Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 3. B was
Q9D504
(Ankyrin repeat domain-containing protein 7) with a FATCAT P-Value: 3.8e-08 and RMSD of 1.82 angstrom. The sequence alignment identity is 5.8%.
Structural alignment shown in left. Query protein A6QL64 colored as red in alignment, homolog Q9D504 colored as blue.
Query protein A6QL64 is also shown in right top, homolog Q9D504 showed in right bottom. They are colored based on secondary structures.
A6QL64 MED-----GKRE---------RWP-TLME----RLCSDGFAFPQYPIKPYHLKRIHRAVLHGNLEKLK-YLLLTYYDANKRDRKERTALHLACATGQPEM 80 Q9D504 MKKFFPFRGKRKTDDSHSHSSEVPISLAKTAPPSLSIGG----GYHLRDKHLKKLHKAATIGNEQKLKDYLERKKYNVNGRDKRSRTPLHLACANGYTNI 96 A6QL64 VHLLVSRRCELNLCDREDRTPLIKAVQLRQEACATLLLQNGANPNITDFFGRTALHYAVYNEDTSMIEKLLSHGTNIEECSKCEYQPLLFAVSRRKVKMV 180 Q9D504 VSLLIENQCKINVQDSENRTPLIKAVECQQESCATVLLLHGADPNLVDVYSNTALHYAVCGQNISLANKLLQYKANLEAKNKDGHTPLLLAVAENNENMV 196 A6QL64 EFLLKKKANVNAIDYLGRSALIHAVTLGEKDIVILLLQHNIDVLSRDAFRKIAGDYAIEAKNRVIFDLIYEYERKRYEDLPINSNPVSSQK--QPALKAT 278 Q9D504 KFLLKKGADVNASDKNHRTAIMIALIVEPTSSVKLLLQQDTDLAHKDIYGFTAEEYA--SFNG--FTM--------YHHITAN-NE-NKKKTEQTAY--- 279 A6QL64 SGKEDSISNIATEIKDGQKSGTVSSQKQPALKDTSDKDDSVSNTATEIKDEQKSGTVLPAVEQCLNRSLYRPDAVAQPVTENEFSLESEIISKLYIPKRK 378 Q9D504 ---------------------------------------------------------------------------------------------------- 279 A6QL64 IISPRSIKDVLPPVEEAVDRCLYLLDRFAQPVTKDKFALESENISEPYFTNRRTISQQSAENLDAACGIDKTENGNMFEDQNVDKEGKALPATGQKANVS 478 Q9D504 ---------------------------------------------------------------------------------------------------- 279 A6QL64 PEQPPLFTHTVKDRDHISTRFLGGMDSLTSSEESSERPPLSTLTLKEADPSSKAAMRRKDSPPPGKVSSQKQPAEKATSDDKDSVSNIATEIKEGPISGT 578 Q9D504 ---------------------------------------------------------------------------------------------------- 279 A6QL64 VSSQKQPAEKATSDEKDSVSNIATEIKKGQQSGTVSPQKQSAWKVIFKKKVSLLNIATRIMGGGKSGTVSSQKQPASKATSDKTDSALNIATEIKDGLQC 678 Q9D504 ---------------------------------------------------------------------------------------------------- 279 A6QL64 GTVSSQKQPALKATTDEEDSVSNIATEIKDGEKSGTVSSQKQPALKATTDEEDSVSNIATEIKDGEKSGTVSSQKQPALKATTDEKDSVSNIATEIKDGE 778 Q9D504 ---------------------------------------------------------------------------------------------------- 279 A6QL64 KSGTVSSQKPPALTATSDEEGSVLSIARENKDGEKSRTVSSRKKPALKATSDEKDSFSNITRGKKDGEISRKVSSQKPPTLKGTSDEEDSVLGIARENKD 878 Q9D504 ---------------------------------------------------------------------------------------------------- 279 A6QL64 GEKSRTVSSEKPPGLKASSAEKDSVLNIARGKKDGEKTKRVSSRKKPSLEATSDEKDSFSNITREKKDGEISRKVSSQKPPALKGTSDEEDSVLGIAREN 978 Q9D504 ---------------------------------------------------------------------------------------------------- 279 A6QL64 KDGEKSRTVSSEKPPGLKATSDEKDSVLNIARGKKDGEKTRTVSSQKPPTLKATSDEEDSVLSIARENKDGEKSRTVSSEKPSGLKATSAEKDSVLNIAR 1078 Q9D504 ---------------------------------------------------------------------------------------------------- 279 A6QL64 GKKYGEKTKRVSSRKKPALKATSDEKDSVLYIAREKKDGEKSRTVSSPKQPALKAICDKEDSVPNMATEKKDEQISGTVSCQKQPALKATSDKKDSVSNI 1178 Q9D504 ---------------------------------------------------------------------------------------------------- 279 A6QL64 PTEIKDGQQSGTVSSQKQPAWKATSVKKDSVSNIATEIKDGQIRGTVSPQKQSAQKVIFKKKVSLLNIATRITGGWKSGTEYPENLPTLKATIENKNSVL 1278 Q9D504 ---------------------------------------------------------------------------------------------------- 279 A6QL64 NTATKMKDVQTSTPAEQDLEMASEGEQKRLEEYENNQPQVKNQIHSRDDLDDIIQSSQTVSEDGDSLCCNCKNVILLIDQHEMKCKDCVHLLKIKNTFCL 1378 Q9D504 ---------------------------------------------------------------------------------------------------- 279 A6QL64 WKRLIKLKDNHCEQLRVKIRKLKNKASVLQKRISEKEEIKSQLKHEILELEKELCSLRFAIQQEKKKRRNVEEVHQKVREKLRITEEQYRIEADVTKPIK 1478 Q9D504 ---------------------------------------------------------------------------------------------------- 279 A6QL64 PALKSAEVELKTGGNNSNQVSETDEKEDLLHENRLMQDEIARLRLEKDTIKNQNLEKKYLKDFEIVKRKHEDLQKALKRNGETLAKTIACYSGQLAALTD 1578 Q9D504 ---------------------------------------------------------------------------------------------------- 279 A6QL64 ENTTLRSKLEKQRESRQRLETEMQSYHCRLNAARCDHDQSHSSKRDQELAFQGTVDKCRHLQENLNSHVLILSLQLSKAESKSRVLKTELHYTGEALKEK 1678 Q9D504 ---------------------------------------------------------------------------------------------------- 279 A6QL64 ALVFEHVQSELKQKQSQMKDIEKMYKSGYNTMEKCIEKQERFCQLKKQNMLLQQQLDDARNKADNQEKAILNIQARCDARVQNLQAECRKHRLLLEEDNK 1778 Q9D504 ---------------------------------------------------------------------------------------------------- 279 A6QL64 MLVNELNHSKEKECQYEKEKAEREVAVRQLQQKRDDVLNKGSATKALLDASSRHCTYLENGMQDSRKKLDQMRSQFQEIQDQLTATIRCTKEMEGDTQKL 1878 Q9D504 ---------------------------------------------------------------------------------------------------- 279 A6QL64 EVEHVMMRKIIKKQDDQIERLEKILQHSSLMLQVFES 1915 Q9D504 ------------------------------------- 279
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0009925 | basal plasma membrane |
| 1. PB | GO:0070972 | protein localization to endoplasmic reticulum |
| 1. PB | GO:0043086 | negative regulation of catalytic activity |
| 1. PB | GO:0008157 | protein phosphatase 1 binding |
| 1. PB | GO:0008093 | cytoskeletal anchor activity |
| 1. PB | GO:0042994 | cytoplasmic sequestering of transcription factor |
| 1. PB | GO:0035308 | negative regulation of protein dephosphorylation |
| 1. PB | GO:0030017 | sarcomere |
| 2. P | GO:0032886 | regulation of microtubule-based process |
| 2. P | GO:0010469 | regulation of signaling receptor activity |
| 2. P | GO:0032039 | integrator complex |
| 2. P | GO:0002853 | negative regulation of T cell mediated cytotoxicity directed against tumor cell target |
| 2. P | GO:0019226 | transmission of nerve impulse |
| 2. P | GO:0003756 | protein disulfide isomerase activity |
| 2. P | GO:1903573 | negative regulation of response to endoplasmic reticulum stress |
| 2. P | GO:0080115 | myosin XI tail binding |
| 2. P | GO:0030844 | positive regulation of intermediate filament depolymerization |
| 2. P | GO:0048858 | cell projection morphogenesis |
| 2. P | GO:0007091 | metaphase/anaphase transition of mitotic cell cycle |
| 2. P | GO:0034472 | snRNA 3'-end processing |
| 2. P | GO:0030953 | astral microtubule organization |
| 2. P | GO:0005796 | Golgi lumen |
| 2. P | GO:0071215 | cellular response to abscisic acid stimulus |
| 2. P | GO:0090281 | negative regulation of calcium ion import |
| 2. P | GO:0031589 | cell-substrate adhesion |
| 2. P | GO:2000179 | positive regulation of neural precursor cell proliferation |
| 2. P | GO:0000128 | flocculation |
| 2. P | GO:1990441 | negative regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress |
| 2. P | GO:0008366 | axon ensheathment |
| 2. P | GO:0005854 | nascent polypeptide-associated complex |
| 2. P | GO:0048012 | hepatocyte growth factor receptor signaling pathway |
| 2. P | GO:0031730 | CCR5 chemokine receptor binding |
| 2. P | GO:0042306 | regulation of protein import into nucleus |
| 2. P | GO:0051764 | actin crosslink formation |
| 2. P | GO:0030414 | peptidase inhibitor activity |
| 2. P | GO:0050817 | coagulation |
| 2. P | GO:0001953 | negative regulation of cell-matrix adhesion |
| 2. P | GO:0031076 | embryonic camera-type eye development |
| 2. P | GO:1903917 | positive regulation of endoplasmic reticulum stress-induced eIF2 alpha dephosphorylation |
| 2. P | GO:0009277 | fungal-type cell wall |
| 2. P | GO:0032515 | negative regulation of phosphoprotein phosphatase activity |
| 2. P | GO:0022027 | interkinetic nuclear migration |
| 2. P | GO:0046914 | transition metal ion binding |
| 2. P | GO:1901318 | negative regulation of flagellated sperm motility |
| 2. P | GO:0001533 | cornified envelope |
| 2. P | GO:0110148 | biomineralization |
| 2. P | GO:0019215 | intermediate filament binding |
| 2. P | GO:0072089 | stem cell proliferation |
| 2. P | GO:0007420 | brain development |
| 2. P | GO:0030054 | cell junction |
| 2. P | GO:0048240 | sperm capacitation |
| 2. P | GO:0031528 | microvillus membrane |
| 2. P | GO:0045943 | positive regulation of transcription by RNA polymerase I |
| 2. P | GO:0010466 | negative regulation of peptidase activity |
| 2. P | GO:0032516 | positive regulation of phosphoprotein phosphatase activity |
| 2. P | GO:0031424 | keratinization |
| 2. P | GO:0031225 | anchored component of membrane |
| 2. P | GO:0032290 | peripheral nervous system myelin formation |
| 2. P | GO:0022408 | negative regulation of cell-cell adhesion |
| 2. P | GO:1902850 | microtubule cytoskeleton organization involved in mitosis |
| 2. P | GO:0034614 | cellular response to reactive oxygen species |
| 2. P | GO:0039503 | suppression by virus of host innate immune response |
| 2. P | GO:0007288 | sperm axoneme assembly |
| 2. P | GO:0043484 | regulation of RNA splicing |
| 2. P | GO:0001520 | outer dense fiber |
| 2. P | GO:0110143 | magnetosome |
| 2. P | GO:0009566 | fertilization |
| 2. P | GO:0032287 | peripheral nervous system myelin maintenance |
| 2. P | GO:1900005 | positive regulation of serine-type endopeptidase activity |
| 2. P | GO:0017022 | myosin binding |
| 2. P | GO:0032184 | SUMO polymer binding |
| 2. P | GO:0005537 | mannose binding |
| 2. P | GO:0005882 | intermediate filament |
| 2. P | GO:0060236 | regulation of mitotic spindle organization |
| 2. P | GO:0004791 | thioredoxin-disulfide reductase activity |
| 2. P | GO:0030176 | integral component of endoplasmic reticulum membrane |
| 2. P | GO:0000164 | protein phosphatase type 1 complex |
| 2. P | GO:0036496 | regulation of translational initiation by eIF2 alpha dephosphorylation |
| 2. P | GO:1902310 | positive regulation of peptidyl-serine dephosphorylation |
| 2. P | GO:0005741 | mitochondrial outer membrane |
| 2. P | GO:0060734 | regulation of endoplasmic reticulum stress-induced eIF2 alpha phosphorylation |
| 2. P | GO:0042628 | mating plug formation |
| 2. P | GO:0005176 | ErbB-2 class receptor binding |
| 2. P | GO:0070262 | peptidyl-serine dephosphorylation |
| 2. P | GO:1903912 | negative regulation of endoplasmic reticulum stress-induced eIF2 alpha phosphorylation |
| 2. P | GO:0009789 | positive regulation of abscisic acid-activated signaling pathway |
| 3. B | GO:0005770 | late endosome |
| 3. B | GO:0034765 | regulation of ion transmembrane transport |
| 3. B | GO:0071625 | vocalization behavior |
| 3. B | GO:0000122 | negative regulation of transcription by RNA polymerase II |
| 3. B | GO:0048337 | positive regulation of mesodermal cell fate specification |
| 3. B | GO:0050729 | positive regulation of inflammatory response |
| 3. B | GO:0090037 | positive regulation of protein kinase C signaling |
| 3. B | GO:0048709 | oligodendrocyte differentiation |
| 3. B | GO:0006511 | ubiquitin-dependent protein catabolic process |
| 3. B | GO:0043011 | myeloid dendritic cell differentiation |
| 3. B | GO:0035148 | tube formation |
| 3. B | GO:0032456 | endocytic recycling |
| 3. B | GO:0007507 | heart development |
| 3. B | GO:0001701 | in utero embryonic development |
| 3. B | GO:0072104 | glomerular capillary formation |
| 3. B | GO:1903779 | regulation of cardiac conduction |
| 3. B | GO:0042088 | T-helper 1 type immune response |
| 3. B | GO:0070563 | negative regulation of vitamin D receptor signaling pathway |
| 3. B | GO:0030334 | regulation of cell migration |
| 3. B | GO:0032421 | stereocilium bundle |
