01 NA 1.92e-05
3. B Q01317 Ankyrin repeat protein nuc-2 1.32e-01 NA 8.58e-10
3. B Q566C8 Ankyrin repeat domain-containing protein 54 1.57e-01 NA 8.42e-06
3. B Q641X1 Ankyrin repeat domain-containing protein 61 1.43e-03 NA 5.96e-04
3. B P14585 Protein lin-12 4.60e-01 NA 0.001
3. B Q96T49 Protein phosphatase 1 regulatory inhibitor subunit 16B 8.92e-03 NA 0.003
3. B O14593 DNA-binding protein RFXANK 2.18e-03 NA 3.98e-06
3. B Q99466 Neurogenic locus notch homolog protein 4 9.87e-01 NA 0.003
3. B Q9Y576 Ankyrin repeat and SOCS box protein 1 4.37e-03 NA 0.005
3. B Q07E41 Cortactin-binding protein 2 2.51e-01 NA 9.27e-05
3. B P62774 Myotrophin 3.67e-03 NA 2.79e-05
3. B Q8K4M9 Oxysterol-binding protein-related protein 1 2.47e-01 NA 0.045
3. B Q9Z2X2 26S proteasome non-ATPase regulatory subunit 10 2.52e-06 NA 2.27e-11
3. B Q95N27 Protein phosphatase 1 regulatory inhibitor subunit 16B 8.58e-03 NA 0.006
3. B P97819 85/88 kDa calcium-independent phospholipase A2 1.34e-01 NA 9.78e-05
3. B Q8N6S4 Ankyrin repeat domain-containing protein 13C 8.06e-01 NA 0.027
3. B Q5UPB9 Putative ankyrin repeat protein L42 NA NA 5.87e-04
3. B Q9WV06 Ankyrin repeat domain-containing protein 2 4.94e-02 NA 3.63e-10
3. B Q02357 Ankyrin-1 1.46e-01 NA 2.61e-15
3. B O44997 Death-associated protein kinase dapk-1 1.06e-01 NA 4.27e-04
3. B Q5FVC7 Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 2.66e-01 NA 4.48e-05
3. B P41412 Cell division cycle-related protein res2/pct1 3.97e-01 NA 3.41e-04
3. B Q4ULZ2 Putative ankyrin repeat protein RF_0580 8.59e-06 NA 7.13e-09
3. B Q8N8A2 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B 4.28e-03 NA 2.63e-15
3. B Q9D504 Ankyrin repeat domain-containing protein 7 3.80e-08 NA 7.60e-50
3. B Q9NU02 Ankyrin repeat and EF-hand domain-containing protein 1 1.22e-01 NA 1.60e-05
3. B Q29RM5 Protein fem-1 homolog A 3.81e-03 NA 0.024
3. B Q5ZK62 Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 1.84e-01 NA 1.14e-05
3. B Q5TYM7 CARD- and ANK-domain containing inflammasome adapter protein 4.99e-03 NA 3.40e-13
3. B Q5U312 Ankycorbin 1.27e-02 NA 7.38e-11
3. B Q21920 Ankyrin repeat and KH domain-containing protein mask-1 3.67e-01 NA 2.11e-07
3. B Q65XV2 E3 ubiquitin-protein ligase XB3 4.94e-02 NA 3.57e-04
3. B Q5R6D7 Ankyrin repeat and SOCS box protein 8 5.64e-03 NA 4.38e-12
3. B S0DPL8 Apicidin F cluster transcription factor apf2 3.41e-02 NA 2.16e-05
3. B Q8IV38 Ankyrin repeat and MYND domain-containing protein 2 4.52e-01 NA 0.005
3. B A1ZBY1 Protein fem-1 homolog B 5.05e-02 NA 0.002
3. B Q08353 NF-kappa-B inhibitor alpha 2.32e-02 NA 5.98e-06
3. B Q554E7 Putative ZDHHC-type palmitoyltransferase 5 2.12e-01 NA 7.95e-04
3. B Q14DN9 Ankyrin repeat and death domain-containing protein 1B 2.51e-03 NA 5.09e-07
3. B Q9VUX2 E3 ubiquitin-protein ligase mind-bomb 7.25e-02 NA 8.87e-08
3. B Q9SQK3 Ankyrin repeat domain-containing protein EMB506, chloroplastic 2.42e-02 NA 7.64e-06
3. B Q7T0Q1 Myotrophin 4.81e-03 NA 2.79e-05
3. B Q6P6B7 Ankyrin repeat domain-containing protein 16 1.11e-03 NA 2.10e-07
3. B A2AQH4 BCL-6 corepressor-like protein 1 3.30e-01 NA 3.48e-04
3. B O70511 Ankyrin-3 1.69e-01 NA 1.28e-13
3. B Q90623 Protein phosphatase 1 regulatory subunit 12A 1.42e-02 NA 3.14e-05
3. B Q3U0D9 E3 ubiquitin-protein ligase HACE1 1.72e-01 NA 1.73e-07
3. B Q5R8C8 Ankyrin repeat domain-containing protein 46 8.61e-02 NA 1.71e-04
3. B Q9Z2X3 26S proteasome non-ATPase regulatory subunit 10 2.14e-06 NA 2.59e-09
3. B Q9TXQ1 Poly [ADP-ribose] polymerase tankyrase 5.00e-01 NA 6.90e-09
3. B Q7Z8U2 Palmitoyltransferase akr1 6.90e-03 NA 6.52e-09
3. B Q7T163 Kinase D-interacting substrate of 220 kDa B 5.52e-01 NA 3.61e-11
3. B Q9J505 Putative ankyrin repeat protein FPV230 NA NA 3.13e-06
3. B Q68DC2 Ankyrin repeat and SAM domain-containing protein 6 2.93e-02 NA 1.02e-04
3. B A1X154 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 5.64e-02 NA 0.001
3. B Q7XUW4 Potassium channel KOR2 3.94e-01 NA 3.30e-07
3. B Q6RI86 Transient receptor potential cation channel subfamily A member 1 3.00e-01 NA 0.011
3. B Q15057 Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 1.69e-01 NA 1.46e-04
3. B Q1RMI3 GA-binding protein subunit beta-1 3.28e-02 NA 3.37e-12
3. B Q9WV48 SH3 and multiple ankyrin repeat domains protein 1 2.44e-03 NA 0.002
3. B Q4UJY2 Putative ankyrin repeat protein RF_1306 3.95e-02 NA 0.026
3. B D3J163 Protein VAPYRIN-LIKE 2.31e-03 NA 3.92e-06
3. B Q10311 Ankyrin repeat-containing protein C6C3.08 9.72e-05 NA 5.11e-08
3. B A2A690 Protein TANC2 1.12e-01 NA 6.78e-11
3. B A5A3E0 POTE ankyrin domain family member F 8.31e-02 NA 2.44e-55
3. B Q07DW4 Cortactin-binding protein 2 4.02e-01 NA 1.14e-05
3. B Q6KAE5 Probable E3 ubiquitin-protein ligase XBOS32 6.00e-02 NA 0.006
3. B Q4R3S3 Ankyrin repeat domain-containing protein 7 2.84e-06 NA 1.51e-47
3. B Q38898 Potassium channel AKT2/3 5.13e-01 NA 0.018
3. B Q8CGN4 BCL-6 corepressor 3.08e-01 NA 2.44e-04
3. B Q7T3P8 Protein fem-1 homolog C 5.78e-03 NA 0.001
3. B Q9Z2F6 B-cell lymphoma 3 protein homolog 6.03e-03 NA 8.70e-12
3. B Q8BXP5 Photoreceptor ankyrin repeat protein 1.16e-01 NA 0.003
3. B O83515 Putative ankyrin repeat-containing protein TP_0502 7.58e-02 NA 2.22e-09
3. B A7MB89 Protein fem-1 homolog C 2.38e-02 NA 0.004
3. B Q9WTT2 Caseinolytic peptidase B protein homolog 7.54e-01 NA 0.012