| 3. B | GO:0003270 | Notch signaling pathway involved in regulation of secondary heart field cardioblast proliferation |
| 3. B | GO:0010812 | negative regulation of cell-substrate adhesion |
| 3. B | GO:0001756 | somitogenesis |
| 3. B | GO:2001259 | positive regulation of cation channel activity |
| 3. B | GO:0051247 | positive regulation of protein metabolic process |
| 3. B | GO:0021514 | ventral spinal cord interneuron differentiation |
| 3. B | GO:1903522 | regulation of blood circulation |
| 3. B | GO:0070372 | regulation of ERK1 and ERK2 cascade |
| 3. B | GO:0060412 | ventricular septum morphogenesis |
| 3. B | GO:0045663 | positive regulation of myoblast differentiation |
| 3. B | GO:0014044 | Schwann cell development |
| 3. B | GO:0006306 | DNA methylation |
| 3. B | GO:0097190 | apoptotic signaling pathway |
| 3. B | GO:0106310 | protein serine kinase activity |
| 3. B | GO:0019903 | protein phosphatase binding |
| 3. B | GO:0003252 | negative regulation of cell proliferation involved in heart valve morphogenesis |
| 3. B | GO:0085020 | protein K6-linked ubiquitination |
| 3. B | GO:0006959 | humoral immune response |
| 3. B | GO:0004842 | ubiquitin-protein transferase activity |
| 3. B | GO:0047499 | calcium-independent phospholipase A2 activity |
| 3. B | GO:0043403 | skeletal muscle tissue regeneration |
| 3. B | GO:0007140 | male meiotic nuclear division |
| 3. B | GO:0001837 | epithelial to mesenchymal transition |
| 3. B | GO:0051494 | negative regulation of cytoskeleton organization |
| 3. B | GO:0048259 | regulation of receptor-mediated endocytosis |
| 3. B | GO:0045070 | positive regulation of viral genome replication |
| 3. B | GO:0003950 | NAD+ ADP-ribosyltransferase activity |
| 3. B | GO:0032420 | stereocilium |
| 3. B | GO:0035264 | multicellular organism growth |
| 3. B | GO:0021519 | spinal cord association neuron specification |
| 3. B | GO:0015095 | magnesium ion transmembrane transporter activity |
| 3. B | GO:0045611 | negative regulation of hemocyte differentiation |
| 3. B | GO:0051489 | regulation of filopodium assembly |
| 3. B | GO:0035622 | intrahepatic bile duct development |
| 3. B | GO:0045737 | positive regulation of cyclin-dependent protein serine/threonine kinase activity |
| 3. B | GO:0045036 | protein targeting to chloroplast |
| 3. B | GO:0033257 | Bcl3/NF-kappaB2 complex |
| 3. B | GO:0016571 | histone methylation |
| 3. B | GO:0043254 | regulation of protein-containing complex assembly |
| 3. B | GO:0010765 | positive regulation of sodium ion transport |
| 3. B | GO:0035304 | regulation of protein dephosphorylation |
| 3. B | GO:0071546 | pi-body |
| 3. B | GO:0010557 | positive regulation of macromolecule biosynthetic process |
| 3. B | GO:0003162 | atrioventricular node development |
| 3. B | GO:0035690 | |
| 3. B | GO:0007283 | spermatogenesis |
| 3. B | GO:0007492 | endoderm development |
| 3. B | GO:0048549 | positive regulation of pinocytosis |
| 3. B | GO:2001214 | positive regulation of vasculogenesis |
| 3. B | GO:0030534 | adult behavior |
| 3. B | GO:0031069 | hair follicle morphogenesis |
| 3. B | GO:0072659 | protein localization to plasma membrane |
| 3. B | GO:0086015 | SA node cell action potential |
| 3. B | GO:1990404 | protein ADP-ribosylase activity |
| 3. B | GO:0005903 | brush border |
| 3. B | GO:0061073 | ciliary body morphogenesis |
| 3. B | GO:0051092 | positive regulation of NF-kappaB transcription factor activity |
| 3. B | GO:0007520 | myoblast fusion |
| 3. B | GO:0003151 | outflow tract morphogenesis |
| 3. B | GO:0036464 | cytoplasmic ribonucleoprotein granule |
| 3. B | GO:0006913 | nucleocytoplasmic transport |
| 3. B | GO:0072014 | proximal tubule development |
| 3. B | GO:0002437 | inflammatory response to antigenic stimulus |
| 3. B | GO:0002039 | p53 binding |
| 3. B | GO:0031286 | negative regulation of sorocarp stalk cell differentiation |
| 3. B | GO:0002052 | positive regulation of neuroblast proliferation |
| 3. B | GO:0042734 | presynaptic membrane |
| 3. B | GO:0050953 | sensory perception of light stimulus |
| 3. B | GO:1902309 | negative regulation of peptidyl-serine dephosphorylation |
| 3. B | GO:0070417 | cellular response to cold |
| 3. B | GO:0031462 | Cul2-RING ubiquitin ligase complex |
| 3. B | GO:0048715 | negative regulation of oligodendrocyte differentiation |
| 3. B | GO:0010564 | regulation of cell cycle process |
| 3. B | GO:0034142 | toll-like receptor 4 signaling pathway |
| 3. B | GO:1990433 | CSL-Notch-Mastermind transcription factor complex |
| 3. B | GO:0005123 | death receptor binding |
| 3. B | GO:0032426 | stereocilium tip |
| 3. B | GO:0043409 | negative regulation of MAPK cascade |
| 3. B | GO:0001886 | endothelial cell morphogenesis |
| 3. B | GO:0043008 | ATP-dependent protein binding |
| 3. B | GO:0048056 | R3/R4 cell differentiation |
| 3. B | GO:0003160 | endocardium morphogenesis |
| 3. B | GO:0022011 | myelination in peripheral nervous system |
| 3. B | GO:0007249 | I-kappaB kinase/NF-kappaB signaling |
| 3. B | GO:0050894 | determination of affect |
| 3. B | GO:0045638 | negative regulation of myeloid cell differentiation |
| 3. B | GO:0001709 | cell fate determination |
| 3. B | GO:0000209 | protein polyubiquitination |
| 3. B | GO:0097546 | ciliary base |
| 3. B | GO:0001947 | heart looping |
| 3. B | GO:0035116 | embryonic hindlimb morphogenesis |
| 3. B | GO:0090201 | negative regulation of release of cytochrome c from mitochondria |
| 3. B | GO:0002027 | regulation of heart rate |
| 3. B | GO:2000178 | negative regulation of neural precursor cell proliferation |
| 3. B | GO:1904970 | brush border assembly |
| 3. B | GO:0044325 | transmembrane transporter binding |
| 3. B | GO:0008593 | regulation of Notch signaling pathway |
| 3. B | GO:0030496 | midbody |
| 3. B | GO:0005634 | nucleus |
| 3. B | GO:0072116 | pronephros formation |
| 3. B | GO:0072574 | hepatocyte proliferation |
| 3. B | GO:1990760 | osmolarity-sensing cation channel activity |
| 3. B | GO:0019888 | protein phosphatase regulator activity |
| 3. B | GO:0046875 | ephrin receptor binding |
| 3. B | GO:0010366 | negative regulation of ethylene biosynthetic process |
| 3. B | GO:0001763 | morphogenesis of a branching structure |
| 3. B | GO:0030660 | Golgi-associated vesicle membrane |
| 3. B | GO:0002789 | negative regulation of antifungal peptide production |
| 3. B | GO:0072044 | collecting duct development |
| 3. B | GO:0046826 | negative regulation of protein export from nucleus |
| 3. B | GO:1900246 | positive regulation of RIG-I signaling pathway |
| 3. B | GO:1904901 | positive regulation of myosin II filament organization |
| 3. B | GO:0070528 | protein kinase C signaling |
| 3. B | GO:0060999 | positive regulation of dendritic spine development |
| 3. B | GO:0007253 | cytoplasmic sequestering of NF-kappaB |
| 3. B | GO:0005516 | calmodulin binding |
| 3. B | GO:0045603 | positive regulation of endothelial cell differentiation |
| 3. B | GO:0010875 | positive regulation of cholesterol efflux |
| 3. B | GO:0045746 | negative regulation of Notch signaling pathway |
| 3. B | GO:0035774 | positive regulation of insulin secretion involved in cellular response to glucose stimulus |
| 3. B | GO:0097604 | temperature-gated cation channel activity |
| 3. B | GO:0070213 | protein auto-ADP-ribosylation |
| 3. B | GO:0004672 | protein kinase activity |
| 3. B | GO:0046427 | positive regulation of receptor signaling pathway via JAK-STAT |
| 3. B | GO:0043330 | response to exogenous dsRNA |
| 3. B | GO:0055016 | hypochord development |
| 3. B | GO:0031877 | somatostatin receptor binding |
| 3. B | GO:0048812 | neuron projection morphogenesis |
| 3. B | GO:0033292 | T-tubule organization |
| 3. B | GO:0005769 | early endosome |
| 3. B | GO:0010923 | negative regulation of phosphatase activity |
| 3. B | GO:0071356 | cellular response to tumor necrosis factor |
| 3. B | GO:0045665 | negative regulation of neuron differentiation |
| 3. B | GO:0048699 | generation of neurons |
| 3. B | GO:0071372 | cellular response to follicle-stimulating hormone stimulus |
| 3. B | GO:0061629 | RNA polymerase II-specific DNA-binding transcription factor binding |
| 3. B | GO:1904108 | protein localization to ciliary inversin compartment |
| 3. B | GO:0009950 | dorsal/ventral axis specification |
| 3. B | GO:0005525 | GTP binding |
| 3. B | GO:1900245 | positive regulation of MDA-5 signaling pathway |
| 3. B | GO:0045747 | positive regulation of Notch signaling pathway |
| 3. B | GO:0006915 | apoptotic process |
| 3. B | GO:0035924 | cellular response to vascular endothelial growth factor stimulus |
| 3. B | GO:0106311 | |
| 3. B | GO:0014832 | urinary bladder smooth muscle contraction |
| 3. B | GO:0071889 | 14-3-3 protein binding |
| 3. B | GO:0006606 | protein import into nucleus |
| 3. B | GO:0090521 | glomerular visceral epithelial cell migration |
| 3. B | GO:0031436 | BRCA1-BARD1 complex |
| 3. B | GO:0045944 | positive regulation of transcription by RNA polymerase II |
| 3. B | GO:0050768 | negative regulation of neurogenesis |
| 3. B | GO:0030307 | positive regulation of cell growth |
| 3. B | GO:0099092 | postsynaptic density, intracellular component |
| 3. B | GO:0045893 | positive regulation of transcription, DNA-templated |
| 3. B | GO:0005249 | voltage-gated potassium channel activity |
| 3. B | GO:0045211 | postsynaptic membrane |
| 3. B | GO:0010838 | positive regulation of keratinocyte proliferation |
| 3. B | GO:0010976 | positive regulation of neuron projection development |
| 3. B | GO:0031941 | filamentous actin |
| 3. B | GO:0032270 | positive regulation of cellular protein metabolic process |
| 3. B | GO:0043491 | protein kinase B signaling |
| 3. B | GO:0005902 | microvillus |
| 3. B | GO:0036336 | dendritic cell migration |
| 3. B | GO:0016055 | Wnt signaling pathway |
| 3. B | GO:0048873 | homeostasis of number of cells within a tissue |
| 3. B | GO:0051967 | negative regulation of synaptic transmission, glutamatergic |
| 3. B | GO:0061195 | taste bud formation |
| 3. B | GO:0018345 | protein palmitoylation |
| 3. B | GO:1904106 | protein localization to microvillus |
| 3. B | GO:0032288 | myelin assembly |
| 3. B | GO:0021515 | cell differentiation in spinal cord |
| 3. B | GO:0015271 | outward rectifier potassium channel activity |
| 3. B | GO:0002011 | morphogenesis of an epithelial sheet |
| 3. B | GO:0071212 | subsynaptic reticulum |
| 3. B | GO:0014807 | regulation of somitogenesis |
| 3. B | GO:0031670 | cellular response to nutrient |
| 3. B | GO:0090090 | negative regulation of canonical Wnt signaling pathway |
| 3. B | GO:0030279 | negative regulation of ossification |
| 3. B | GO:0048663 | neuron fate commitment |
| 3. B | GO:0030016 | myofibril |
| 3. B | GO:0006584 | catecholamine metabolic process |
| 3. B | GO:0060743 | epithelial cell maturation involved in prostate gland development |
| 3. B | GO:0003182 | coronary sinus valve morphogenesis |
| 3. B | GO:0055117 | regulation of cardiac muscle contraction |
| 3. B | GO:1902339 | positive regulation of apoptotic process involved in morphogenesis |
| 3. B | GO:0044605 | phosphocholine transferase activity |
| 3. B | GO:0006929 | substrate-dependent cell migration |
| 3. B | GO:0030424 | axon |
| 3. B | GO:0035307 | positive regulation of protein dephosphorylation |
| 3. B | GO:0007409 | axonogenesis |