3. B Q80T11 Usher syndrome type-1G protein homolog 8.50e-01 NA 0.002
3. B Q9D2J7 Ankyrin repeat and EF-hand domain-containing protein 1 6.61e-03 NA 4.53e-05
3. B Q9D119 Protein phosphatase 1 regulatory subunit 27 1.03e-01 NA 2.90e-05
3. B Q9H2K2 Poly [ADP-ribose] polymerase tankyrase-2 1.09e-01 NA 1.11e-09
3. B Q9D061 Acyl-CoA-binding domain-containing protein 6 1.56e-01 NA 4.82e-04
3. B Q8VHA6 Ankyrin repeat and SOCS box protein 18 1.44e-03 NA 0.005
3. B Q06547 GA-binding protein subunit beta-1 2.43e-02 NA 2.41e-12
3. B Q91ZT7 Ankyrin repeat and SOCS box protein 10 2.01e-03 NA 2.59e-08
3. B A6NHY2 Ankyrin repeat and death domain-containing protein 1B 2.81e-03 NA 0.002
3. B P55273 Cyclin-dependent kinase 4 inhibitor D 8.71e-04 NA 0.013
3. B Q5RCK5 Ankyrin repeat and SOCS box protein 7 1.98e-04 NA 6.23e-06
3. B Q8UVC1 Inversin 1.04e-02 NA 1.56e-10
3. B Q5SQ80 Putative ankyrin repeat domain-containing protein 20A2 6.28e-01 NA 1.22e-59
3. B Q2IBD4 Cortactin-binding protein 2 3.04e-01 NA 0.002
3. B P0CG39 POTE ankyrin domain family member J 1.98e-02 NA 7.52e-54
3. B P46530 Neurogenic locus notch homolog protein 1 2.05e-01 NA 2.32e-06
3. B Q6TGW5 Osteoclast-stimulating factor 1 1.84e-02 NA 0.002
3. B Q63618 Espin 3.93e-02 NA 5.90e-05
3. B Q1RIZ4 Putative ankyrin repeat protein RBE_0589 6.33e-02 NA 1.10e-06
3. B B9EJA2 Cortactin-binding protein 2 4.20e-01 NA 3.78e-04
3. B Q8CGB3 Uveal autoantigen with coiled-coil domains and ankyrin repeats 2.93e-02 NA 9.19e-12
3. B Q3UES3 Poly [ADP-ribose] polymerase tankyrase-2 8.81e-02 NA 1.67e-09
3. B A5WVX9 Palmitoyltransferase ZDHHC17 1.07e-03 NA 3.74e-10
3. B Q9J504 Putative ankyrin repeat protein FPV231 NA NA 1.96e-11
3. B Q91ZT9 Ankyrin repeat and SOCS box protein 8 5.36e-03 NA 7.98e-12
3. B Q6W2J9 BCL-6 corepressor 1.02e-01 NA 2.44e-04
3. B Q9Y2G4 Ankyrin repeat domain-containing protein 6 1.18e-02 NA 3.01e-09
3. B F1LTE0 Protein TANC2 9.91e-02 NA 7.19e-11
3. B B1AK53 Espin 8.07e-02 NA 0.011
3. B Q495M9 Usher syndrome type-1G protein 5.90e-01 NA 0.002
3. B Q9ERC1 Unconventional myosin-XVI 8.18e-01 NA 1.31e-04
3. B Q9P2R3 Rabankyrin-5 7.40e-03 NA 0.006
3. B Q8BZ25 Ankyrin repeat and protein kinase domain-containing protein 1 3.11e-04 NA 4.34e-11
3. B Q8UVC3 Inversin 1.02e-01 NA 1.53e-11
3. B P13508 Protein glp-1 4.69e-02 NA 1.09e-05
3. B Q9SCX5 Probable potassium channel AKT5 2.49e-01 NA 2.01e-06
3. B Q05823 2-5A-dependent ribonuclease 5.76e-02 NA 1.63e-07
3. B P57044 Integrin-linked protein kinase 5.74e-02 NA 2.44e-07
3. B Q8ZWC4 Putative ankyrin repeat protein PAE1861 1.56e-04 NA 2.59e-06
3. B O54910 NF-kappa-B inhibitor epsilon 2.60e-05 NA 9.22e-06
3. B Q4X251 Palmitoyltransferase akr1 2.30e-03 NA 2.08e-08
3. B Q08E43 Ankyrin repeat and SOCS box protein 8 1.32e-02 NA 2.35e-11
3. B Q5UPG6 Putative ankyrin repeat protein L92 NA NA 0.005
3. B Q8VBX0 Ankyrin repeat and SOCS box protein 13 2.26e-05 NA 2.37e-11
3. B B7WN72 Protein shank 7.03e-02 NA 0.013
3. B Q14678 KN motif and ankyrin repeat domain-containing protein 1 6.75e-01 NA 0.002
3. B Q9BXW6 Oxysterol-binding protein-related protein 1 1.13e-01 NA 0.002
3. B Q9Z205 DNA-binding protein RFXANK 2.30e-03 NA 0.006
3. B Q00653 Nuclear factor NF-kappa-B p100 subunit 2.22e-02 NA 1.57e-08
3. B Q5ZLC8 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C 3.92e-03 NA 6.85e-14
3. B Q68LP1 E3 ubiquitin-protein ligase MIB2 5.02e-02 NA 8.99e-04
3. B Q01484 Ankyrin-2 NA NA 1.03e-17
3. B Q9UK73 Protein fem-1 homolog B 2.70e-02 NA 4.30e-06
3. B F8W2M1 E3 ubiquitin-protein ligase HACE1 2.79e-02 NA 4.06e-08
3. B Q9WV71 Ankyrin repeat and SOCS box protein 4 1.11e-03 NA 7.01e-04
3. B Q9J513 Putative ankyrin repeat protein FPV222 NA NA 1.54e-07
3. B Q9DBR7 Protein phosphatase 1 regulatory subunit 12A 2.49e-03 NA 1.92e-05
3. B Q9U518 L-asparaginase 3.89e-02 NA 1.93e-07
3. B Q9Y283 Inversin 7.32e-03 NA 7.16e-12
3. B Q9J512 Putative ankyrin repeat protein FPV223 NA NA 0.001
3. B Q495B1 Ankyrin repeat and death domain-containing protein 1A 5.64e-04 NA 4.16e-13
3. B Q9M8S6 Potassium channel SKOR 6.67e-01 NA 1.04e-09
3. B Q9ULH0 Kinase D-interacting substrate of 220 kDa 5.76e-01 NA 3.11e-14
3. B G3I6Z6 Neurogenic locus notch homolog protein 1 NA NA 6.54e-05
3. B Q9BGT9 Ankyrin repeat and SOCS box protein 7 1.63e-04 NA 2.40e-06
3. B Q5XJ13 Ankyrin repeat and SAM domain-containing protein 6 4.67e-02 NA 0.005
3. B P14360 Putative ankyrin repeat protein FPV240 NA NA 1.43e-08
3. B O70445 BRCA1-associated RING domain protein 1 1.22e-01 NA 7.10e-06
3. B Q4UKJ3 Putative ankyrin repeat protein RF_1087 4.38e-02 NA 6.54e-05
3. B Q5UPG5 Putative ankyrin repeat protein L93 NA NA 1.68e-09
3. B Q9WV72 Ankyrin repeat and SOCS box protein 3 2.33e-03 NA 3.19e-09
3. B Q9J502 Putative ankyrin repeat protein FPV233 NA NA 3.24e-09
3. B Q86SG2 Ankyrin repeat domain-containing protein 23 1.05e-02 NA 7.27e-07
3. B Q91WK7 Ankyrin repeat domain-containing protein 54 1.81e-01 NA 9.54e-06
3. B Q876L4 Probable palmitoyltransferase AKR2 1.26e-02 NA 1.76e-05
3. B Q5U2S6 Ankyrin repeat and SOCS box protein 2 1.31e-03 NA 2.42e-08
3. B Q80SY4 E3 ubiquitin-protein ligase MIB1 6.75e-02 NA 5.03e-07
3. B Q876L5 Palmitoyltransferase AKR1 1.39e-02 NA 0.011
3. B Q4I8B6 Palmitoyltransferase AKR1 1.01e-04 NA 2.06e-10