| 3. B | GO:0051146 | striated muscle cell differentiation |
| 3. B | GO:0035255 | ionotropic glutamate receptor binding |
| 3. B | GO:0003714 | transcription corepressor activity |
| 3. B | GO:0043069 | negative regulation of programmed cell death |
| 3. B | GO:1902260 | negative regulation of delayed rectifier potassium channel activity |
| 3. B | GO:0031013 | troponin I binding |
| 3. B | GO:0031430 | M band |
| 3. B | GO:0050678 | regulation of epithelial cell proliferation |
| 3. B | GO:0043046 | DNA methylation involved in gamete generation |
| 3. B | GO:0070198 | protein localization to chromosome, telomeric region |
| 3. B | GO:0090238 | positive regulation of arachidonic acid secretion |
| 3. B | GO:0045751 | negative regulation of Toll signaling pathway |
| 3. B | GO:0072576 | liver morphogenesis |
| 3. B | GO:0007030 | Golgi organization |
| 3. B | GO:0045838 | positive regulation of membrane potential |
| 3. B | GO:0005929 | cilium |
| 3. B | GO:1902263 | apoptotic process involved in embryonic digit morphogenesis |
| 3. B | GO:0036371 | protein localization to T-tubule |
| 3. B | GO:0035172 | hemocyte proliferation |
| 3. B | GO:0003344 | pericardium morphogenesis |
| 3. B | GO:0060076 | excitatory synapse |
| 3. B | GO:0070742 | C2H2 zinc finger domain binding |
| 3. B | GO:0140627 | ubiquitin-dependent protein catabolic process via the C-end degron rule pathway |
| 3. B | GO:0003208 | cardiac ventricle morphogenesis |
| 3. B | GO:0003214 | cardiac left ventricle morphogenesis |
| 3. B | GO:2000812 | regulation of barbed-end actin filament capping |
| 3. B | GO:0010424 | DNA methylation on cytosine within a CG sequence |
| 3. B | GO:0051101 | regulation of DNA binding |
| 3. B | GO:0014731 | spectrin-associated cytoskeleton |
| 3. B | GO:0005737 | cytoplasm |
| 3. B | GO:0098978 | glutamatergic synapse |
| 3. B | GO:2000001 | regulation of DNA damage checkpoint |
| 3. B | GO:0055013 | cardiac muscle cell development |
| 3. B | GO:0072114 | pronephros morphogenesis |
| 3. B | GO:0061630 | ubiquitin protein ligase activity |
| 3. B | GO:0010882 | regulation of cardiac muscle contraction by calcium ion signaling |
| 3. B | GO:0043005 | neuron projection |
| 3. B | GO:0098871 | postsynaptic actin cytoskeleton |
| 3. B | GO:0097435 | supramolecular fiber organization |
| 3. B | GO:0035153 | epithelial cell type specification, open tracheal system |
| 3. B | GO:0046331 | lateral inhibition |
| 3. B | GO:0014704 | intercalated disc |
| 3. B | GO:0042995 | cell projection |
| 3. B | GO:0019901 | protein kinase binding |
| 3. B | GO:0046959 | habituation |
| 3. B | GO:0001955 | blood vessel maturation |
| 3. B | GO:0010225 | response to UV-C |
| 3. B | GO:0099519 | dense core granule cytoskeletal transport |
| 3. B | GO:0007219 | Notch signaling pathway |
| 3. B | GO:0035994 | response to muscle stretch |
| 3. B | GO:0038023 | signaling receptor activity |
| 3. B | GO:0060354 | negative regulation of cell adhesion molecule production |
| 3. B | GO:0010881 | regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion |
| 3. B | GO:0031441 | negative regulation of mRNA 3'-end processing |
| 3. B | GO:0032232 | negative regulation of actin filament bundle assembly |
| 3. B | GO:0034638 | phosphatidylcholine catabolic process |
| 3. B | GO:0021546 | rhombomere development |
| 3. B | GO:0003332 | negative regulation of extracellular matrix constituent secretion |
| 3. B | GO:0046976 | histone methyltransferase activity (H3-K27 specific) |
| 3. B | GO:1905274 | regulation of modification of postsynaptic actin cytoskeleton |
| 3. B | GO:0005856 | cytoskeleton |
| 3. B | GO:0031047 | gene silencing by RNA |
| 3. B | GO:0042048 | olfactory behavior |
| 3. B | GO:0071222 | cellular response to lipopolysaccharide |
| 3. B | GO:0071447 | cellular response to hydroperoxide |
| 3. B | GO:0032580 | Golgi cisterna membrane |
| 3. B | GO:0035914 | skeletal muscle cell differentiation |
| 3. B | GO:0016529 | sarcoplasmic reticulum |
| 3. B | GO:0071800 | podosome assembly |
| 3. B | GO:0060288 | formation of a compartment boundary |
| 3. B | GO:0051497 | negative regulation of stress fiber assembly |
| 3. B | GO:0005096 | GTPase activator activity |
| 3. B | GO:0030034 | microvillar actin bundle assembly |
| 3. B | GO:1901222 | regulation of NIK/NF-kappaB signaling |
| 3. B | GO:0045672 | positive regulation of osteoclast differentiation |
| 3. B | GO:1904743 | negative regulation of telomeric DNA binding |
| 3. B | GO:0071347 | cellular response to interleukin-1 |
| 3. B | GO:1900383 | regulation of synaptic plasticity by receptor localization to synapse |
| 3. B | GO:0003241 | growth involved in heart morphogenesis |
| 3. B | GO:0072660 | maintenance of protein location in plasma membrane |
| 3. B | GO:0015629 | actin cytoskeleton |
| 3. B | GO:0009967 | positive regulation of signal transduction |
| 3. B | GO:0086004 | regulation of cardiac muscle cell contraction |
| 3. B | GO:0055007 | cardiac muscle cell differentiation |
| 3. B | GO:0060289 | compartment boundary maintenance |
| 3. B | GO:0031674 | I band |
| 3. B | GO:2000134 | negative regulation of G1/S transition of mitotic cell cycle |
| 3. B | GO:0043197 | dendritic spine |
| 3. B | GO:0005112 | Notch binding |
| 3. B | GO:0003198 | epithelial to mesenchymal transition involved in endocardial cushion formation |
| 3. B | GO:0102991 | myristoyl-CoA hydrolase activity |
| 3. B | GO:1901187 | regulation of ephrin receptor signaling pathway |
| 3. B | GO:0010378 | temperature compensation of the circadian clock |
| 3. B | GO:0061028 | establishment of endothelial barrier |
| 3. B | GO:0001889 | liver development |
| 3. B | GO:0008285 | negative regulation of cell population proliferation |
| 3. B | GO:0045197 | establishment or maintenance of epithelial cell apical/basal polarity |
| 3. B | GO:0060674 | placenta blood vessel development |
| 3. B | GO:0033209 | tumor necrosis factor-mediated signaling pathway |
| 3. B | GO:0036309 | protein localization to M-band |
| 3. B | GO:0065001 | specification of axis polarity |
| 3. B | GO:0050750 | low-density lipoprotein particle receptor binding |
| 3. B | GO:0060317 | cardiac epithelial to mesenchymal transition |
| 3. B | GO:0060948 | cardiac vascular smooth muscle cell development |
| 3. B | GO:0086069 | bundle of His cell to Purkinje myocyte communication |
| 3. B | GO:0045732 | positive regulation of protein catabolic process |
| 3. B | GO:0034446 | substrate adhesion-dependent cell spreading |
| 3. B | GO:0002357 | defense response to tumor cell |
| 3. B | GO:0002070 | epithelial cell maturation |
| 3. B | GO:0031432 | titin binding |
| 3. B | GO:0034112 | positive regulation of homotypic cell-cell adhesion |
| 3. B | GO:0060442 | branching involved in prostate gland morphogenesis |
| 3. B | GO:0006471 | protein ADP-ribosylation |
| 3. B | GO:0070531 | BRCA1-A complex |
| 3. B | GO:0030154 | cell differentiation |
| 3. B | GO:0060842 | arterial endothelial cell differentiation |
| 3. B | GO:0086070 | SA node cell to atrial cardiac muscle cell communication |
| 3. B | GO:0042327 | positive regulation of phosphorylation |
| 3. B | GO:0045955 | negative regulation of calcium ion-dependent exocytosis |
| 3. B | GO:0090160 | Golgi to lysosome transport |
| 3. B | GO:2001027 | negative regulation of endothelial cell chemotaxis |
| 3. B | GO:0043268 | positive regulation of potassium ion transport |
| 3. B | GO:0035518 | histone H2A monoubiquitination |
| 3. B | GO:0042981 | regulation of apoptotic process |
| 3. B | GO:0031267 | small GTPase binding |
| 3. B | GO:0016021 | integral component of membrane |
| 3. B | GO:0060035 | notochord cell development |
| 3. B | GO:0002193 | MAML1-RBP-Jkappa- ICN1 complex |
| 3. B | GO:0046579 | positive regulation of Ras protein signal transduction |
| 3. B | GO:0045685 | regulation of glial cell differentiation |
| 3. B | GO:0030513 | positive regulation of BMP signaling pathway |
| 3. B | GO:2000737 | negative regulation of stem cell differentiation |
| 3. B | GO:0048754 | branching morphogenesis of an epithelial tube |
| 3. B | GO:0010001 | glial cell differentiation |
| 3. B | GO:0000062 | fatty-acyl-CoA binding |
| 3. B | GO:1902531 | regulation of intracellular signal transduction |
| 3. B | GO:1900827 | positive regulation of membrane depolarization during cardiac muscle cell action potential |
| 3. B | GO:0031960 | response to corticosteroid |
| 3. B | GO:0060074 | synapse maturation |
| 3. B | GO:0003256 | regulation of transcription from RNA polymerase II promoter involved in myocardial precursor cell differentiation |
| 3. B | GO:1901201 | regulation of extracellular matrix assembly |
| 3. B | GO:0048892 | lateral line nerve development |
| 3. B | GO:0032049 | cardiolipin biosynthetic process |
| 3. B | GO:0010667 | negative regulation of cardiac muscle cell apoptotic process |
| 3. B | GO:0038061 | NIK/NF-kappaB signaling |
| 3. B | GO:0019730 | antimicrobial humoral response |
| 3. B | GO:0005938 | cell cortex |
| 3. B | GO:0042802 | identical protein binding |
| 3. B | GO:0005654 | nucleoplasm |
| 3. B | GO:0048708 | astrocyte differentiation |
| 3. B | GO:0001708 | cell fate specification |
| 3. B | GO:0030674 | protein-macromolecule adaptor activity |
| 3. B | GO:0034058 | endosomal vesicle fusion |
| 3. B | GO:0003222 | ventricular trabecula myocardium morphogenesis |
| 3. B | GO:0030326 | embryonic limb morphogenesis |
| 3. B | GO:0060740 | prostate gland epithelium morphogenesis |
| 3. B | GO:0030837 | negative regulation of actin filament polymerization |
| 3. B | GO:0071286 | cellular response to magnesium ion |
| 3. B | GO:1905938 | positive regulation of germ cell proliferation |
| 3. B | GO:0060411 | cardiac septum morphogenesis |
| 3. B | GO:0050775 | positive regulation of dendrite morphogenesis |
| 3. B | GO:0032717 | negative regulation of interleukin-8 production |
| 3. B | GO:0060113 | inner ear receptor cell differentiation |
| 3. B | GO:0045967 | negative regulation of growth rate |
| 3. B | GO:0043034 | costamere |
| 3. B | GO:0021986 | habenula development |
| 3. B | GO:0018230 | peptidyl-L-cysteine S-palmitoylation |
| 3. B | GO:0032791 | lead ion binding |
| 3. B | GO:0030046 | parallel actin filament bundle assembly |
| 3. B | GO:0046843 | dorsal appendage formation |
| 3. B | GO:0016567 | protein ubiquitination |
| 3. B | GO:0051059 | NF-kappaB binding |
| 3. B | GO:0036166 | phenotypic switching |
| 3. B | GO:0046469 | platelet activating factor metabolic process |
| 3. B | GO:0007605 | sensory perception of sound |
| 3. B | GO:0044877 | protein-containing complex binding |
| 3. B | GO:0070986 | left/right axis specification |
| 3. B | GO:0005576 | extracellular region |
| 3. B | GO:0019887 | protein kinase regulator activity |
| 3. B | GO:0046974 | histone methyltransferase activity (H3-K9 specific) |
| 3. B | GO:0098908 | regulation of neuronal action potential |
| 3. B | GO:0018024 | histone-lysine N-methyltransferase activity |
| 3. B | GO:0010468 | regulation of gene expression |
| 3. B | GO:0021915 | neural tube development |
| 3. B | GO:0030018 | Z disc |
| 3. B | GO:0002467 | germinal center formation |
| 3. B | GO:0036377 | arbuscular mycorrhizal association |
| 3. B | GO:0046473 | phosphatidic acid metabolic process |
| 3. B | GO:0007221 | positive regulation of transcription of Notch receptor target |
| 3. B | GO:0099612 | protein localization to axon |
| 3. B | GO:1902041 | regulation of extrinsic apoptotic signaling pathway via death domain receptors |
| 3. B | GO:0005524 | ATP binding |
| 3. B | GO:0061419 | positive regulation of transcription from RNA polymerase II promoter in response to hypoxia |
| 3. B | GO:0045669 | positive regulation of osteoblast differentiation |
| 3. B | GO:0042686 | regulation of cardioblast cell fate specification |
| 3. B | GO:0046338 | phosphatidylethanolamine catabolic process |
| 3. B | GO:0071260 | cellular response to mechanical stimulus |
| 3. B | GO:0097422 | tubular endosome |
| 3. B | GO:0018027 | peptidyl-lysine dimethylation |
| 3. B | GO:0010960 | magnesium ion homeostasis |
| 3. B | GO:2001204 | regulation of osteoclast development |
| 3. B | GO:0001650 | fibrillar center |
| 3. B | GO:0048536 | spleen development |
| 3. B | GO:0042826 | histone deacetylase binding |
| 3. B | GO:1990090 | cellular response to nerve growth factor stimulus |
| 3. B | GO:0140261 | BCOR complex |
| 3. B | GO:0035418 | protein localization to synapse |
| 3. B | GO:0042325 | regulation of phosphorylation |
| 3. B | GO:0010614 | negative regulation of cardiac muscle hypertrophy |
| 3. B | GO:0021675 | nerve development |
| 3. B | GO:0035646 | endosome to melanosome transport |
| 3. B | GO:0044232 | organelle membrane contact site |
| 3. B | GO:0001841 | neural tube formation |
| 3. B | GO:0048899 | anterior lateral line development |
| 3. B | GO:0033147 | negative regulation of intracellular estrogen receptor signaling pathway |
| 3. B | GO:0062043 | positive regulation of cardiac epithelial to mesenchymal transition |
| 3. B | GO:0001222 | transcription corepressor binding |
| 3. B | GO:0045316 | negative regulation of compound eye photoreceptor development |
| 3. B | GO:0007009 | plasma membrane organization |
| 3. B | GO:0045607 | regulation of inner ear auditory receptor cell differentiation |
| 3. B | GO:0043292 | contractile fiber |
| 3. B | GO:0042691 | positive regulation of crystal cell differentiation |
| 3. B | GO:0032996 | Bcl3-Bcl10 complex |
| 3. B | GO:0043517 | positive regulation of DNA damage response, signal transduction by p53 class mediator |
| 3. B | GO:0019843 | rRNA binding |
| 3. B | GO:0070212 | protein poly-ADP-ribosylation |
| 3. B | GO:2000048 | negative regulation of cell-cell adhesion mediated by cadherin |
| 3. B | GO:1904058 | positive regulation of sensory perception of pain |
| 3. B | GO:0060979 | vasculogenesis involved in coronary vascular morphogenesis |
| 3. B | GO:0007160 | cell-matrix adhesion |
| 3. B | GO:0000151 | ubiquitin ligase complex |
| 3. B | GO:0030160 | synaptic receptor adaptor activity |
| 3. B | GO:2000209 | regulation of anoikis |
| 3. B | GO:0045662 | negative regulation of myoblast differentiation |
| 3. B | GO:0019228 | neuronal action potential |
| 3. B | GO:0072017 | distal tubule development |
| 3. B | GO:0007440 | foregut morphogenesis |
| 3. B | GO:0048711 | positive regulation of astrocyte differentiation |
| 3. B | GO:0072073 | kidney epithelium development |
| 3. B | GO:0045859 | regulation of protein kinase activity |
| 3. B | GO:0051569 | regulation of histone H3-K4 methylation |
| 3. B | GO:0004622 | lysophospholipase activity |
| 3. B | GO:0035023 | regulation of Rho protein signal transduction |
| 3. B | GO:0072357 | PTW/PP1 phosphatase complex |
| 3. B | GO:0007386 | compartment pattern specification |
| 3. B | GO:0010650 | positive regulation of cell communication by electrical coupling |
| 3. B | GO:0003181 | atrioventricular valve morphogenesis |
| 3. B | GO:0090051 | negative regulation of cell migration involved in sprouting angiogenesis |
| 3. B | GO:0042663 | regulation of endodermal cell fate specification |
| 3. B | GO:0007478 | leg disc morphogenesis |
| 3. B | GO:0010638 | positive regulation of organelle organization |
| 3. B | GO:0060768 | regulation of epithelial cell proliferation involved in prostate gland development |
| 3. B | GO:0060998 | regulation of dendritic spine development |
| 3. B | GO:2000811 | negative regulation of anoikis |
| 3. B | GO:0006897 | endocytosis |
| 3. B | GO:0032934 | sterol binding |
| 3. B | GO:0070650 | actin filament bundle distribution |
| 3. B | GO:0045608 | negative regulation of inner ear auditory receptor cell differentiation |
| 3. B | GO:0055008 | cardiac muscle tissue morphogenesis |
| 3. B | GO:1901339 | regulation of store-operated calcium channel activity |
| 3. B | GO:0014066 | regulation of phosphatidylinositol 3-kinase signaling |
| 3. B | GO:0006887 | exocytosis |
| 3. B | GO:0071314 | cellular response to cocaine |
| 3. B | GO:0000242 | pericentriolar material |
| 3. B | GO:2000096 | positive regulation of Wnt signaling pathway, planar cell polarity pathway |
| 3. B | GO:0003197 | endocardial cushion development |
| 3. B | GO:0016604 | nuclear body |
| 3. B | GO:0003723 | RNA binding |
| 3. B | GO:0098685 | Schaffer collateral - CA1 synapse |
| 3. B | GO:0042665 | regulation of ectodermal cell fate specification |
| 3. B | GO:1903589 | positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis |
| 3. B | GO:0098907 | regulation of SA node cell action potential |
| 3. B | GO:0003203 | endocardial cushion morphogenesis |
| 3. B | GO:0003408 | optic cup formation involved in camera-type eye development |
| 3. B | GO:1905667 | negative regulation of protein localization to endosome |
| 3. B | GO:1900026 | positive regulation of substrate adhesion-dependent cell spreading |
| 3. B | GO:0035965 | cardiolipin acyl-chain remodeling |
| 3. B | GO:0003677 | DNA binding |
| 3. B | GO:0048471 | perinuclear region of cytoplasm |
| 3. B | GO:0030155 | regulation of cell adhesion |
| 3. B | GO:0086014 | atrial cardiac muscle cell action potential |
| 3. B | GO:0016409 | palmitoyltransferase activity |
| 3. B | GO:0008270 | zinc ion binding |
| 3. B | GO:0003184 | pulmonary valve morphogenesis |
| 3. B | GO:0046957 | negative phototaxis |
| 3. B | GO:0030507 | spectrin binding |
| 3. B | GO:0043518 | negative regulation of DNA damage response, signal transduction by p53 class mediator |
| 3. B | GO:0003169 | coronary vein morphogenesis |
| 3. B | GO:1904908 | negative regulation of maintenance of mitotic sister chromatid cohesion, telomeric |
| 3. B | GO:0060528 | secretory columnal luminar epithelial cell differentiation involved in prostate glandular acinus development |
| 3. B | GO:0002315 | marginal zone B cell differentiation |
| 3. B | GO:0010832 | negative regulation of myotube differentiation |
| 3. B | GO:0071532 | ankyrin repeat binding |
| 3. B | GO:0070682 | proteasome regulatory particle assembly |
| 3. B | GO:0070936 | protein K48-linked ubiquitination |
| 3. B | GO:0070412 | R-SMAD binding |
| 3. B | GO:0140439 | protein-cysteine S-stearoyltransferase activity |
| 3. B | GO:0051438 | regulation of ubiquitin-protein transferase activity |
| 3. B | GO:0045648 | positive regulation of erythrocyte differentiation |
| 3. B | GO:0031143 | pseudopodium |
| 3. B | GO:0051017 | actin filament bundle assembly |
| 3. B | GO:1900087 | positive regulation of G1/S transition of mitotic cell cycle |
| 3. B | GO:0032495 | response to muramyl dipeptide |
| 3. B | GO:0007368 | determination of left/right symmetry |
| 3. B | GO:0071244 | cellular response to carbon dioxide |
| 3. B | GO:0060982 | coronary artery morphogenesis |
| 3. B | GO:0007616 | long-term memory |
| 3. B | GO:0045687 | positive regulation of glial cell differentiation |
| 3. B | GO:0014069 | postsynaptic density |
| 3. B | GO:0070431 | nucleotide-binding oligomerization domain containing 2 signaling pathway |
| 3. B | GO:0001954 | positive regulation of cell-matrix adhesion |
| 3. B | GO:0051726 | regulation of cell cycle |
| 3. B | GO:0002268 | follicular dendritic cell differentiation |
| 3. B | GO:0014912 | negative regulation of smooth muscle cell migration |
| 3. B | GO:0031359 | integral component of chloroplast outer membrane |
| 3. B | GO:0010780 | meiotic DNA double-strand break formation involved in reciprocal meiotic recombination |
| 3. B | GO:0071407 | cellular response to organic cyclic compound |
| 3. B | GO:0031867 | EP4 subtype prostaglandin E2 receptor binding |
| 3. B | GO:0015248 | sterol transporter activity |
| 3. B | GO:0048103 | somatic stem cell division |
| 3. B | GO:0043266 | regulation of potassium ion transport |
| 3. B | GO:0050955 | thermoception |
| 3. B | GO:0060843 | venous endothelial cell differentiation |
| 3. B | GO:2000651 | positive regulation of sodium ion transmembrane transporter activity |
| 3. B | GO:0006528 | asparagine metabolic process |
| 3. B | GO:0032496 | response to lipopolysaccharide |
| 3. B | GO:0014065 | phosphatidylinositol 3-kinase signaling |
| 3. B | GO:0140031 | phosphorylation-dependent protein binding |
| 3. B | GO:0001934 | positive regulation of protein phosphorylation |
| 3. B | GO:0050957 | equilibrioception |
| 3. B | GO:0003207 | cardiac chamber formation |
| 3. B | GO:0061384 | heart trabecula morphogenesis |
| 3. B | GO:0043619 | regulation of transcription from RNA polymerase II promoter in response to oxidative stress |
| 3. B | GO:0048060 | negative gravitaxis |
| 3. B | GO:0072015 | glomerular visceral epithelial cell development |
| 3. B | GO:2000304 | positive regulation of ceramide biosynthetic process |
| 3. B | GO:0070171 | negative regulation of tooth mineralization |
| 3. B | GO:0034703 | cation channel complex |
| 3. B | GO:0019208 | phosphatase regulator activity |
| 3. B | GO:0030315 | T-tubule |
| 3. B | GO:0043161 | proteasome-mediated ubiquitin-dependent protein catabolic process |
| 3. B | GO:0043280 | positive regulation of cysteine-type endopeptidase activity involved in apoptotic process |
| 3. B | GO:0003209 | cardiac atrium morphogenesis |
| 3. B | GO:0090263 | positive regulation of canonical Wnt signaling pathway |
| 3. B | GO:0048052 | R1/R6 cell differentiation |
| 3. B | GO:1903670 | regulation of sprouting angiogenesis |
| 3. B | GO:0021531 | spinal cord radial glial cell differentiation |
| 3. B | GO:0010888 | negative regulation of lipid storage |
| 3. B | GO:0010761 | fibroblast migration |
| 3. B | GO:0005262 | calcium channel activity |
| 3. B | GO:0017020 | myosin phosphatase regulator activity |
| 3. B | GO:0008290 | F-actin capping protein complex |
| 3. B | GO:0102545 | phosphatidyl phospholipase B activity |
| 3. B | GO:0097062 | dendritic spine maintenance |
| 3. B | GO:0031901 | early endosome membrane |
| 3. B | GO:0031672 | A band |
| 3. B | GO:0003213 | cardiac right atrium morphogenesis |
| 3. B | GO:0045602 | negative regulation of endothelial cell differentiation |
| 3. B | GO:0090575 | RNA polymerase II transcription regulator complex |
| 3. B | GO:0050793 | regulation of developmental process |
| 3. B | GO:0098910 | regulation of atrial cardiac muscle cell action potential |
| 3. B | GO:0043194 | axon initial segment |
| 3. B | GO:0009912 | auditory receptor cell fate commitment |
| 3. B | GO:0030941 | chloroplast targeting sequence binding |
| 3. B | GO:0099527 | postsynapse to nucleus signaling pathway |
| 3. B | GO:0046849 | bone remodeling |
| 3. B | GO:2000249 | regulation of actin cytoskeleton reorganization |
| 3. B | GO:0048265 | response to pain |