3. B P16157 Ankyrin-1 3.25e-01 NA 1.73e-15
3. B Q5VUR7 Putative ankyrin repeat domain-containing protein 20A3 5.06e-04 NA 1.61e-59
3. B O88202 60 kDa lysophospholipase 8.07e-02 NA 0.045
3. B Q502M6 Ankyrin repeat domain-containing protein 29 8.14e-04 NA 6.00e-06
3. B Q337A0 Probable E3 ubiquitin-protein ligase XBOS33 3.21e-02 NA 0.011
3. B Q6S8J3 POTE ankyrin domain family member E 4.93e-03 NA 2.16e-55
3. B Q96I34 Protein phosphatase 1 regulatory subunit 16A 1.76e-01 NA 0.034
3. B Q0VGY8 Protein TANC1 2.46e-01 NA 6.07e-10
3. B P0C0T2 Ankyrin repeat and SAM domain-containing protein 6 1.08e-01 NA 9.09e-05
3. B O95271 Poly [ADP-ribose] polymerase tankyrase-1 1.81e-01 NA 2.21e-10
3. B G0LXV8 Alpha-latrotoxin-Lh1a (Fragment) 1.10e-02 NA 1.75e-05
3. B Q8WWX0 Ankyrin repeat and SOCS box protein 5 7.85e-04 NA 7.44e-04
3. B Q15027 Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 1.77e-01 NA 7.87e-05
3. B Q9Y566 SH3 and multiple ankyrin repeat domains protein 1 6.77e-03 NA 0.007
3. B Q653P0 Potassium channel KOR1 5.00e-01 NA 4.27e-09
3. B Q6PFX9 Poly [ADP-ribose] polymerase tankyrase-1 5.32e-02 NA 2.61e-10
3. B Q9J5I3 Putative ankyrin repeat protein FPV018 NA NA 6.04e-08
3. B Q2IBG0 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 4.72e-02 NA 0.028
3. B Q94B55 Putative E3 ubiquitin-protein ligase XBAT31 9.86e-03 NA 1.70e-07
3. B Q6P1S6 Myotrophin 5.33e-03 NA 6.27e-06
3. B C7B178 Protein VAPYRIN 1.09e-02 NA 2.54e-06
3. B Q9D1A4 Ankyrin repeat and SOCS box protein 5 8.30e-04 NA 0.001
3. B Q5R4M7 Ankyrin repeat and SOCS box protein 6 1.85e-02 NA 8.68e-06
3. B Q875M2 Palmitoyltransferase AKR1 9.11e-03 NA 2.96e-05
3. B Q71S21 Inversin-B 3.54e-02 NA 1.06e-12
3. B Q8VHK2 Caskin-1 2.08e-02 NA 3.41e-10
3. B Q29Q26 Ankyrin repeat domain-containing protein 2B 3.27e-01 NA 1.25e-07
3. B Q7Z020 Transient receptor potential cation channel subfamily A member 1 4.03e-01 NA 0.002
3. B Q6DGX3 Ankyrin repeat domain-containing protein 54 1.38e-01 NA 7.58e-06
3. B Q9P0K7 Ankycorbin 3.24e-01 NA 1.10e-09
3. B Q3V096 Ankyrin repeat domain-containing protein 42 9.68e-03 NA 2.16e-08
3. B Q4P6L3 Palmitoyltransferase AKR1 5.10e-03 NA 0.001
3. B Q96AX9 E3 ubiquitin-protein ligase MIB2 4.08e-02 NA 0.005
3. B A0A3L7I2I8 85/88 kDa calcium-independent phospholipase A2 5.23e-02 NA 1.58e-04
3. B Q5RFS1 Ankyrin repeat and SOCS box protein 11 1.05e-03 NA 0.005
3. B Q5DU14 Unconventional myosin-XVI 5.03e-01 NA 1.06e-04
3. B Q5UPH0 Putative ankyrin repeat protein L100 NA NA 6.77e-06
3. B Q86YR6 POTE ankyrin domain family member D 2.70e-03 NA 9.22e-60
3. B Q923M0 Protein phosphatase 1 regulatory subunit 16A 2.56e-02 NA 2.13e-04
3. B Q8N9B4 Ankyrin repeat domain-containing protein 42 1.90e-03 NA 2.83e-04
3. B Q15653 NF-kappa-B inhibitor beta 3.95e-02 NA 1.62e-04
3. B Q07E28 Cortactin-binding protein 2 8.72e-02 NA 3.77e-05
3. B Q5H9F3 BCL-6 corepressor-like protein 1 1.91e-01 NA 7.44e-04
3. B Q8WXK3 Ankyrin repeat and SOCS box protein 13 2.77e-05 NA 3.46e-11
3. B Q5TYW2 Ankyrin repeat domain-containing protein 20A1 2.76e-02 NA 2.64e-59
3. B Q5GIG6 Serine/threonine-protein kinase TNNI3K 1.15e-03 NA 1.23e-06
3. B Q92625 Ankyrin repeat and SAM domain-containing protein 1A 4.10e-02 NA 3.68e-07
3. B Q3UUF8 Ankyrin repeat domain-containing protein 34B 1.53e-01 NA 0.007
3. B Q09YI3 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 3.54e-02 NA 0.028
3. B Q9J5I9 Putative ankyrin repeat protein FPV012 NA NA 5.61e-05
3. B A0M8T5 Cortactin-binding protein 2 6.36e-01 NA 6.96e-05
3. B Q2KI79 Ankyrin repeat family A protein 2 2.70e-02 NA 1.47e-07
3. B Q5ZM55 Protein fem-1 homolog B 2.56e-02 NA 3.18e-05
3. B Q07E15 Cortactin-binding protein 2 9.31e-01 NA 9.53e-06
3. B Q6UB98 Ankyrin repeat domain-containing protein 12 8.01e-02 NA 2.57e-04
3. B Q9XZC0 Alpha-latrocrustotoxin-Lt1a (Fragment) 2.56e-02 NA 2.21e-08
3. B A6QPE7 Ankyrin repeat domain-containing protein 65 1.65e-04 NA 3.66e-08
3. B Q94A76 Potassium channel GORK 6.83e-01 NA 6.15e-11
3. B Q8Q0U0 Putative ankyrin repeat protein MM_0045 4.93e-05 NA 1.31e-13
3. B Q93650 Putative glutaminase 3 7.86e-01 NA 1.89e-04
3. B Q54KH3 Ankyrin repeat domain-containing protein 39 homolog 6.31e-02 NA 0.004
3. B O35516 Neurogenic locus notch homolog protein 2 5.25e-01 NA 1.28e-05
3. B Q5VYY1 Ankyrin repeat domain-containing protein 22 2.92e-04 NA 7.28e-04
3. B Q755Y0 Palmitoyltransferase AKR1 1.05e-02 NA 7.85e-04
3. B Q03017 NF-kappa-B inhibitor cactus 2.35e-04 NA 6.50e-05
3. B B8N0E6 Ankyrin-repeat domain containing transcription coregulator asaA 8.62e-01 NA 0.048
3. B O75762 Transient receptor potential cation channel subfamily A member 1 2.34e-01 NA 1.63e-04
3. B Q5M9H0 Ankyrin repeat and SAM domain-containing protein 3 1.44e-01 NA 1.92e-11
3. B Q9CQM6 Ankyrin repeat domain-containing protein 61 1.43e-03 NA 3.51e-04
3. B Q6NY19 KN motif and ankyrin repeat domain-containing protein 3 5.98e-02 NA 2.06e-06
3. B A0M8S4 Cortactin-binding protein 2 5.01e-01 NA 1.28e-06
3. B Q9Z1E3 NF-kappa-B inhibitor alpha 1.07e-02 NA 1.31e-05
3. B Q9TU71 Ankyrin repeat domain-containing protein 1 2.49e-02 NA 3.08e-08
3. B E9Q4F7 Ankyrin repeat domain-containing protein 11 1.60e-01 NA 1.02e-08
3. B Q18297 Transient receptor potential cation channel subfamily A member 1 homolog 5.54e-01 NA 0.034