| 3. B | GO:0016279 | protein-lysine N-methyltransferase activity |
| 3. B | GO:0043066 | negative regulation of apoptotic process |
| 3. B | GO:0007165 | signal transduction |
| 3. B | GO:1904355 | positive regulation of telomere capping |
| 3. B | GO:0010745 | negative regulation of macrophage derived foam cell differentiation |
| 3. B | GO:0033270 | paranode region of axon |
| 3. B | GO:0001895 | retina homeostasis |
| 3. B | GO:0031466 | Cul5-RING ubiquitin ligase complex |
| 3. B | GO:1901223 | negative regulation of NIK/NF-kappaB signaling |
| 3. B | GO:0097543 | ciliary inversin compartment |
| 3. B | GO:0017124 | SH3 domain binding |
| 3. B | GO:0003847 | 1-alkyl-2-acetylglycerophosphocholine esterase activity |
| 3. B | GO:0046822 | regulation of nucleocytoplasmic transport |
| 3. B | GO:0003219 | cardiac right ventricle formation |
| 3. B | GO:0001658 | branching involved in ureteric bud morphogenesis |
| 3. B | GO:0017171 | serine hydrolase activity |
| 3. B | GO:0072144 | glomerular mesangial cell development |
| 3. B | GO:0016235 | aggresome |
| 3. B | GO:0060956 | endocardial cell differentiation |
| 3. B | GO:0042383 | sarcolemma |
| 3. B | GO:1901189 | positive regulation of ephrin receptor signaling pathway |
| 3. B | GO:0070427 | nucleotide-binding oligomerization domain containing 1 signaling pathway |
| 3. B | GO:0030030 | cell projection organization |
| 3. B | GO:0050931 | pigment cell differentiation |
| 3. B | GO:0060038 | cardiac muscle cell proliferation |
| 3. B | GO:0030029 | actin filament-based process |
| 3. B | GO:0032212 | positive regulation of telomere maintenance via telomerase |
| 3. B | GO:0002040 | sprouting angiogenesis |
| 3. B | GO:0007569 | cell aging |
| 3. B | GO:0045064 | T-helper 2 cell differentiation |
| 3. B | GO:0061001 | regulation of dendritic spine morphogenesis |
| 3. B | GO:2000279 | negative regulation of DNA biosynthetic process |
| 3. B | GO:0045596 | negative regulation of cell differentiation |
| 3. B | GO:0061025 | membrane fusion |
| 3. B | GO:0051386 | regulation of neurotrophin TRK receptor signaling pathway |
| 3. B | GO:1990393 | 3M complex |
| 3. B | GO:0060803 | BMP signaling pathway involved in mesodermal cell fate specification |
| 3. B | GO:0045618 | positive regulation of keratinocyte differentiation |
| 3. B | GO:0003180 | aortic valve morphogenesis |
| 3. B | GO:1990705 | cholangiocyte proliferation |
| 3. B | GO:0060013 | righting reflex |
| 3. B | GO:0050968 | detection of chemical stimulus involved in sensory perception of pain |
| 3. B | GO:0042246 | tissue regeneration |
| 3. B | GO:0003157 | endocardium development |
| 3. B | GO:0007229 | integrin-mediated signaling pathway |
| 3. B | GO:0002455 | humoral immune response mediated by circulating immunoglobulin |
| 3. B | GO:1903343 | positive regulation of meiotic DNA double-strand break formation |
| 3. B | GO:0046533 | negative regulation of photoreceptor cell differentiation |
| 3. B | GO:0097150 | neuronal stem cell population maintenance |
| 3. B | GO:0060045 | positive regulation of cardiac muscle cell proliferation |
| 3. B | GO:0048013 | ephrin receptor signaling pathway |
| 3. B | GO:1901019 | regulation of calcium ion transmembrane transporter activity |
| 3. B | GO:0035171 | lamellocyte differentiation |
| 3. B | GO:0031625 | ubiquitin protein ligase binding |
| 3. B | GO:1903849 | positive regulation of aorta morphogenesis |
| 3. B | GO:0003713 | transcription coactivator activity |
| 3. B | GO:0045162 | clustering of voltage-gated sodium channels |
| 3. B | GO:0060413 | atrial septum morphogenesis |
| 3. B | GO:0051865 | protein autoubiquitination |
| 3. B | GO:0003192 | mitral valve formation |
| 3. B | GO:0043065 | positive regulation of apoptotic process |
| 3. B | GO:0008139 | nuclear localization sequence binding |
| 3. B | GO:0030027 | lamellipodium |
| 3. B | GO:0000415 | negative regulation of histone H3-K36 methylation |
| 3. B | GO:0033268 | node of Ranvier |
| 3. B | GO:0048665 | neuron fate specification |
| 3. B | GO:0090200 | positive regulation of release of cytochrome c from mitochondria |
| 3. B | GO:0003264 | regulation of cardioblast proliferation |
| 3. B | GO:0019705 | protein-cysteine S-myristoyltransferase activity |
| 3. B | GO:0010613 | positive regulation of cardiac muscle hypertrophy |
| 3. B | GO:0001835 | blastocyst hatching |
| 3. B | GO:0061314 | Notch signaling involved in heart development |
| 3. B | GO:0008361 | regulation of cell size |
| 3. B | GO:0071709 | membrane assembly |
| 3. B | GO:0015278 | calcium-release channel activity |
| 3. B | GO:0045921 | positive regulation of exocytosis |
| 3. B | GO:0043422 | protein kinase B binding |
| 3. B | GO:1990756 | ubiquitin ligase-substrate adaptor activity |
| 3. B | GO:0060992 | response to fungicide |
| 3. B | GO:2000463 | positive regulation of excitatory postsynaptic potential |
| 3. B | GO:0016290 | palmitoyl-CoA hydrolase activity |
| 3. B | GO:0014732 | skeletal muscle atrophy |
| 3. B | GO:0030673 | axolemma |
| 3. B | GO:0019899 | enzyme binding |
| 3. B | GO:0060361 | flight |
| 3. B | GO:0099173 | postsynapse organization |
| 3. B | GO:0051570 | regulation of histone H3-K9 methylation |
| 3. B | GO:0045466 | R7 cell differentiation |
| 3. B | GO:0034587 | piRNA metabolic process |
| 3. B | GO:0004857 | enzyme inhibitor activity |
| 3. B | GO:2000974 | negative regulation of pro-B cell differentiation |
| 3. B | GO:0060997 | dendritic spine morphogenesis |
| 3. B | GO:0048845 | venous blood vessel morphogenesis |
| 3. B | GO:1901018 | positive regulation of potassium ion transmembrane transporter activity |
| 3. B | GO:0050714 | positive regulation of protein secretion |
| 3. B | GO:0060135 | maternal process involved in female pregnancy |
| 3. B | GO:0031663 | lipopolysaccharide-mediated signaling pathway |
| 3. B | GO:2000311 | regulation of AMPA receptor activity |
| 3. B | GO:0043055 | maintenance of dauer |
| 3. B | GO:0086066 | atrial cardiac muscle cell to AV node cell communication |
| 3. B | GO:1901021 | positive regulation of calcium ion transmembrane transporter activity |
| 3. B | GO:1901224 | positive regulation of NIK/NF-kappaB signaling |
| 3. B | GO:0060253 | negative regulation of glial cell proliferation |
| 3. B | GO:0005925 | focal adhesion |
| 3. B | GO:0050966 | detection of mechanical stimulus involved in sensory perception of pain |
| 3. B | GO:0021707 | cerebellar granule cell differentiation |
| 3. B | GO:0033256 | I-kappaB/NF-kappaB complex |
| 3. B | GO:0014031 | mesenchymal cell development |
| 3. B | GO:0051151 | negative regulation of smooth muscle cell differentiation |
| 3. B | GO:0032991 | protein-containing complex |
| 3. B | GO:0005829 | cytosol |
| 3. B | GO:0046872 | metal ion binding |
| 3. B | GO:0035544 | negative regulation of SNARE complex assembly |
| 3. B | GO:0035508 | positive regulation of myosin-light-chain-phosphatase activity |
| 3. B | GO:0097553 | calcium ion transmembrane import into cytosol |
| 3. B | GO:0000139 | Golgi membrane |
| 3. B | GO:0035556 | intracellular signal transduction |
| 3. B | GO:0019706 | protein-cysteine S-palmitoyltransferase activity |
| 3. B | GO:0003273 | cell migration involved in endocardial cushion formation |
| 3. B | GO:0051572 | negative regulation of histone H3-K4 methylation |
| 3. B | GO:1903793 | positive regulation of anion transport |
| 3. B | GO:0070168 | negative regulation of biomineral tissue development |
| 3. B | GO:0044354 | macropinosome |
| 3. B | GO:0035507 | regulation of myosin-light-chain-phosphatase activity |
| 3. B | GO:1904357 | negative regulation of telomere maintenance via telomere lengthening |
| 3. B | GO:0061344 | regulation of cell adhesion involved in heart morphogenesis |
| 3. B | GO:0032088 | negative regulation of NF-kappaB transcription factor activity |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q5JPF3 | Ankyrin repeat domain-containing protein 36C | 3.86e-07 | 9.86e-90 | 0.0 |
| 1. PB | Q9BXX3 | Ankyrin repeat domain-containing protein 30A | 2.07e-05 | 4.30e-26 | 2.58e-82 |
| 1. PB | A6QL64 | Ankyrin repeat domain-containing protein 36A | 0 | 6.42e-164 | 0.0 |
| 1. PB | Q8N2N9 | Ankyrin repeat domain-containing protein 36B | 1.61e-06 | 9.94e-40 | 0.0 |
| 1. PB | Q9BXX2 | Ankyrin repeat domain-containing protein 30B | 3.90e-05 | 8.97e-25 | 5.78e-69 |
| 2. P | A6NJ88 | Putative SAGE1-like protein | 9.19e-01 | 7.42e-03 | NA |
| 2. P | Q8NA70 | Protein FAM47B | 9.41e-01 | 1.08e-05 | NA |
| 2. P | Q08696 | Axoneme-associated protein mst101(2) | 4.34e-03 | 1.64e-02 | NA |
| 2. P | E1BM58 | Periaxin | 5.89e-01 | 1.32e-02 | NA |
| 2. P | P24710 | Involucrin | 2.78e-02 | 1.47e-05 | NA |
| 2. P | Q5JRC9 | Protein FAM47A | 6.42e-01 | 4.27e-03 | NA |
| 2. P | Q9JJ11 | Transforming acidic coiled-coil-containing protein 3 | 2.13e-01 | 1.40e-04 | NA |
| 2. P | E9Q6E9 | SUMO-interacting motif-containing protein 1 | 9.06e-01 | 4.31e-03 | NA |
| 2. P | Q2KI51 | Protein phosphatase 1 regulatory subunit 15A | 4.71e-01 | 1.32e-02 | NA |
| 2. P | P39712 | Flocculation protein FLO9 | 8.63e-01 | 2.67e-02 | NA |
| 2. P | P17564 | Protein phosphatase 1 regulatory subunit 15A | 8.66e-01 | 3.41e-03 | NA |
| 2. P | Q5HY64 | Putative protein FAM47C | 9.84e-01 | 6.96e-03 | NA |
| 2. P | F1LWT0 | SUMO-interacting motif-containing protein 1 | 7.84e-01 | 4.63e-05 | NA |
| 2. P | O88492 | Perilipin-4 | 4.40e-01 | 1.07e-07 | NA |
| 2. P | P22006 | Seminal vesicle secretory protein 2 | 8.32e-01 | 1.38e-03 | NA |
| 2. P | P97347 | Repetin | 7.92e-02 | 1.59e-04 | NA |
| 2. P | Q25060 | LWamide neuropeptides | 6.43e-01 | 8.82e-04 | NA |
| 2. P | F4JZY1 | COP1-interactive protein 1 | 2.18e-02 | 1.43e-02 | NA |
| 2. P | Q28298 | Ribosome-binding protein 1 | 1.46e-03 | 8.59e-03 | NA |
| 2. P | O15069 | NAC-alpha domain-containing protein 1 | 2.89e-01 | 6.28e-08 | NA |
| 2. P | Q9BXM0 | Periaxin | 2.94e-01 | 2.28e-04 | NA |
| 2. P | Q77Z83 | Immediate-early protein 2 | NA | 9.74e-03 | NA |
| 2. P | Q8XYE3 | TAL effector protein Brg11 | 5.59e-01 | 1.76e-02 | NA |
| 2. P | P21263 | Nestin | 2.70e-01 | 8.24e-03 | NA |
| 2. P | F4HXQ7 | Myosin-binding protein 1 | 4.31e-01 | 1.52e-03 | NA |
| 2. P | Q9D9R9 | Protein FAM186A | 6.34e-01 | 3.38e-05 | NA |
| 2. P | Q4ZJY7 | Mucin-like protein Glc1.8b | NA | 1.52e-02 | NA |
| 2. P | V6F519 | Magnetosome-associated protein MamJ | 7.99e-01 | 1.81e-03 | NA |
| 2. P | Q99PL5 | Ribosome-binding protein 1 | 9.57e-04 | 2.01e-02 | NA |
| 2. P | P38894 | Flocculation protein FLO5 | 8.72e-01 | 5.34e-03 | NA |
| 2. P | Q8JZM8 | Mucin-4 | NA | 3.92e-02 | NA |
| 2. P | P0DKL2 | Protein OPAQUE10 | 4.40e-01 | 4.42e-02 | NA |
| 2. P | Q95337 | Involucrin | 2.56e-02 | 1.39e-02 | NA |
| 2. P | Q8N307 | Mucin-20 | 9.76e-01 | 4.93e-02 | NA |
| 2. P | P18175 | Involucrin | 8.22e-03 | 7.26e-03 | NA |
| 2. P | O36421 | Uncharacterized gene 73 protein | NA | 2.05e-02 | NA |
| 2. P | Q54G05 | Putative leucine-rich repeat-containing protein DDB_G0290503 | 1.51e-03 | 4.44e-06 | NA |
| 2. P | O55103 | Periaxin | 3.11e-01 | 1.03e-02 | NA |
| 2. P | Q9C0Y2 | Putative cell agglutination protein SPAPB2C8.01 | 1.00e+00 | 8.07e-03 | NA |
| 2. P | Q9Z1Q1 | Nestin (Fragments) | 2.82e-01 | 1.52e-02 | NA |
| 2. P | Q9URU4 | Putative cell agglutination protein pfl5 | 9.81e-01 | 4.20e-02 | NA |
| 2. P | Q35142 | Uncharacterized mitochondrial protein urf-N | 2.86e-02 | 6.33e-03 | NA |
| 2. P | Q6P902 | Thioredoxin domain-containing protein 2 | 4.71e-01 | 2.23e-02 | NA |
| 3. B | Q9H560 | Putative ankyrin repeat domain-containing protein 19 | 1.30e-05 | NA | 8.18e-63 |
| 3. B | Q8BX02 | KN motif and ankyrin repeat domain-containing protein 2 | 6.80e-01 | NA | 1.81e-04 |
| 3. B | Q8VHS6 | Ankyrin repeat and SOCS box protein 15 | 8.00e-03 | NA | 0.004 |
| 3. B | Q5URB9 | Putative ankyrin repeat protein R840 | NA | NA | 0.004 |
| 3. B | Q8IZ07 | Ankyrin repeat domain-containing protein 13A | 6.25e-01 | NA | 0.021 |
| 3. B | Q9J5H9 | Putative ankyrin repeat protein FPV022 | NA | NA | 0.007 |
| 3. B | Q8IUH5 | Palmitoyltransferase ZDHHC17 | 1.21e-03 | NA | 1.12e-09 |
| 3. B | Q54KA7 | Ankyrin repeat, PH and SEC7 domain containing protein secG | 2.30e-02 | NA | 1.84e-18 |
| 3. B | Q0V8G2 | GA-binding protein subunit beta-2 | 3.45e-02 | NA | 4.24e-13 |
| 3. B | Q3MJ40 | Coiled-coil domain-containing protein 144B | 4.01e-01 | NA | 3.95e-22 |
| 3. B | P59672 | Ankyrin repeat and SAM domain-containing protein 1A | 3.74e-02 | NA | 1.58e-05 |
| 3. B | Q6AFL2 | Putative ankyrin-containing lipoprotein Lxx09580 | 1.82e-03 | NA | 0.030 |
| 3. B | O14974 | Protein phosphatase 1 regulatory subunit 12A | 2.25e-02 | NA | 1.85e-05 |
| 3. B | Q99NH0 | Ankyrin repeat domain-containing protein 17 | 1.02e-01 | NA | 6.39e-11 |
| 3. B | Q7ZYD9 | Ankyrin repeat domain-containing protein 13C-B | 6.39e-01 | NA | 0.041 |
| 3. B | A9JR78 | Tonsoku-like protein | 5.30e-01 | NA | 1.65e-04 |
| 3. B | P57078 | Receptor-interacting serine/threonine-protein kinase 4 | 3.22e-03 | NA | 1.97e-08 |
| 3. B | Q6P9J5 | KN motif and ankyrin repeat domain-containing protein 4 | 5.19e-01 | NA | 1.20e-06 |
| 3. B | Q499M5 | Ankyrin repeat domain-containing protein 16 | 1.45e-03 | NA | 2.99e-06 |
| 3. B | Q3TYL0 | IQ motif and ankyrin repeat domain-containing protein 1 | 8.73e-02 | NA | 0.022 |
| 3. B | Q9Y575 | Ankyrin repeat and SOCS box protein 3 | 3.78e-04 | NA | 6.94e-12 |
| 3. B | Q1LZC5 | Ankyrin repeat domain-containing protein 54 | 3.19e-01 | NA | 2.82e-06 |
| 3. B | P0C6P7 | Protein fem-1 homolog B | 3.19e-02 | NA | 6.99e-06 |
| 3. B | Q8CEF1 | Protein fem-1 homolog C | 2.32e-02 | NA | 0.004 |
| 3. B | Q9WV74 | Ankyrin repeat and SOCS box protein 1 | 4.85e-03 | NA | 0.011 |
| 3. B | Q9J5H8 | Putative ankyrin repeat protein FPV023 | NA | NA | 2.66e-04 |
| 3. B | D3J162 | Protein VAPYRIN | 3.74e-02 | NA | 1.16e-05 |
| 3. B | Q0P5B9 | Ankyrin repeat domain-containing protein 39 | 3.17e-02 | NA | 2.15e-06 |
| 3. B | Q4UJ75 | Putative ankyrin repeat domain-containing protein 20A4 | 6.10e-03 | NA | 2.84e-59 |
| 3. B | Q06527 | Ankyrin homolog | 2.43e-04 | NA | 7.74e-09 |
| 3. B | Q8N7Z5 | Ankyrin repeat domain-containing protein 31 | 3.07e-01 | NA | 1.92e-05 |
| 3. B | Q01317 | Ankyrin repeat protein nuc-2 | 1.32e-01 | NA | 8.58e-10 |
| 3. B | Q566C8 | Ankyrin repeat domain-containing protein 54 | 1.57e-01 | NA | 8.42e-06 |
| 3. B | Q641X1 | Ankyrin repeat domain-containing protein 61 | 1.43e-03 | NA | 5.96e-04 |
| 3. B | P14585 | Protein lin-12 | 4.60e-01 | NA | 0.001 |
| 3. B | Q96T49 | Protein phosphatase 1 regulatory inhibitor subunit 16B | 8.92e-03 | NA | 0.003 |
| 3. B | O14593 | DNA-binding protein RFXANK | 2.18e-03 | NA | 3.98e-06 |
| 3. B | Q99466 | Neurogenic locus notch homolog protein 4 | 9.87e-01 | NA | 0.003 |
| 3. B | Q9Y576 | Ankyrin repeat and SOCS box protein 1 | 4.37e-03 | NA | 0.005 |
| 3. B | Q07E41 | Cortactin-binding protein 2 | 2.51e-01 | NA | 9.27e-05 |
| 3. B | P62774 | Myotrophin | 3.67e-03 | NA | 2.79e-05 |
| 3. B | Q8K4M9 | Oxysterol-binding protein-related protein 1 | 2.47e-01 | NA | 0.045 |
| 3. B | Q9Z2X2 | 26S proteasome non-ATPase regulatory subunit 10 | 2.52e-06 | NA | 2.27e-11 |
| 3. B | Q95N27 | Protein phosphatase 1 regulatory inhibitor subunit 16B | 8.58e-03 | NA | 0.006 |
| 3. B | P97819 | 85/88 kDa calcium-independent phospholipase A2 | 1.34e-01 | NA | 9.78e-05 |
| 3. B | Q8N6S4 | Ankyrin repeat domain-containing protein 13C | 8.06e-01 | NA | 0.027 |
| 3. B | Q5UPB9 | Putative ankyrin repeat protein L42 | NA | NA | 5.87e-04 |
| 3. B | Q9WV06 | Ankyrin repeat domain-containing protein 2 | 4.94e-02 | NA | 3.63e-10 |
| 3. B | Q02357 | Ankyrin-1 | 1.46e-01 | NA | 2.61e-15 |
| 3. B | O44997 | Death-associated protein kinase dapk-1 | 1.06e-01 | NA | 4.27e-04 |
| 3. B | Q5FVC7 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 | 2.66e-01 | NA | 4.48e-05 |
| 3. B | P41412 | Cell division cycle-related protein res2/pct1 | 3.97e-01 | NA | 3.41e-04 |
| 3. B | Q4ULZ2 | Putative ankyrin repeat protein RF_0580 | 8.59e-06 | NA | 7.13e-09 |
| 3. B | Q8N8A2 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B | 4.28e-03 | NA | 2.63e-15 |
| 3. B | Q9D504 | Ankyrin repeat domain-containing protein 7 | 3.80e-08 | NA | 7.60e-50 |
| 3. B | Q9NU02 | Ankyrin repeat and EF-hand domain-containing protein 1 | 1.22e-01 | NA | 1.60e-05 |
| 3. B | Q29RM5 | Protein fem-1 homolog A | 3.81e-03 | NA | 0.024 |
| 3. B | Q5ZK62 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 | 1.84e-01 | NA | 1.14e-05 |
| 3. B | Q5TYM7 | CARD- and ANK-domain containing inflammasome adapter protein | 4.99e-03 | NA | 3.40e-13 |
| 3. B | Q5U312 | Ankycorbin | 1.27e-02 | NA | 7.38e-11 |
| 3. B | Q21920 | Ankyrin repeat and KH domain-containing protein mask-1 | 3.67e-01 | NA | 2.11e-07 |
| 3. B | Q65XV2 | E3 ubiquitin-protein ligase XB3 | 4.94e-02 | NA | 3.57e-04 |
| 3. B | Q5R6D7 | Ankyrin repeat and SOCS box protein 8 | 5.64e-03 | NA | 4.38e-12 |
| 3. B | S0DPL8 | Apicidin F cluster transcription factor apf2 | 3.41e-02 | NA | 2.16e-05 |
| 3. B | Q8IV38 | Ankyrin repeat and MYND domain-containing protein 2 | 4.52e-01 | NA | 0.005 |
| 3. B | A1ZBY1 | Protein fem-1 homolog B | 5.05e-02 | NA | 0.002 |
| 3. B | Q08353 | NF-kappa-B inhibitor alpha | 2.32e-02 | NA | 5.98e-06 |
| 3. B | Q554E7 | Putative ZDHHC-type palmitoyltransferase 5 | 2.12e-01 | NA | 7.95e-04 |
| 3. B | Q14DN9 | Ankyrin repeat and death domain-containing protein 1B | 2.51e-03 | NA | 5.09e-07 |
| 3. B | Q9VUX2 | E3 ubiquitin-protein ligase mind-bomb | 7.25e-02 | NA | 8.87e-08 |
| 3. B | Q9SQK3 | Ankyrin repeat domain-containing protein EMB506, chloroplastic | 2.42e-02 | NA | 7.64e-06 |
| 3. B | Q7T0Q1 | Myotrophin | 4.81e-03 | NA | 2.79e-05 |
| 3. B | Q6P6B7 | Ankyrin repeat domain-containing protein 16 | 1.11e-03 | NA | 2.10e-07 |
| 3. B | A2AQH4 | BCL-6 corepressor-like protein 1 | 3.30e-01 | NA | 3.48e-04 |
| 3. B | O70511 | Ankyrin-3 | 1.69e-01 | NA | 1.28e-13 |
| 3. B | Q90623 | Protein phosphatase 1 regulatory subunit 12A | 1.42e-02 | NA | 3.14e-05 |
| 3. B | Q3U0D9 | E3 ubiquitin-protein ligase HACE1 | 1.72e-01 | NA | 1.73e-07 |
| 3. B | Q5R8C8 | Ankyrin repeat domain-containing protein 46 | 8.61e-02 | NA | 1.71e-04 |
| 3. B | Q9Z2X3 | 26S proteasome non-ATPase regulatory subunit 10 | 2.14e-06 | NA | 2.59e-09 |
| 3. B | Q9TXQ1 | Poly [ADP-ribose] polymerase tankyrase | 5.00e-01 | NA | 6.90e-09 |
| 3. B | Q7Z8U2 | Palmitoyltransferase akr1 | 6.90e-03 | NA | 6.52e-09 |
| 3. B | Q7T163 | Kinase D-interacting substrate of 220 kDa B | 5.52e-01 | NA | 3.61e-11 |
| 3. B | Q9J505 | Putative ankyrin repeat protein FPV230 | NA | NA | 3.13e-06 |
| 3. B | Q68DC2 | Ankyrin repeat and SAM domain-containing protein 6 | 2.93e-02 | NA | 1.02e-04 |
| 3. B | A1X154 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 5.64e-02 | NA | 0.001 |
| 3. B | Q7XUW4 | Potassium channel KOR2 | 3.94e-01 | NA | 3.30e-07 |
| 3. B | Q6RI86 | Transient receptor potential cation channel subfamily A member 1 | 3.00e-01 | NA | 0.011 |
| 3. B | Q15057 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 | 1.69e-01 | NA | 1.46e-04 |
| 3. B | Q1RMI3 | GA-binding protein subunit beta-1 | 3.28e-02 | NA | 3.37e-12 |
| 3. B | Q9WV48 | SH3 and multiple ankyrin repeat domains protein 1 | 2.44e-03 | NA | 0.002 |
| 3. B | Q4UJY2 | Putative ankyrin repeat protein RF_1306 | 3.95e-02 | NA | 0.026 |
| 3. B | D3J163 | Protein VAPYRIN-LIKE | 2.31e-03 | NA | 3.92e-06 |
| 3. B | Q10311 | Ankyrin repeat-containing protein C6C3.08 | 9.72e-05 | NA | 5.11e-08 |
| 3. B | A2A690 | Protein TANC2 | 1.12e-01 | NA | 6.78e-11 |
| 3. B | A5A3E0 | POTE ankyrin domain family member F | 8.31e-02 | NA | 2.44e-55 |
| 3. B | Q07DW4 | Cortactin-binding protein 2 | 4.02e-01 | NA | 1.14e-05 |
| 3. B | Q6KAE5 | Probable E3 ubiquitin-protein ligase XBOS32 | 6.00e-02 | NA | 0.006 |
| 3. B | Q4R3S3 | Ankyrin repeat domain-containing protein 7 | 2.84e-06 | NA | 1.51e-47 |
| 3. B | Q38898 | Potassium channel AKT2/3 | 5.13e-01 | NA | 0.018 |
| 3. B | Q8CGN4 | BCL-6 corepressor | 3.08e-01 | NA | 2.44e-04 |
| 3. B | Q7T3P8 | Protein fem-1 homolog C | 5.78e-03 | NA | 0.001 |
| 3. B | Q9Z2F6 | B-cell lymphoma 3 protein homolog | 6.03e-03 | NA | 8.70e-12 |
| 3. B | Q8BXP5 | Photoreceptor ankyrin repeat protein | 1.16e-01 | NA | 0.003 |
| 3. B | O83515 | Putative ankyrin repeat-containing protein TP_0502 | 7.58e-02 | NA | 2.22e-09 |
| 3. B | A7MB89 | Protein fem-1 homolog C | 2.38e-02 | NA | 0.004 |
| 3. B | Q9WTT2 | Caseinolytic peptidase B protein homolog | 7.54e-01 | NA | 0.012 |
| 3. B | Q80T11 | Usher syndrome type-1G protein homolog | 8.50e-01 | NA | 0.002 |
| 3. B | Q9D2J7 | Ankyrin repeat and EF-hand domain-containing protein 1 | 6.61e-03 | NA | 4.53e-05 |
| 3. B | Q9D119 | Protein phosphatase 1 regulatory subunit 27 | 1.03e-01 | NA | 2.90e-05 |
| 3. B | Q9H2K2 | Poly [ADP-ribose] polymerase tankyrase-2 | 1.09e-01 | NA | 1.11e-09 |
| 3. B | Q9D061 | Acyl-CoA-binding domain-containing protein 6 | 1.56e-01 | NA | 4.82e-04 |
| 3. B | Q8VHA6 | Ankyrin repeat and SOCS box protein 18 | 1.44e-03 | NA | 0.005 |
| 3. B | Q06547 | GA-binding protein subunit beta-1 | 2.43e-02 | NA | 2.41e-12 |
| 3. B | Q91ZT7 | Ankyrin repeat and SOCS box protein 10 | 2.01e-03 | NA | 2.59e-08 |
| 3. B | A6NHY2 | Ankyrin repeat and death domain-containing protein 1B | 2.81e-03 | NA | 0.002 |
| 3. B | P55273 | Cyclin-dependent kinase 4 inhibitor D | 8.71e-04 | NA | 0.013 |
| 3. B | Q5RCK5 | Ankyrin repeat and SOCS box protein 7 | 1.98e-04 | NA | 6.23e-06 |
| 3. B | Q8UVC1 | Inversin | 1.04e-02 | NA | 1.56e-10 |
| 3. B | Q5SQ80 | Putative ankyrin repeat domain-containing protein 20A2 | 6.28e-01 | NA | 1.22e-59 |
| 3. B | Q2IBD4 | Cortactin-binding protein 2 | 3.04e-01 | NA | 0.002 |
| 3. B | P0CG39 | POTE ankyrin domain family member J | 1.98e-02 | NA | 7.52e-54 |
| 3. B | P46530 | Neurogenic locus notch homolog protein 1 | 2.05e-01 | NA | 2.32e-06 |
| 3. B | Q6TGW5 | Osteoclast-stimulating factor 1 | 1.84e-02 | NA | 0.002 |
| 3. B | Q63618 | Espin | 3.93e-02 | NA | 5.90e-05 |
| 3. B | Q1RIZ4 | Putative ankyrin repeat protein RBE_0589 | 6.33e-02 | NA | 1.10e-06 |
| 3. B | B9EJA2 | Cortactin-binding protein 2 | 4.20e-01 | NA | 3.78e-04 |
| 3. B | Q8CGB3 | Uveal autoantigen with coiled-coil domains and ankyrin repeats | 2.93e-02 | NA | 9.19e-12 |
| 3. B | Q3UES3 | Poly [ADP-ribose] polymerase tankyrase-2 | 8.81e-02 | NA | 1.67e-09 |
| 3. B | A5WVX9 | Palmitoyltransferase ZDHHC17 | 1.07e-03 | NA | 3.74e-10 |
| 3. B | Q9J504 | Putative ankyrin repeat protein FPV231 | NA | NA | 1.96e-11 |
| 3. B | Q91ZT9 | Ankyrin repeat and SOCS box protein 8 | 5.36e-03 | NA | 7.98e-12 |
| 3. B | Q6W2J9 | BCL-6 corepressor | 1.02e-01 | NA | 2.44e-04 |
| 3. B | Q9Y2G4 | Ankyrin repeat domain-containing protein 6 | 1.18e-02 | NA | 3.01e-09 |