3. B Q1RJN6 Putative ankyrin repeat protein RBE_0347 8.58e-02 NA 2.75e-06
3. B A6QR20 SMC5-SMC6 complex localization factor protein 1 7.85e-01 NA 0.046
3. B P98150 Nuclear factor NF-kappa-B p100 subunit 1.31e-01 NA 1.59e-08
3. B Q5RF15 Serine/threonine-protein kinase TNNI3K 1.08e-01 NA 1.79e-08
3. B Q9VFD5 Protein fem-1 homolog CG6966 8.71e-02 NA 9.97e-05
3. B Q6P9K8 Caskin-1 1.64e-02 NA 8.40e-10
3. B Q2T9W8 Ankyrin repeat domain-containing protein 61 2.52e-03 NA 0.017
3. B Q2IBA2 Cortactin-binding protein 2 6.22e-01 NA 1.29e-06
3. B Q812A3 Ankyrin repeat domain-containing protein 23 1.90e-02 NA 2.96e-07
3. B Q3SWY2 Integrin-linked protein kinase 5.99e-02 NA 6.12e-07
3. B A5PMU4 Ankyrin repeat and sterile alpha motif domain-containing protein 1B 3.64e-02 NA 1.25e-10
3. B Q876A6 Palmitoyltransferase AKR1 1.44e-02 NA 5.58e-04
3. B Q96KQ7 Histone-lysine N-methyltransferase EHMT2 9.44e-02 NA 1.74e-12
3. B Q6GNY1 E3 ubiquitin-protein ligase mib1 9.16e-03 NA 1.62e-06
3. B Q91ZU0 Ankyrin repeat and SOCS box protein 7 8.21e-06 NA 3.99e-06
3. B Q91ZT8 Ankyrin repeat and SOCS box protein 9 5.79e-04 NA 8.63e-09
3. B Q5UPV1 Putative ankyrin repeat protein L271 NA NA 0.002
3. B A2A2Z9 Ankyrin repeat domain-containing protein 18B 1.39e-04 NA 1.40e-63
3. B Q9J5H7 Putative ankyrin repeat protein FPV024 NA NA 8.37e-09
3. B Q09701 Palmitoyltransferase akr1 1.56e-02 NA 0.037
3. B Q8WXI3 Ankyrin repeat and SOCS box protein 10 1.76e-03 NA 0.028
3. B Q01705 Neurogenic locus notch homolog protein 1 1.51e-01 NA 7.42e-05
3. B P0C550 Potassium channel AKT1 1.57e-01 NA 3.38e-06
3. B X1WE18 KN motif and ankyrin repeat domain-containing protein 2 7.65e-01 NA 0.008
3. B Q8WXK1 Ankyrin repeat and SOCS box protein 15 7.64e-03 NA 9.64e-06
3. B Q2IBF8 Cortactin-binding protein 2 7.71e-01 NA 1.04e-04
3. B Q2T9K6 Protein fem-1 homolog C 2.69e-02 NA 1.06e-05
3. B Q9ULJ7 Ankyrin repeat domain-containing protein 50 1.03e-01 NA 5.07e-14
3. B P0C927 Ankyrin repeat and SOCS box protein 14 2.96e-03 NA 1.35e-09
3. B Q8VHK1 Caskin-2 3.36e-02 NA 8.70e-06
3. B Q9Y6X6 Unconventional myosin-XVI 6.86e-01 NA 2.71e-05
3. B Q8K2H4 Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 2.30e-01 NA 1.25e-04
3. B A5PK26 Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 2.17e-01 NA 0.001
3. B Q9ZCL3 Putative ankyrin repeat protein RP714 9.22e-03 NA 0.003
3. B P46531 Neurogenic locus notch homolog protein 1 3.69e-01 NA 7.31e-05
3. B Q2IBE6 Cortactin-binding protein 2 1.16e-01 NA 1.56e-05
3. B Q3ZBX7 Ankyrin repeat domain-containing protein 1 1.40e-02 NA 5.26e-07
3. B Q4V869 Acyl-CoA-binding domain-containing protein 6 2.63e-01 NA 9.98e-05
3. B Q09YG9 Cortactin-binding protein 2 7.38e-01 NA 6.45e-05
3. B Q8HXA6 Ankyrin repeat and SOCS box protein 15 8.34e-03 NA 0.001
3. B Q91ZU1 Ankyrin repeat and SOCS box protein 6 1.05e-02 NA 2.15e-06
3. B Q96NS5 Ankyrin repeat and SOCS box protein 16 2.60e-03 NA 0.034
3. B Q52T38 Protein S-acyltransferase 24 2.94e-02 NA 0.049
3. B P0C6S7 Ankyrin repeat and sterile alpha motif domain-containing protein 1B 4.73e-02 NA 1.42e-07
3. B P0C6C1 Ankyrin repeat domain-containing protein 34C 2.92e-01 NA 8.06e-06
3. B Q9C6C3 ADP-ribosylation factor GTPase-activating protein AGD2 1.85e-02 NA 5.11e-05
3. B Q96JP0 Protein fem-1 homolog C 2.31e-02 NA 0.004
3. B F1N6G5 E3 ubiquitin-protein ligase HACE1 4.70e-02 NA 9.25e-07
3. B Q8NFD2 Ankyrin repeat and protein kinase domain-containing protein 1 2.12e-04 NA 3.74e-12
3. B Q865U8 Ankyrin repeat domain-containing protein 1 1.26e-02 NA 4.82e-08
3. B Q9DF58 Integrin-linked protein kinase 9.58e-02 NA 1.28e-05
3. B Q3SZE4 Ankyrin repeat and SOCS box protein 11 1.69e-03 NA 5.35e-04
3. B O60237 Protein phosphatase 1 regulatory subunit 12B 3.23e-02 NA 3.57e-05
3. B Q9SMX5 ADP-ribosylation factor GTPase-activating protein AGD4 1.83e-01 NA 0.003
3. B Q1LZH7 KN motif and ankyrin repeat domain-containing protein 2 8.00e-01 NA 4.77e-05
3. B Q8WVL7 Ankyrin repeat domain-containing protein 49 8.02e-02 NA 0.001
3. B Q3UX43 Ankyrin repeat domain-containing protein 13C 7.93e-01 NA 0.037
3. B Q8NF67 Putative ankyrin repeat domain-containing protein 20A12 pseudogene 4.92e-04 NA 2.24e-15
3. B A2VDR2 Acyl-CoA-binding domain-containing protein 6 1.68e-01 NA 3.43e-06
3. B Q00PJ1 Cortactin-binding protein 2 4.08e-01 NA 3.65e-06
3. B Q54BA2 Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 1.95e-01 NA 2.80e-06
3. B Q9VCA8 Ankyrin repeat and KH domain-containing protein mask NA NA 1.06e-11
3. B Q04861 Nuclear factor NF-kappa-B p105 subunit 5.14e-02 NA 0.001
3. B Q25338 Delta-latroinsectotoxin-Lt1a 2.38e-02 NA 4.17e-09
3. B Q15327 Ankyrin repeat domain-containing protein 1 1.09e-02 NA 1.47e-08
3. B Q5EA33 Ankyrin repeat domain-containing protein 49 2.56e-02 NA 0.010
3. B Q86YT6 E3 ubiquitin-protein ligase MIB1 1.64e-02 NA 5.85e-07
3. B Q94CT7 Probable E3 ubiquitin-protein ligase XBOS31 1.52e-02 NA 8.16e-08
3. B Q9TZC4 Integrin-linked protein kinase homolog pat-4 1.68e-01 NA 5.39e-04
3. B O89019 Inversin 1.37e-01 NA 1.73e-10
3. B Q66JD7 Acyl-CoA-binding domain-containing protein 6 2.44e-01 NA 7.98e-05
3. B Q53RE8 Ankyrin repeat domain-containing protein 39 4.98e-04 NA 2.78e-05
3. B Q54HW1 26S proteasome non-ATPase regulatory subunit 10 7.96e-06 NA 4.83e-16
3. B Q9J4Z8 Putative ankyrin repeat protein FPV242 NA NA 0.001