| 3. B | F1LTE0 | Protein TANC2 | 9.91e-02 | NA | 7.19e-11 |
| 3. B | B1AK53 | Espin | 8.07e-02 | NA | 0.011 |
| 3. B | Q495M9 | Usher syndrome type-1G protein | 5.90e-01 | NA | 0.002 |
| 3. B | Q9ERC1 | Unconventional myosin-XVI | 8.18e-01 | NA | 1.31e-04 |
| 3. B | Q9P2R3 | Rabankyrin-5 | 7.40e-03 | NA | 0.006 |
| 3. B | Q8BZ25 | Ankyrin repeat and protein kinase domain-containing protein 1 | 3.11e-04 | NA | 4.34e-11 |
| 3. B | Q8UVC3 | Inversin | 1.02e-01 | NA | 1.53e-11 |
| 3. B | P13508 | Protein glp-1 | 4.69e-02 | NA | 1.09e-05 |
| 3. B | Q9SCX5 | Probable potassium channel AKT5 | 2.49e-01 | NA | 2.01e-06 |
| 3. B | Q05823 | 2-5A-dependent ribonuclease | 5.76e-02 | NA | 1.63e-07 |
| 3. B | P57044 | Integrin-linked protein kinase | 5.74e-02 | NA | 2.44e-07 |
| 3. B | Q8ZWC4 | Putative ankyrin repeat protein PAE1861 | 1.56e-04 | NA | 2.59e-06 |
| 3. B | O54910 | NF-kappa-B inhibitor epsilon | 2.60e-05 | NA | 9.22e-06 |
| 3. B | Q4X251 | Palmitoyltransferase akr1 | 2.30e-03 | NA | 2.08e-08 |
| 3. B | Q08E43 | Ankyrin repeat and SOCS box protein 8 | 1.32e-02 | NA | 2.35e-11 |
| 3. B | Q5UPG6 | Putative ankyrin repeat protein L92 | NA | NA | 0.005 |
| 3. B | Q8VBX0 | Ankyrin repeat and SOCS box protein 13 | 2.26e-05 | NA | 2.37e-11 |
| 3. B | B7WN72 | Protein shank | 7.03e-02 | NA | 0.013 |
| 3. B | Q14678 | KN motif and ankyrin repeat domain-containing protein 1 | 6.75e-01 | NA | 0.002 |
| 3. B | Q9BXW6 | Oxysterol-binding protein-related protein 1 | 1.13e-01 | NA | 0.002 |
| 3. B | Q9Z205 | DNA-binding protein RFXANK | 2.30e-03 | NA | 0.006 |
| 3. B | Q00653 | Nuclear factor NF-kappa-B p100 subunit | 2.22e-02 | NA | 1.57e-08 |
| 3. B | Q5ZLC8 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 3.92e-03 | NA | 6.85e-14 |
| 3. B | Q68LP1 | E3 ubiquitin-protein ligase MIB2 | 5.02e-02 | NA | 8.99e-04 |
| 3. B | Q01484 | Ankyrin-2 | NA | NA | 1.03e-17 |
| 3. B | Q9UK73 | Protein fem-1 homolog B | 2.70e-02 | NA | 4.30e-06 |
| 3. B | F8W2M1 | E3 ubiquitin-protein ligase HACE1 | 2.79e-02 | NA | 4.06e-08 |
| 3. B | Q9WV71 | Ankyrin repeat and SOCS box protein 4 | 1.11e-03 | NA | 7.01e-04 |
| 3. B | Q9J513 | Putative ankyrin repeat protein FPV222 | NA | NA | 1.54e-07 |
| 3. B | Q9DBR7 | Protein phosphatase 1 regulatory subunit 12A | 2.49e-03 | NA | 1.92e-05 |
| 3. B | Q9U518 | L-asparaginase | 3.89e-02 | NA | 1.93e-07 |
| 3. B | Q9Y283 | Inversin | 7.32e-03 | NA | 7.16e-12 |
| 3. B | Q9J512 | Putative ankyrin repeat protein FPV223 | NA | NA | 0.001 |
| 3. B | Q495B1 | Ankyrin repeat and death domain-containing protein 1A | 5.64e-04 | NA | 4.16e-13 |
| 3. B | Q9M8S6 | Potassium channel SKOR | 6.67e-01 | NA | 1.04e-09 |
| 3. B | Q9ULH0 | Kinase D-interacting substrate of 220 kDa | 5.76e-01 | NA | 3.11e-14 |
| 3. B | G3I6Z6 | Neurogenic locus notch homolog protein 1 | NA | NA | 6.54e-05 |
| 3. B | Q9BGT9 | Ankyrin repeat and SOCS box protein 7 | 1.63e-04 | NA | 2.40e-06 |
| 3. B | Q5XJ13 | Ankyrin repeat and SAM domain-containing protein 6 | 4.67e-02 | NA | 0.005 |
| 3. B | P14360 | Putative ankyrin repeat protein FPV240 | NA | NA | 1.43e-08 |
| 3. B | O70445 | BRCA1-associated RING domain protein 1 | 1.22e-01 | NA | 7.10e-06 |
| 3. B | Q4UKJ3 | Putative ankyrin repeat protein RF_1087 | 4.38e-02 | NA | 6.54e-05 |
| 3. B | Q5UPG5 | Putative ankyrin repeat protein L93 | NA | NA | 1.68e-09 |
| 3. B | Q9WV72 | Ankyrin repeat and SOCS box protein 3 | 2.33e-03 | NA | 3.19e-09 |
| 3. B | Q9J502 | Putative ankyrin repeat protein FPV233 | NA | NA | 3.24e-09 |
| 3. B | Q86SG2 | Ankyrin repeat domain-containing protein 23 | 1.05e-02 | NA | 7.27e-07 |
| 3. B | Q91WK7 | Ankyrin repeat domain-containing protein 54 | 1.81e-01 | NA | 9.54e-06 |
| 3. B | Q876L4 | Probable palmitoyltransferase AKR2 | 1.26e-02 | NA | 1.76e-05 |
| 3. B | Q5U2S6 | Ankyrin repeat and SOCS box protein 2 | 1.31e-03 | NA | 2.42e-08 |
| 3. B | Q80SY4 | E3 ubiquitin-protein ligase MIB1 | 6.75e-02 | NA | 5.03e-07 |
| 3. B | Q876L5 | Palmitoyltransferase AKR1 | 1.39e-02 | NA | 0.011 |
| 3. B | Q4I8B6 | Palmitoyltransferase AKR1 | 1.01e-04 | NA | 2.06e-10 |
| 3. B | P16157 | Ankyrin-1 | 3.25e-01 | NA | 1.73e-15 |
| 3. B | Q5VUR7 | Putative ankyrin repeat domain-containing protein 20A3 | 5.06e-04 | NA | 1.61e-59 |
| 3. B | O88202 | 60 kDa lysophospholipase | 8.07e-02 | NA | 0.045 |
| 3. B | Q502M6 | Ankyrin repeat domain-containing protein 29 | 8.14e-04 | NA | 6.00e-06 |
| 3. B | Q337A0 | Probable E3 ubiquitin-protein ligase XBOS33 | 3.21e-02 | NA | 0.011 |
| 3. B | Q6S8J3 | POTE ankyrin domain family member E | 4.93e-03 | NA | 2.16e-55 |
| 3. B | Q96I34 | Protein phosphatase 1 regulatory subunit 16A | 1.76e-01 | NA | 0.034 |
| 3. B | Q0VGY8 | Protein TANC1 | 2.46e-01 | NA | 6.07e-10 |
| 3. B | P0C0T2 | Ankyrin repeat and SAM domain-containing protein 6 | 1.08e-01 | NA | 9.09e-05 |
| 3. B | O95271 | Poly [ADP-ribose] polymerase tankyrase-1 | 1.81e-01 | NA | 2.21e-10 |
| 3. B | G0LXV8 | Alpha-latrotoxin-Lh1a (Fragment) | 1.10e-02 | NA | 1.75e-05 |
| 3. B | Q8WWX0 | Ankyrin repeat and SOCS box protein 5 | 7.85e-04 | NA | 7.44e-04 |
| 3. B | Q15027 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 | 1.77e-01 | NA | 7.87e-05 |
| 3. B | Q9Y566 | SH3 and multiple ankyrin repeat domains protein 1 | 6.77e-03 | NA | 0.007 |
| 3. B | Q653P0 | Potassium channel KOR1 | 5.00e-01 | NA | 4.27e-09 |
| 3. B | Q6PFX9 | Poly [ADP-ribose] polymerase tankyrase-1 | 5.32e-02 | NA | 2.61e-10 |
| 3. B | Q9J5I3 | Putative ankyrin repeat protein FPV018 | NA | NA | 6.04e-08 |
| 3. B | Q2IBG0 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 4.72e-02 | NA | 0.028 |
| 3. B | Q94B55 | Putative E3 ubiquitin-protein ligase XBAT31 | 9.86e-03 | NA | 1.70e-07 |
| 3. B | Q6P1S6 | Myotrophin | 5.33e-03 | NA | 6.27e-06 |
| 3. B | C7B178 | Protein VAPYRIN | 1.09e-02 | NA | 2.54e-06 |
| 3. B | Q9D1A4 | Ankyrin repeat and SOCS box protein 5 | 8.30e-04 | NA | 0.001 |
| 3. B | Q5R4M7 | Ankyrin repeat and SOCS box protein 6 | 1.85e-02 | NA | 8.68e-06 |
| 3. B | Q875M2 | Palmitoyltransferase AKR1 | 9.11e-03 | NA | 2.96e-05 |
| 3. B | Q71S21 | Inversin-B | 3.54e-02 | NA | 1.06e-12 |
| 3. B | Q8VHK2 | Caskin-1 | 2.08e-02 | NA | 3.41e-10 |
| 3. B | Q29Q26 | Ankyrin repeat domain-containing protein 2B | 3.27e-01 | NA | 1.25e-07 |
| 3. B | Q7Z020 | Transient receptor potential cation channel subfamily A member 1 | 4.03e-01 | NA | 0.002 |
| 3. B | Q6DGX3 | Ankyrin repeat domain-containing protein 54 | 1.38e-01 | NA | 7.58e-06 |
| 3. B | Q9P0K7 | Ankycorbin | 3.24e-01 | NA | 1.10e-09 |
| 3. B | Q3V096 | Ankyrin repeat domain-containing protein 42 | 9.68e-03 | NA | 2.16e-08 |
| 3. B | Q4P6L3 | Palmitoyltransferase AKR1 | 5.10e-03 | NA | 0.001 |
| 3. B | Q96AX9 | E3 ubiquitin-protein ligase MIB2 | 4.08e-02 | NA | 0.005 |
| 3. B | A0A3L7I2I8 | 85/88 kDa calcium-independent phospholipase A2 | 5.23e-02 | NA | 1.58e-04 |
| 3. B | Q5RFS1 | Ankyrin repeat and SOCS box protein 11 | 1.05e-03 | NA | 0.005 |
| 3. B | Q5DU14 | Unconventional myosin-XVI | 5.03e-01 | NA | 1.06e-04 |
| 3. B | Q5UPH0 | Putative ankyrin repeat protein L100 | NA | NA | 6.77e-06 |
| 3. B | Q86YR6 | POTE ankyrin domain family member D | 2.70e-03 | NA | 9.22e-60 |
| 3. B | Q923M0 | Protein phosphatase 1 regulatory subunit 16A | 2.56e-02 | NA | 2.13e-04 |
| 3. B | Q8N9B4 | Ankyrin repeat domain-containing protein 42 | 1.90e-03 | NA | 2.83e-04 |
| 3. B | Q15653 | NF-kappa-B inhibitor beta | 3.95e-02 | NA | 1.62e-04 |
| 3. B | Q07E28 | Cortactin-binding protein 2 | 8.72e-02 | NA | 3.77e-05 |
| 3. B | Q5H9F3 | BCL-6 corepressor-like protein 1 | 1.91e-01 | NA | 7.44e-04 |
| 3. B | Q8WXK3 | Ankyrin repeat and SOCS box protein 13 | 2.77e-05 | NA | 3.46e-11 |
| 3. B | Q5TYW2 | Ankyrin repeat domain-containing protein 20A1 | 2.76e-02 | NA | 2.64e-59 |
| 3. B | Q5GIG6 | Serine/threonine-protein kinase TNNI3K | 1.15e-03 | NA | 1.23e-06 |
| 3. B | Q92625 | Ankyrin repeat and SAM domain-containing protein 1A | 4.10e-02 | NA | 3.68e-07 |
| 3. B | Q3UUF8 | Ankyrin repeat domain-containing protein 34B | 1.53e-01 | NA | 0.007 |
| 3. B | Q09YI3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 3.54e-02 | NA | 0.028 |
| 3. B | Q9J5I9 | Putative ankyrin repeat protein FPV012 | NA | NA | 5.61e-05 |
| 3. B | A0M8T5 | Cortactin-binding protein 2 | 6.36e-01 | NA | 6.96e-05 |
| 3. B | Q2KI79 | Ankyrin repeat family A protein 2 | 2.70e-02 | NA | 1.47e-07 |
| 3. B | Q5ZM55 | Protein fem-1 homolog B | 2.56e-02 | NA | 3.18e-05 |
| 3. B | Q07E15 | Cortactin-binding protein 2 | 9.31e-01 | NA | 9.53e-06 |
| 3. B | Q6UB98 | Ankyrin repeat domain-containing protein 12 | 8.01e-02 | NA | 2.57e-04 |
| 3. B | Q9XZC0 | Alpha-latrocrustotoxin-Lt1a (Fragment) | 2.56e-02 | NA | 2.21e-08 |
| 3. B | A6QPE7 | Ankyrin repeat domain-containing protein 65 | 1.65e-04 | NA | 3.66e-08 |
| 3. B | Q94A76 | Potassium channel GORK | 6.83e-01 | NA | 6.15e-11 |
| 3. B | Q8Q0U0 | Putative ankyrin repeat protein MM_0045 | 4.93e-05 | NA | 1.31e-13 |
| 3. B | Q93650 | Putative glutaminase 3 | 7.86e-01 | NA | 1.89e-04 |
| 3. B | Q54KH3 | Ankyrin repeat domain-containing protein 39 homolog | 6.31e-02 | NA | 0.004 |
| 3. B | O35516 | Neurogenic locus notch homolog protein 2 | 5.25e-01 | NA | 1.28e-05 |
| 3. B | Q5VYY1 | Ankyrin repeat domain-containing protein 22 | 2.92e-04 | NA | 7.28e-04 |
| 3. B | Q755Y0 | Palmitoyltransferase AKR1 | 1.05e-02 | NA | 7.85e-04 |
| 3. B | Q03017 | NF-kappa-B inhibitor cactus | 2.35e-04 | NA | 6.50e-05 |
| 3. B | B8N0E6 | Ankyrin-repeat domain containing transcription coregulator asaA | 8.62e-01 | NA | 0.048 |
| 3. B | O75762 | Transient receptor potential cation channel subfamily A member 1 | 2.34e-01 | NA | 1.63e-04 |
| 3. B | Q5M9H0 | Ankyrin repeat and SAM domain-containing protein 3 | 1.44e-01 | NA | 1.92e-11 |
| 3. B | Q9CQM6 | Ankyrin repeat domain-containing protein 61 | 1.43e-03 | NA | 3.51e-04 |
| 3. B | Q6NY19 | KN motif and ankyrin repeat domain-containing protein 3 | 5.98e-02 | NA | 2.06e-06 |
| 3. B | A0M8S4 | Cortactin-binding protein 2 | 5.01e-01 | NA | 1.28e-06 |
| 3. B | Q9Z1E3 | NF-kappa-B inhibitor alpha | 1.07e-02 | NA | 1.31e-05 |
| 3. B | Q9TU71 | Ankyrin repeat domain-containing protein 1 | 2.49e-02 | NA | 3.08e-08 |
| 3. B | E9Q4F7 | Ankyrin repeat domain-containing protein 11 | 1.60e-01 | NA | 1.02e-08 |
| 3. B | Q18297 | Transient receptor potential cation channel subfamily A member 1 homolog | 5.54e-01 | NA | 0.034 |
| 3. B | Q1RJN6 | Putative ankyrin repeat protein RBE_0347 | 8.58e-02 | NA | 2.75e-06 |
| 3. B | A6QR20 | SMC5-SMC6 complex localization factor protein 1 | 7.85e-01 | NA | 0.046 |
| 3. B | P98150 | Nuclear factor NF-kappa-B p100 subunit | 1.31e-01 | NA | 1.59e-08 |
| 3. B | Q5RF15 | Serine/threonine-protein kinase TNNI3K | 1.08e-01 | NA | 1.79e-08 |
| 3. B | Q9VFD5 | Protein fem-1 homolog CG6966 | 8.71e-02 | NA | 9.97e-05 |
| 3. B | Q6P9K8 | Caskin-1 | 1.64e-02 | NA | 8.40e-10 |
| 3. B | Q2T9W8 | Ankyrin repeat domain-containing protein 61 | 2.52e-03 | NA | 0.017 |
| 3. B | Q2IBA2 | Cortactin-binding protein 2 | 6.22e-01 | NA | 1.29e-06 |
| 3. B | Q812A3 | Ankyrin repeat domain-containing protein 23 | 1.90e-02 | NA | 2.96e-07 |
| 3. B | Q3SWY2 | Integrin-linked protein kinase | 5.99e-02 | NA | 6.12e-07 |
| 3. B | A5PMU4 | Ankyrin repeat and sterile alpha motif domain-containing protein 1B | 3.64e-02 | NA | 1.25e-10 |