3. B Q69ZU8 Ankyrin repeat domain-containing protein 6 3.33e-02 NA 8.72e-10
3. B Q8WMX8 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 1.54e-02 NA 0.035
3. B Q0JKV1 Potassium channel AKT1 5.45e-01 NA 3.47e-06
3. B Q2IBB2 Cortactin-binding protein 2 2.45e-01 NA 4.22e-04
3. B Q9EQG6 Kinase D-interacting substrate of 220 kDa 8.54e-01 NA 2.67e-14
3. B Q5ZLC6 Ankyrin repeat domain-containing protein 10 8.68e-02 NA 0.030
3. B Q4KL97 Ankyrin repeat domain-containing protein 1 9.48e-03 NA 5.55e-06
3. B Q91955 Myotrophin 4.00e-03 NA 1.25e-05
3. B P14368 Putative ankyrin repeat protein FPV234 NA NA 5.77e-04
3. B P58546 Myotrophin 3.65e-03 NA 8.02e-05
3. B Q2QLG9 Cortactin-binding protein 2 7.60e-01 NA 1.44e-05
3. B Q4R544 Ankyrin repeat and SOCS box protein 8 2.21e-02 NA 6.83e-12
3. B Q9J5A7 Putative ankyrin repeat protein FPV115 NA NA 1.06e-06
3. B Q9J4Z6 Putative ankyrin repeat protein FPV244 NA NA 2.91e-07
3. B B2RU33 POTE ankyrin domain family member C 2.49e-03 NA 1.60e-59
3. B Q6NSI1 Putative ankyrin repeat domain-containing protein 26-like protein 2.27e-02 NA 8.00e-47
3. B P0CG38 POTE ankyrin domain family member I 3.70e-02 NA 7.52e-54
3. B A0JP26 POTE ankyrin domain family member B3 1.83e-03 NA 9.42e-61
3. B O74205 Transcription factor TOXE 4.69e-02 NA 0.003
3. B Q09YJ5 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 5.19e-02 NA 0.028
3. B Q6S5H5 POTE ankyrin domain family member G 4.47e-03 NA 6.99e-60
3. B P77736 Putative ankyrin repeat protein YahD 6.49e-06 NA 3.24e-05
3. B Q5F478 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B 4.16e-03 NA 2.27e-15
3. B Q8K3X6 Ankyrin repeat and SAM domain-containing protein 4B 3.10e-01 NA 1.57e-04
3. B Q9J507 Putative ankyrin repeat protein FPV228 NA NA 6.81e-08
3. B Q7TQP6 Serine/threonine-protein kinase TNNI3K 1.60e-03 NA 3.83e-08
3. B P0CS67 Palmitoyltransferase AKR1 3.43e-03 NA 3.94e-04
3. B Q9Z2G0 Protein fem-1 homolog B 2.93e-02 NA 6.87e-06
3. B G5E8K5 Ankyrin-3 1.50e-01 NA 1.58e-13
3. B Q8K0L0 Ankyrin repeat and SOCS box protein 2 1.46e-03 NA 1.23e-07
3. B A0PJZ0 Putative ankyrin repeat domain-containing protein 20A5 1.52e-02 NA 5.81e-38
3. B Q6DD51 Caskin-2 5.03e-02 NA 6.38e-10
3. B P21783 Neurogenic locus notch homolog protein 1 6.20e-01 NA 0.001
3. B Q8TF21 Ankyrin repeat domain-containing protein 24 2.47e-01 NA 2.00e-08
3. B A0A0A6YYL3 POTE ankyrin domain family member B 3.75e-04 NA 3.06e-61
3. B A0A0R4IQZ2 Putative palmitoyltransferase ZDHHC13 1.68e-03 NA 6.05e-07
3. B Q5CZ79 Ankyrin repeat domain-containing protein 20B 3.63e-03 NA 7.71e-62
3. B Q9H765 Ankyrin repeat and SOCS box protein 8 5.47e-03 NA 4.34e-12
3. B Q3KP44 Ankyrin repeat domain-containing protein 55 3.14e-02 NA 4.83e-09
3. B Q1RJR6 Putative ankyrin repeat protein RBE_0317 1.72e-02 NA 1.42e-04
3. B Q63746 NF-kappa-B inhibitor alpha 9.29e-03 NA 1.98e-05
3. B Q10728 Protein phosphatase 1 regulatory subunit 12A 4.38e-02 NA 1.82e-05
3. B P07207 Neurogenic locus Notch protein NA NA 1.51e-05
3. B Q07DV1 Cortactin-binding protein 2 3.49e-01 NA 4.20e-05
3. B Q9CWU2 Palmitoyltransferase ZDHHC13 7.71e-03 NA 4.57e-11
3. B Q9W0T5 Transient receptor potential channel pyrexia 1.61e-01 NA 4.04e-08
3. B Q9NWX5 Ankyrin repeat and SOCS box protein 6 5.90e-03 NA 1.32e-05
3. B Q5W7F2 ADP-ribosylation factor GTPase-activating protein AGD3 3.51e-02 NA 0.041
3. B Q9STP8 Acyl-CoA-binding domain-containing protein 2 3.97e-01 NA 1.22e-04
3. B A6NGH8 Ankyrin repeat domain-containing protein 61 3.51e-03 NA 1.78e-06
3. B Q63ZY3 KN motif and ankyrin repeat domain-containing protein 2 6.57e-01 NA 2.19e-04
3. B Q07DX4 Cortactin-binding protein 2 6.33e-01 NA 8.21e-06
3. B Q9CR42 Ankyrin repeat domain-containing protein 1 1.04e-02 NA 5.86e-07
3. B Q8BTZ5 Ankyrin repeat domain-containing protein 46 9.28e-02 NA 4.04e-04
3. B A6NK59 Ankyrin repeat and SOCS box protein 14 1.51e-02 NA 7.78e-06
3. B Q8BLA8 Transient receptor potential cation channel subfamily A member 1 3.14e-01 NA 0.004
3. B Q8H569 Potassium channel AKT3 1.59e-01 NA 8.42e-06
3. B O73630 Nuclear factor NF-kappa-B p100 subunit 4.00e-02 NA 1.48e-09
3. B A6NI47 Putative POTE ankyrin domain family member M 2.17e-03 NA 7.45e-59
3. B Q5UQV3 Putative ankyrin repeat protein L371 NA NA 1.53e-06
3. B Q6C520 Palmitoyltransferase AKR1 2.35e-03 NA 0.005
3. B Q2QLA2 Cortactin-binding protein 2 5.78e-01 NA 1.66e-04
3. B Q9D2X0 Ankyrin repeat domain-containing protein 39 3.81e-02 NA 5.08e-06
3. B O75179 Ankyrin repeat domain-containing protein 17 8.99e-02 NA 5.82e-11
3. B Q86AT8 Stress-activated protein kinase alpha 3.22e-02 NA 2.74e-04
3. B Q9HYV6 Putative ankyrin repeat protein PA3287 3.56e-04 NA 0.001
3. B Q5ZMD2 Ankyrin repeat and MYND domain-containing protein 2 3.83e-01 NA 0.005
3. B Q09YM8 Cortactin-binding protein 2 6.32e-01 NA 1.38e-05
3. B Q9WTK5 Nuclear factor NF-kappa-B p100 subunit 4.06e-02 NA 1.38e-08
3. B Q6GPE5 Protein fem-1 homolog B 2.40e-02 NA 6.71e-06
3. B Q8WXE0 Caskin-2 8.46e-04 NA 4.21e-05
3. B Q4R690 Palmitoyltransferase ZDHHC13 3.62e-03 NA 5.81e-10
3. B Q07E30 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 5.13e-02 NA 0.045
3. B Q5DW34 Histone-lysine N-methyltransferase EHMT1 6.36e-01 NA 2.69e-14
3. B Q80YE7 Death-associated protein kinase 1 7.27e-02 NA 7.17e-10
3. B Q5UPG0 Putative ankyrin repeat protein L86 NA NA 0.001
3. B E9PTT0 Palmitoyltransferase ZDHHC17 2.08e-03 NA 2.51e-09
3. B P0DJE3 Alpha-latrotoxin-Lhe1a 5.18e-02 NA 1.92e-05
3. B Q978J0 Putative ankyrin repeat protein TV1425 1.14e-04 NA 6.45e-12
3. B O00221 NF-kappa-B inhibitor epsilon 5.26e-05 NA 3.76e-05
3. B Q2IBF5 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 3.69e-02 NA 0.048
3. B Q9VSA4 Tonsoku-like protein 7.73e-01 NA 0.025
3. B Q3UYR4 Espin-like protein 8.38e-02 NA 4.00e-07
3. B Q8IWZ3 Ankyrin repeat and KH domain-containing protein 1 1.78e-01 NA 5.66e-11
3. B Q8IVF6 Ankyrin repeat domain-containing protein 18A 4.46e-04 NA 8.64e-65
3. B Q9J5H5 Putative ankyrin repeat protein FPV026 NA NA 5.24e-10
3. B Q9J4Z4 Putative ankyrin repeat protein FPV246 NA NA 4.09e-10
3. B A6NC57 Ankyrin repeat domain-containing protein 62 1.11e-03 NA 1.02e-145
3. B B0G124 Ankyrin repeat-containing protein DDB_G0279043 1.77e-03 NA 3.27e-08
3. B Q8C6Y6 Ankyrin repeat and SOCS box protein 14 6.94e-03 NA 2.66e-10
3. B Q5UPJ9 Putative ankyrin repeat protein L122 NA NA 3.67e-04
3. B Q91974 NF-kappa-B inhibitor alpha 7.08e-03 NA 9.13e-06
3. B Q54F46 Homeobox protein Wariai 6.40e-02 NA 5.92e-11
3. B A2RUR9 Coiled-coil domain-containing protein 144A 5.20e-03 NA 1.42e-87
3. B Q108T9 Cortactin-binding protein 2 4.93e-01 NA 7.54e-06
3. B Q9H672 Ankyrin repeat and SOCS box protein 7 8.34e-06 NA 2.24e-06
3. B Q9ET47 Espin 5.74e-02 NA 1.08e-04
3. B Q9GKW8 Ankyrin repeat and death domain-containing protein 1A (Fragment) 1.25e-04 NA 5.99e-13
3. B Q05921 2-5A-dependent ribonuclease 3.98e-03 NA 9.40e-07
3. B Q5ZIJ9 E3 ubiquitin-protein ligase MIB2 3.03e-02 NA 0.002
3. B Q80VM7 Ankyrin repeat domain-containing protein 24 1.48e-01 NA 9.78e-10
3. B P50086 Probable 26S proteasome regulatory subunit p28 4.28e-05 NA 0.002
3. B Q1RHT6 Putative ankyrin repeat protein RBE_0997 1.15e-02 NA 2.01e-05
3. B Q505D1 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A 5.88e-03 NA 2.76e-13
3. B O90760 Putative ankyrin repeat protein FPV031 NA NA 1.23e-06
3. B Q8IUH4 Palmitoyltransferase ZDHHC13 1.73e-03 NA 2.69e-10
3. B P81069 GA-binding protein subunit beta-2 1.19e-01 NA 8.25e-13
3. B Q54GC8 Acyl-CoA-binding domain-containing protein 6 homolog 3.77e-01 NA 0.005
3. B Q9UPS8 Ankyrin repeat domain-containing protein 26 3.98e-03 NA 3.70e-155
3. B Q9VUW9 Palmitoyltransferase Hip14 3.23e-03 NA 1.17e-05
3. B Q96Q27 Ankyrin repeat and SOCS box protein 2 9.09e-04 NA 2.23e-08
3. B Q00420 GA-binding protein subunit beta-1 2.85e-02 NA 3.02e-12
3. B Q6NLQ8 E3 ubiquitin-protein ligase XBAT32 5.66e-02 NA 2.05e-04
3. B Q9J508 Putative ankyrin repeat protein FPV227 NA NA 1.26e-07
3. B Q86WC6 Protein phosphatase 1 regulatory subunit 27 8.77e-02 NA 3.38e-05
3. B Q1RI12 Putative ankyrin repeat protein RBE_0921 2.09e-01 NA 1.46e-04
3. B A4D7T3 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 2.32e-02 NA 2.79e-04
3. B Q8R516 E3 ubiquitin-protein ligase MIB2 6.24e-02 NA 0.004
3. B Q5ZXN6 Phosphocholine transferase AnkX 7.25e-02 NA 0.012
3. B Q8BG95 Protein phosphatase 1 regulatory subunit 12B 1.52e-02 NA 1.12e-04
3. B Q13418 Integrin-linked protein kinase 5.75e-02 NA 3.34e-07
3. B Q6ZVH7 Espin-like protein 3.35e-02 NA 2.96e-08
3. B P83757 NF-kappa-B inhibitor cactus NA NA 0.009
3. B Q9C0D5 Protein TANC1 2.91e-02 NA 1.14e-10
3. B Q5BKI6 Ankyrin repeat domain-containing protein 1 1.35e-02 NA 3.38e-07
3. B Q9Z1P7 KN motif and ankyrin repeat domain-containing protein 3 2.62e-02 NA 1.87e-05
3. B Q9J516 Putative ankyrin repeat protein FPV219 NA NA 4.37e-08
3. B Q6ZQK5 Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 1.98e-01 NA 4.48e-05
3. B Q07DZ5 Cortactin-binding protein 2 1.00e-01 NA 1.27e-05
3. B Q09YN0 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 4.96e-02 NA 0.002
3. B O14340 Oxysterol-binding protein homolog C2F12.05c 1.33e-01 NA 0.006
3. B D3YZU1 SH3 and multiple ankyrin repeat domains protein 1 9.75e-03 NA 0.002
3. B Q92527 Ankyrin repeat domain-containing protein 7 2.23e-03 NA 3.73e-44
3. B Q02989 Alpha-latroinsectotoxin-Lt1a (Fragment) 1.36e-02 NA 1.83e-08
3. B Q60J38 Ankyrin repeat and KH domain-containing protein CBG24701 2.42e-01 NA 3.22e-08
3. B D3ZD05 KN motif and ankyrin repeat domain-containing protein 2 6.86e-01 NA 3.98e-04
3. B Q8T2Q0 Putative ZDHHC-type palmitoyltransferase 6 2.66e-02 NA 1.51e-07
3. B B2RXR6 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B 4.48e-03 NA 3.98e-15
3. B Q502K3 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C 3.07e-03 NA 3.84e-13
3. B Q862Z2 Ankyrin repeat and SOCS box protein 5 7.96e-04 NA 0.001
3. B Q66H07 Fibronectin type 3 and ankyrin repeat domains 1 protein 2.06e-05 NA 5.06e-05
3. B Q571F8 Glutaminase liver isoform, mitochondrial 6.27e-01 NA 0.023
3. B Q9EP71 Ankycorbin 2.43e-02 NA 1.53e-09
3. B Q9FIT8 ADP-ribosylation factor GTPase-activating protein AGD1 4.53e-01 NA 1.30e-04
3. B Q5PQ89 Ankyrin repeat domain-containing protein 34B 3.83e-01 NA 0.007
3. B Q8HYY4 Uveal autoantigen with coiled-coil domains and ankyrin repeats protein 5.53e-02 NA 1.27e-11
3. B Q05753 Ankyrin repeat domain-containing protein, chloroplastic 5.38e-02 NA 3.69e-09
3. B Q2QLB3 Cortactin-binding protein 2 6.62e-01 NA 3.83e-05
3. B Q6UB99 Ankyrin repeat domain-containing protein 11 1.14e-01 NA 9.92e-09
3. B Q9JIA3 NF-kappa-B inhibitor beta 1.96e-02 NA 0.012
3. B O55222 Integrin-linked protein kinase 5.62e-02 NA 3.15e-07
3. B Q9J569 Putative ankyrin repeat protein FPV162 NA NA 1.27e-05
3. B Q3SX45 Ankyrin repeat and SOCS box protein 2 1.33e-03 NA 1.06e-10
3. B Q08DV6 Ankyrin repeat and SOCS box protein 3 4.04e-04 NA 3.33e-10
3. B Q9SAR5 Ankyrin repeat domain-containing protein 2A 2.75e-01 NA 3.68e-08
3. B Q76K24 Ankyrin repeat domain-containing protein 46 9.05e-02 NA 2.96e-04
3. B Q4V8X4 Acyl-CoA-binding domain-containing protein 6 2.84e-01 NA 9.33e-05
3. B Q04721 Neurogenic locus notch homolog protein 2 4.68e-01 NA 2.50e-06
3. B Q09YI1 Cortactin-binding protein 2 3.13e-01 NA 2.29e-05
3. B Q3UMT1 Protein phosphatase 1 regulatory subunit 12C 1.23e-02 NA 0.045
3. B Q8N6D5 Ankyrin repeat domain-containing protein 29 1.54e-03 NA 7.94e-06
3. B O15084 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A 6.23e-03 NA 2.43e-13
3. B Q5NVB9 Palmitoyltransferase ZDHHC13 3.53e-03 NA 2.69e-10
3. B Q7T2B9 Myotrophin 5.18e-03 NA 9.38e-07
3. B Q9J4Z5 Putative ankyrin repeat protein FPV245 NA NA 3.13e-08
3. B Q8BTI7 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C 7.63e-02 NA 1.17e-12
3. B E5RJM6 Ankyrin repeat domain-containing protein 65 2.63e-03 NA 1.90e-05
3. B Q6P9Z4 Protein fem-1 homolog A 5.59e-03 NA 5.21e-04
3. B Q9GZV1 Ankyrin repeat domain-containing protein 2 4.07e-02 NA 8.67e-10
3. B Q9QW30 Neurogenic locus notch homolog protein 2 3.74e-01 NA 1.77e-05
3. B Q6GQX6 Ankyrin repeat and SAM domain-containing protein 6 1.25e-01 NA 4.85e-04
3. B Q9NGC3 Centaurin-gamma-1A 9.04e-01 NA 0.022
3. B Q3SX00 Ankyrin repeat domain-containing protein 46 1.16e-01 NA 0.003
3. B Q6IVG4 Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 2.03e-01 NA 1.13e-04
3. B Q59H18 Serine/threonine-protein kinase TNNI3K 1.68e-01 NA 2.20e-06
3. B Q9SM23 Acyl-CoA-binding domain-containing protein 1 4.01e-01 NA 0.007
3. B Q8VHQ3 Protein phosphatase 1 regulatory inhibitor subunit 16B 1.09e-02 NA 0.014
3. B Q99PE2 Ankyrin repeat family A protein 2 7.95e-02 NA 1.96e-07
3. B Q9BSK4 Protein fem-1 homolog A 2.36e-02 NA 0.036
3. B Q9H9B1 Histone-lysine N-methyltransferase EHMT1 7.51e-02 NA 1.68e-13
3. B P35210 Protein SPT23 6.03e-01 NA 0.023
3. B Q28BK1 E3 ubiquitin-protein ligase HACE1 1.40e-01 NA 2.90e-08
3. B Q8IYA2 Putative coiled-coil domain-containing protein 144C 3.26e-03 NA 1.99e-61
3. B Q9J5I7 Putative ankyrin repeat protein FPV014 NA NA 1.48e-06
3. B H3BUK9 POTE ankyrin domain family member B2 1.28e-03 NA 3.06e-61
3. B Q9BZF9 Uveal autoantigen with coiled-coil domains and ankyrin repeats 1.01e-02 NA 5.64e-10
3. B Q9DAM9 Fibronectin type 3 and ankyrin repeat domains 1 protein 2.02e-05 NA 2.53e-05
3. B Q8N283 Ankyrin repeat domain-containing protein 35 1.30e-01 NA 7.52e-12
3. B Q8WXH4 Ankyrin repeat and SOCS box protein 11 1.22e-03 NA 0.015
3. B Q1RJR4 Putative ankyrin repeat protein RBE_0319 1.76e-02 NA 0.004
3. B O60733 85/88 kDa calcium-independent phospholipase A2 1.25e-01 NA 3.24e-06
3. B Q8BLB8 Ankyrin repeat domain-containing protein 34C 1.37e-01 NA 9.89e-06
3. B Q9ERK0 Receptor-interacting serine/threonine-protein kinase 4 2.92e-03 NA 3.23e-10
3. B Q810B6 Rabankyrin-5 7.28e-03 NA 9.42e-05
3. B Q9J517 Putative ankyrin repeat protein FPV218 NA NA 1.15e-08
3. B Q96IX9 Putative ankyrin repeat domain-containing protein 26-like 1 1.76e-02 NA 5.71e-42
3. B Q12955 Ankyrin-3 NA NA 7.20e-15
3. B Q09YJ3 Cortactin-binding protein 2 7.59e-01 NA 1.10e-05
3. B Q8VHS5 Ankyrin repeat and SOCS box protein 16 2.78e-03 NA 0.006
3. B Q6TNT2 Ankyrin repeat domain-containing protein 46 1.94e-01 NA 0.016
3. B A2RUV0 Neurogenic locus notch homolog protein 1 2.46e-01 NA 8.93e-06
3. B Q38998 Potassium channel AKT1 2.92e-01 NA 0.001
3. B Q80TN5 Palmitoyltransferase ZDHHC17 1.38e-03 NA 1.64e-09
3. B P20749 B-cell lymphoma 3 protein 6.04e-03 NA 2.03e-13
3. B Q7S3M5 Palmitoyltransferase akr1 3.06e-03 NA 4.12e-10
3. B Q7Z6G8 Ankyrin repeat and sterile alpha motif domain-containing protein 1B 6.90e-02 NA 1.87e-07
3. B A5PLL1 Ankyrin repeat domain-containing protein 34B 1.48e-01 NA 0.045
3. B Q5R5V4 Integrin-linked protein kinase 1.19e-01 NA 2.86e-07
3. B Q4UKX2 Putative ankyrin repeat protein RF_0950 1.28e-02 NA 8.09e-06
3. B O75832 26S proteasome non-ATPase regulatory subunit 10 2.47e-06 NA 4.63e-11
3. B P62775 Myotrophin 3.57e-03 NA 2.79e-05
3. B Q6ZW76 Ankyrin repeat and SAM domain-containing protein 3 2.73e-02 NA 7.07e-12
3. B Q2IBB4 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 4.29e-02 NA 0.018
3. B P31695 Neurogenic locus notch homolog protein 4 9.94e-01 NA 0.003
3. B Q8GXE6 Potassium channel AKT6 3.71e-01 NA 2.47e-05
3. B A0A140LI88 Ankyrin repeat domain-containing protein 31 3.79e-01 NA 7.73e-06
3. B Q09YK4 Cortactin-binding protein 2 3.24e-01 NA 1.69e-04
3. B Q8C8R3 Ankyrin-2 NA NA 1.81e-17
3. B E1C656 E3 ubiquitin-protein ligase HACE1 5.72e-02 NA 3.12e-07
3. B Q6F6B3 Protein TANC1 2.19e-01 NA 1.96e-09
3. B Q17QS6 Ankyrin repeat and SOCS box protein 5 7.78e-04 NA 4.70e-05
3. B Q86W74 Ankyrin repeat domain-containing protein 46 2.27e-01 NA 0.003
3. B Q8N8V4 Ankyrin repeat and SAM domain-containing protein 4B 4.01e-01 NA 0.002
3. B P40480 Protein HOS4 4.22e-02 NA 1.07e-04
3. B Q9Y574 Ankyrin repeat and SOCS box protein 4 1.24e-03 NA 1.89e-04
3. B Q9H9E1 Ankyrin repeat family A protein 2 5.08e-02 NA 1.92e-07
3. B Q6NXT1 Ankyrin repeat domain-containing protein 54 3.26e-01 NA 7.04e-08
3. B Q8BIZ1 Ankyrin repeat and sterile alpha motif domain-containing protein 1B 4.10e-02 NA 1.40e-07
3. B Q5T7N3 KN motif and ankyrin repeat domain-containing protein 4 7.21e-01 NA 1.63e-07
3. B Q9QZH2 BRCA1-associated RING domain protein 1 7.27e-01 NA 8.35e-06
3. B Q6AWW5 Ankyrin repeat-containing protein At5g02620 1.03e-02 NA 0.002
3. B Q7ZT11 Ankyrin repeat domain-containing protein 1 2.33e-02 NA 1.35e-08
3. B Q8TC84 Fibronectin type 3 and ankyrin repeat domains protein 1 2.05e-05 NA 2.18e-07
3. B Q54HT1 Protein tirA 2.91e-01 NA 0.015
3. B Q96P50 Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 3 1.75e-01 NA 0.003
3. B Q9J503 Putative ankyrin repeat protein FPV232 NA NA 1.90e-05
3. B Q99728 BRCA1-associated RING domain protein 1 2.91e-01 NA 3.33e-06
3. B P97570 85/88 kDa calcium-independent phospholipase A2 1.42e-01 NA 0.005
3. B Q6S8J7 POTE ankyrin domain family member A 3.28e-02 NA 6.14e-65
3. B Q3UMR0 Ankyrin repeat domain-containing protein 27 1.48e-01 NA 2.52e-10
3. B Q07008 Neurogenic locus notch homolog protein 1 1.69e-01 NA 7.87e-05
3. B A3AYR1 Acyl-CoA-binding domain-containing protein 4 1.48e-01 NA 4.80e-04
3. B Q3T0F7 Myotrophin 3.46e-03 NA 8.02e-05
3. B Q811D2 Ankyrin repeat domain-containing protein 26 6.93e-03 NA 3.37e-109
3. B Q07DY4 Cortactin-binding protein 2 8.92e-01 NA 1.18e-06
3. B Q9HCD6 Protein TANC2 7.59e-02 NA 5.88e-11
3. B A1X157 Cortactin-binding protein 2 8.51e-02 NA 3.83e-05
3. B Q9D3J5 Ankyrin repeat domain-containing protein 22 3.65e-04 NA 0.038
3. B Q6S545 POTE ankyrin domain family member H 4.09e-04 NA 3.63e-59
3. B Q9Z148 Histone-lysine N-methyltransferase EHMT2 7.94e-02 NA 4.33e-12
3. B Q9GL21 Uveal autoantigen with coiled-coil domains and ankyrin repeats 3.70e-02 NA 7.77e-11
3. B Q1RK13 Putative ankyrin repeat protein RBE_0220 3.29e-02 NA 5.43e-10
3. B Q54XX5 Probable serine/threonine-protein kinase DDB_G0278535 6.99e-02 NA 0.004
3. B Q9CZK6 Ankyrin repeat and SAM domain-containing protein 3 8.87e-02 NA 2.55e-13
3. B Q8TAK5 GA-binding protein subunit beta-2 1.14e-01 NA 1.69e-13
3. B Q5UPF8 Putative ankyrin repeat protein L88 NA NA 8.27e-05
3. B Q99J82 Integrin-linked protein kinase 5.73e-02 NA 3.15e-07
3. B Q2IBF7 Cortactin-binding protein 2 1.07e-01 NA 7.48e-06
3. B Q2QLF8 Cortactin-binding protein 2 3.53e-01 NA 6.09e-05
3. B Q1RK83 Putative ankyrin repeat protein RBE_0150 1.33e-01 NA 2.55e-04
3. B Q71S22 Inversin-A 1.09e-01 NA 7.86e-13
3. B Q4UMH6 Putative ankyrin repeat protein RF_0381 9.63e-04 NA 1.37e-10
3. B P53355 Death-associated protein kinase 1 7.02e-02 NA 5.15e-10
3. B Q804S5 E3 ubiquitin-protein ligase mib1 1.58e-02 NA 4.13e-07
3. B Q8IYU2 E3 ubiquitin-protein ligase HACE1 1.28e-01 NA 1.50e-07
3. B P0CS66 Palmitoyltransferase AKR1 1.44e-02 NA 3.94e-04
3. B Q9HLN1 Putative ankyrin repeat protein Ta0196 2.32e-04 NA 4.02e-05
3. B Q6B858 Fibronectin type 3 and ankyrin repeat domains protein 1 1.37e-05 NA 2.36e-07
3. B Q8NB46 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C 4.97e-02 NA 4.80e-13
3. B Q0VCS9 Ankyrin repeat and MYND domain-containing protein 2 4.91e-01 NA 0.006
3. B P25963 NF-kappa-B inhibitor alpha 6.18e-03 NA 2.28e-07
3. B Q5REW9 Ankyrin repeat domain-containing protein 27 6.16e-02 NA 3.26e-10
3. B Q863Z4 Myotrophin 3.57e-03 NA 8.02e-05
3. B Q9CQ31 Ankyrin repeat and SOCS box protein 11 1.04e-03 NA 8.12e-05
3. B Q6JAN1 Inversin 1.51e-01 NA 5.27e-12
3. B Q5RJK8 Acyl-CoA-binding domain-containing protein 6 2.21e-01 NA 5.27e-04
3. B D3ZBM7 E3 ubiquitin-protein ligase HACE1 3.14e-02 NA 1.55e-07
3. B Q9J5G9 Putative ankyrin repeat protein FPV034 NA NA 1.79e-07
3. B A2AS55 Ankyrin repeat domain-containing protein 16 1.51e-03 NA 0.001
3. B Q2QLA4 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 4.08e-02 NA 0.038
3. B P23631 Alpha-latrotoxin-Lt1a 1.12e-01 NA 2.45e-06
3. B Q8WXD9 Caskin-1 1.93e-02 NA 1.09e-09
3. B Q8R560 Ankyrin repeat domain-containing protein 1 1.40e-02 NA 1.89e-08
3. B Q60778 NF-kappa-B inhibitor beta 3.45e-02 NA 0.001
3. B Q9FY48 E3 ubiquitin-protein ligase KEG 8.06e-02 NA 0.008
3. B Q5UPR3 Putative ankyrin repeat protein R777 NA NA 0.012
3. B A0A084B9Z8 Ankyrin repeat domain-containing protein SAT10 9.44e-01 NA 0.019
3. B Q8WZ74 Cortactin-binding protein 2 4.05e-01 NA 8.21e-06
3. B Q3EC11 Probable protein S-acyltransferase 23 4.47e-05 NA 0.037
3. B Q8BLD6 Ankyrin repeat domain-containing protein 55 1.25e-01 NA 1.11e-09
3. B Q5B0V6 Palmitoyltransferase akr1 1.46e-02 NA 1.94e-08
3. B Q6DRG7 Protein phosphatase 1 regulatory subunit 12A 2.44e-02 NA 1.76e-04
3. B Q96DX5 Ankyrin repeat and SOCS box protein 9 4.61e-04 NA 5.34e-07
3. B Q9VBP3 Poly [ADP-ribose] polymerase tankyrase 1.10e-01 NA 1.14e-06
3. B Q6DCL5 E3 ubiquitin-protein ligase HACE1 1.79e-01 NA 4.06e-08
3. B Q9BR61 Acyl-CoA-binding domain-containing protein 6 1.75e-01 NA 3.59e-05
3. B Q2QL82 Cortactin-binding protein 2 6.32e-01 NA 9.86e-06
3. B Q96NW4 Ankyrin repeat domain-containing protein 27 2.61e-01 NA 5.70e-11
3. B A7E2S9 Putative ankyrin repeat domain-containing protein 30B-like 9.59e-03 NA 1.33e-44
3. B Q8VE42 Ankyrin repeat domain-containing protein 49 7.37e-02 NA 0.004