| 3. B | Q876A6 | Palmitoyltransferase AKR1 | 1.44e-02 | NA | 5.58e-04 |
| 3. B | Q96KQ7 | Histone-lysine N-methyltransferase EHMT2 | 9.44e-02 | NA | 1.74e-12 |
| 3. B | Q6GNY1 | E3 ubiquitin-protein ligase mib1 | 9.16e-03 | NA | 1.62e-06 |
| 3. B | Q91ZU0 | Ankyrin repeat and SOCS box protein 7 | 8.21e-06 | NA | 3.99e-06 |
| 3. B | Q91ZT8 | Ankyrin repeat and SOCS box protein 9 | 5.79e-04 | NA | 8.63e-09 |
| 3. B | Q5UPV1 | Putative ankyrin repeat protein L271 | NA | NA | 0.002 |
| 3. B | A2A2Z9 | Ankyrin repeat domain-containing protein 18B | 1.39e-04 | NA | 1.40e-63 |
| 3. B | Q9J5H7 | Putative ankyrin repeat protein FPV024 | NA | NA | 8.37e-09 |
| 3. B | Q09701 | Palmitoyltransferase akr1 | 1.56e-02 | NA | 0.037 |
| 3. B | Q8WXI3 | Ankyrin repeat and SOCS box protein 10 | 1.76e-03 | NA | 0.028 |
| 3. B | Q01705 | Neurogenic locus notch homolog protein 1 | 1.51e-01 | NA | 7.42e-05 |
| 3. B | P0C550 | Potassium channel AKT1 | 1.57e-01 | NA | 3.38e-06 |
| 3. B | X1WE18 | KN motif and ankyrin repeat domain-containing protein 2 | 7.65e-01 | NA | 0.008 |
| 3. B | Q8WXK1 | Ankyrin repeat and SOCS box protein 15 | 7.64e-03 | NA | 9.64e-06 |
| 3. B | Q2IBF8 | Cortactin-binding protein 2 | 7.71e-01 | NA | 1.04e-04 |
| 3. B | Q2T9K6 | Protein fem-1 homolog C | 2.69e-02 | NA | 1.06e-05 |
| 3. B | Q9ULJ7 | Ankyrin repeat domain-containing protein 50 | 1.03e-01 | NA | 5.07e-14 |
| 3. B | P0C927 | Ankyrin repeat and SOCS box protein 14 | 2.96e-03 | NA | 1.35e-09 |
| 3. B | Q8VHK1 | Caskin-2 | 3.36e-02 | NA | 8.70e-06 |
| 3. B | Q9Y6X6 | Unconventional myosin-XVI | 6.86e-01 | NA | 2.71e-05 |
| 3. B | Q8K2H4 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 | 2.30e-01 | NA | 1.25e-04 |
| 3. B | A5PK26 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 | 2.17e-01 | NA | 0.001 |
| 3. B | Q9ZCL3 | Putative ankyrin repeat protein RP714 | 9.22e-03 | NA | 0.003 |
| 3. B | P46531 | Neurogenic locus notch homolog protein 1 | 3.69e-01 | NA | 7.31e-05 |
| 3. B | Q2IBE6 | Cortactin-binding protein 2 | 1.16e-01 | NA | 1.56e-05 |
| 3. B | Q3ZBX7 | Ankyrin repeat domain-containing protein 1 | 1.40e-02 | NA | 5.26e-07 |
| 3. B | Q4V869 | Acyl-CoA-binding domain-containing protein 6 | 2.63e-01 | NA | 9.98e-05 |
| 3. B | Q09YG9 | Cortactin-binding protein 2 | 7.38e-01 | NA | 6.45e-05 |
| 3. B | Q8HXA6 | Ankyrin repeat and SOCS box protein 15 | 8.34e-03 | NA | 0.001 |
| 3. B | Q91ZU1 | Ankyrin repeat and SOCS box protein 6 | 1.05e-02 | NA | 2.15e-06 |
| 3. B | Q96NS5 | Ankyrin repeat and SOCS box protein 16 | 2.60e-03 | NA | 0.034 |
| 3. B | Q52T38 | Protein S-acyltransferase 24 | 2.94e-02 | NA | 0.049 |
| 3. B | P0C6S7 | Ankyrin repeat and sterile alpha motif domain-containing protein 1B | 4.73e-02 | NA | 1.42e-07 |
| 3. B | P0C6C1 | Ankyrin repeat domain-containing protein 34C | 2.92e-01 | NA | 8.06e-06 |
| 3. B | Q9C6C3 | ADP-ribosylation factor GTPase-activating protein AGD2 | 1.85e-02 | NA | 5.11e-05 |
| 3. B | Q96JP0 | Protein fem-1 homolog C | 2.31e-02 | NA | 0.004 |
| 3. B | F1N6G5 | E3 ubiquitin-protein ligase HACE1 | 4.70e-02 | NA | 9.25e-07 |
| 3. B | Q8NFD2 | Ankyrin repeat and protein kinase domain-containing protein 1 | 2.12e-04 | NA | 3.74e-12 |
| 3. B | Q865U8 | Ankyrin repeat domain-containing protein 1 | 1.26e-02 | NA | 4.82e-08 |
| 3. B | Q9DF58 | Integrin-linked protein kinase | 9.58e-02 | NA | 1.28e-05 |
| 3. B | Q3SZE4 | Ankyrin repeat and SOCS box protein 11 | 1.69e-03 | NA | 5.35e-04 |
| 3. B | O60237 | Protein phosphatase 1 regulatory subunit 12B | 3.23e-02 | NA | 3.57e-05 |
| 3. B | Q9SMX5 | ADP-ribosylation factor GTPase-activating protein AGD4 | 1.83e-01 | NA | 0.003 |
| 3. B | Q1LZH7 | KN motif and ankyrin repeat domain-containing protein 2 | 8.00e-01 | NA | 4.77e-05 |
| 3. B | Q8WVL7 | Ankyrin repeat domain-containing protein 49 | 8.02e-02 | NA | 0.001 |
| 3. B | Q3UX43 | Ankyrin repeat domain-containing protein 13C | 7.93e-01 | NA | 0.037 |
| 3. B | Q8NF67 | Putative ankyrin repeat domain-containing protein 20A12 pseudogene | 4.92e-04 | NA | 2.24e-15 |
| 3. B | A2VDR2 | Acyl-CoA-binding domain-containing protein 6 | 1.68e-01 | NA | 3.43e-06 |
| 3. B | Q00PJ1 | Cortactin-binding protein 2 | 4.08e-01 | NA | 3.65e-06 |
| 3. B | Q54BA2 | Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 | 1.95e-01 | NA | 2.80e-06 |
| 3. B | Q9VCA8 | Ankyrin repeat and KH domain-containing protein mask | NA | NA | 1.06e-11 |
| 3. B | Q04861 | Nuclear factor NF-kappa-B p105 subunit | 5.14e-02 | NA | 0.001 |
| 3. B | Q25338 | Delta-latroinsectotoxin-Lt1a | 2.38e-02 | NA | 4.17e-09 |
| 3. B | Q15327 | Ankyrin repeat domain-containing protein 1 | 1.09e-02 | NA | 1.47e-08 |
| 3. B | Q5EA33 | Ankyrin repeat domain-containing protein 49 | 2.56e-02 | NA | 0.010 |
| 3. B | Q86YT6 | E3 ubiquitin-protein ligase MIB1 | 1.64e-02 | NA | 5.85e-07 |
| 3. B | Q94CT7 | Probable E3 ubiquitin-protein ligase XBOS31 | 1.52e-02 | NA | 8.16e-08 |
| 3. B | Q9TZC4 | Integrin-linked protein kinase homolog pat-4 | 1.68e-01 | NA | 5.39e-04 |
| 3. B | O89019 | Inversin | 1.37e-01 | NA | 1.73e-10 |
| 3. B | Q66JD7 | Acyl-CoA-binding domain-containing protein 6 | 2.44e-01 | NA | 7.98e-05 |
| 3. B | Q53RE8 | Ankyrin repeat domain-containing protein 39 | 4.98e-04 | NA | 2.78e-05 |
| 3. B | Q54HW1 | 26S proteasome non-ATPase regulatory subunit 10 | 7.96e-06 | NA | 4.83e-16 |
| 3. B | Q9J4Z8 | Putative ankyrin repeat protein FPV242 | NA | NA | 0.001 |
| 3. B | Q69ZU8 | Ankyrin repeat domain-containing protein 6 | 3.33e-02 | NA | 8.72e-10 |
| 3. B | Q8WMX8 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.54e-02 | NA | 0.035 |
| 3. B | Q0JKV1 | Potassium channel AKT1 | 5.45e-01 | NA | 3.47e-06 |
| 3. B | Q2IBB2 | Cortactin-binding protein 2 | 2.45e-01 | NA | 4.22e-04 |
| 3. B | Q9EQG6 | Kinase D-interacting substrate of 220 kDa | 8.54e-01 | NA | 2.67e-14 |
| 3. B | Q5ZLC6 | Ankyrin repeat domain-containing protein 10 | 8.68e-02 | NA | 0.030 |
| 3. B | Q4KL97 | Ankyrin repeat domain-containing protein 1 | 9.48e-03 | NA | 5.55e-06 |
| 3. B | Q91955 | Myotrophin | 4.00e-03 | NA | 1.25e-05 |
| 3. B | P14368 | Putative ankyrin repeat protein FPV234 | NA | NA | 5.77e-04 |
| 3. B | P58546 | Myotrophin | 3.65e-03 | NA | 8.02e-05 |
| 3. B | Q2QLG9 | Cortactin-binding protein 2 | 7.60e-01 | NA | 1.44e-05 |
| 3. B | Q4R544 | Ankyrin repeat and SOCS box protein 8 | 2.21e-02 | NA | 6.83e-12 |
| 3. B | Q9J5A7 | Putative ankyrin repeat protein FPV115 | NA | NA | 1.06e-06 |
| 3. B | Q9J4Z6 | Putative ankyrin repeat protein FPV244 | NA | NA | 2.91e-07 |
| 3. B | B2RU33 | POTE ankyrin domain family member C | 2.49e-03 | NA | 1.60e-59 |
| 3. B | Q6NSI1 | Putative ankyrin repeat domain-containing protein 26-like protein | 2.27e-02 | NA | 8.00e-47 |
| 3. B | P0CG38 | POTE ankyrin domain family member I | 3.70e-02 | NA | 7.52e-54 |
| 3. B | A0JP26 | POTE ankyrin domain family member B3 | 1.83e-03 | NA | 9.42e-61 |
| 3. B | O74205 | Transcription factor TOXE | 4.69e-02 | NA | 0.003 |
| 3. B | Q09YJ5 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 5.19e-02 | NA | 0.028 |
| 3. B | Q6S5H5 | POTE ankyrin domain family member G | 4.47e-03 | NA | 6.99e-60 |
| 3. B | P77736 | Putative ankyrin repeat protein YahD | 6.49e-06 | NA | 3.24e-05 |
| 3. B | Q5F478 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B | 4.16e-03 | NA | 2.27e-15 |
| 3. B | Q8K3X6 | Ankyrin repeat and SAM domain-containing protein 4B | 3.10e-01 | NA | 1.57e-04 |
| 3. B | Q9J507 | Putative ankyrin repeat protein FPV228 | NA | NA | 6.81e-08 |
| 3. B | Q7TQP6 | Serine/threonine-protein kinase TNNI3K | 1.60e-03 | NA | 3.83e-08 |
| 3. B | P0CS67 | Palmitoyltransferase AKR1 | 3.43e-03 | NA | 3.94e-04 |
| 3. B | Q9Z2G0 | Protein fem-1 homolog B | 2.93e-02 | NA | 6.87e-06 |
| 3. B | G5E8K5 | Ankyrin-3 | 1.50e-01 | NA | 1.58e-13 |
| 3. B | Q8K0L0 | Ankyrin repeat and SOCS box protein 2 | 1.46e-03 | NA | 1.23e-07 |
| 3. B | A0PJZ0 | Putative ankyrin repeat domain-containing protein 20A5 | 1.52e-02 | NA | 5.81e-38 |
| 3. B | Q6DD51 | Caskin-2 | 5.03e-02 | NA | 6.38e-10 |
| 3. B | P21783 | Neurogenic locus notch homolog protein 1 | 6.20e-01 | NA | 0.001 |
| 3. B | Q8TF21 | Ankyrin repeat domain-containing protein 24 | 2.47e-01 | NA | 2.00e-08 |
| 3. B | A0A0A6YYL3 | POTE ankyrin domain family member B | 3.75e-04 | NA | 3.06e-61 |
| 3. B | A0A0R4IQZ2 | Putative palmitoyltransferase ZDHHC13 | 1.68e-03 | NA | 6.05e-07 |
| 3. B | Q5CZ79 | Ankyrin repeat domain-containing protein 20B | 3.63e-03 | NA | 7.71e-62 |
| 3. B | Q9H765 | Ankyrin repeat and SOCS box protein 8 | 5.47e-03 | NA | 4.34e-12 |
| 3. B | Q3KP44 | Ankyrin repeat domain-containing protein 55 | 3.14e-02 | NA | 4.83e-09 |
| 3. B | Q1RJR6 | Putative ankyrin repeat protein RBE_0317 | 1.72e-02 | NA | 1.42e-04 |
| 3. B | Q63746 | NF-kappa-B inhibitor alpha | 9.29e-03 | NA | 1.98e-05 |
| 3. B | Q10728 | Protein phosphatase 1 regulatory subunit 12A | 4.38e-02 | NA | 1.82e-05 |
| 3. B | P07207 | Neurogenic locus Notch protein | NA | NA | 1.51e-05 |
| 3. B | Q07DV1 | Cortactin-binding protein 2 | 3.49e-01 | NA | 4.20e-05 |
| 3. B | Q9CWU2 | Palmitoyltransferase ZDHHC13 | 7.71e-03 | NA | 4.57e-11 |
| 3. B | Q9W0T5 | Transient receptor potential channel pyrexia | 1.61e-01 | NA | 4.04e-08 |
| 3. B | Q9NWX5 | Ankyrin repeat and SOCS box protein 6 | 5.90e-03 | NA | 1.32e-05 |
| 3. B | Q5W7F2 | ADP-ribosylation factor GTPase-activating protein AGD3 | 3.51e-02 | NA | 0.041 |
| 3. B | Q9STP8 | Acyl-CoA-binding domain-containing protein 2 | 3.97e-01 | NA | 1.22e-04 |
| 3. B | A6NGH8 | Ankyrin repeat domain-containing protein 61 | 3.51e-03 | NA | 1.78e-06 |
| 3. B | Q63ZY3 | KN motif and ankyrin repeat domain-containing protein 2 | 6.57e-01 | NA | 2.19e-04 |
| 3. B | Q07DX4 | Cortactin-binding protein 2 | 6.33e-01 | NA | 8.21e-06 |
| 3. B | Q9CR42 | Ankyrin repeat domain-containing protein 1 | 1.04e-02 | NA | 5.86e-07 |
| 3. B | Q8BTZ5 | Ankyrin repeat domain-containing protein 46 | 9.28e-02 | NA | 4.04e-04 |
| 3. B | A6NK59 | Ankyrin repeat and SOCS box protein 14 | 1.51e-02 | NA | 7.78e-06 |
| 3. B | Q8BLA8 | Transient receptor potential cation channel subfamily A member 1 | 3.14e-01 | NA | 0.004 |
| 3. B | Q8H569 | Potassium channel AKT3 | 1.59e-01 | NA | 8.42e-06 |
| 3. B | O73630 | Nuclear factor NF-kappa-B p100 subunit | 4.00e-02 | NA | 1.48e-09 |
| 3. B | A6NI47 | Putative POTE ankyrin domain family member M | 2.17e-03 | NA | 7.45e-59 |
| 3. B | Q5UQV3 | Putative ankyrin repeat protein L371 | NA | NA | 1.53e-06 |
| 3. B | Q6C520 | Palmitoyltransferase AKR1 | 2.35e-03 | NA | 0.005 |
| 3. B | Q2QLA2 | Cortactin-binding protein 2 | 5.78e-01 | NA | 1.66e-04 |
| 3. B | Q9D2X0 | Ankyrin repeat domain-containing protein 39 | 3.81e-02 | NA | 5.08e-06 |
| 3. B | O75179 | Ankyrin repeat domain-containing protein 17 | 8.99e-02 | NA | 5.82e-11 |
| 3. B | Q86AT8 | Stress-activated protein kinase alpha | 3.22e-02 | NA | 2.74e-04 |
| 3. B | Q9HYV6 | Putative ankyrin repeat protein PA3287 | 3.56e-04 | NA | 0.001 |
| 3. B | Q5ZMD2 | Ankyrin repeat and MYND domain-containing protein 2 | 3.83e-01 | NA | 0.005 |
| 3. B | Q09YM8 | Cortactin-binding protein 2 | 6.32e-01 | NA | 1.38e-05 |
| 3. B | Q9WTK5 | Nuclear factor NF-kappa-B p100 subunit | 4.06e-02 | NA | 1.38e-08 |
| 3. B | Q6GPE5 | Protein fem-1 homolog B | 2.40e-02 | NA | 6.71e-06 |
| 3. B | Q8WXE0 | Caskin-2 | 8.46e-04 | NA | 4.21e-05 |
| 3. B | Q4R690 | Palmitoyltransferase ZDHHC13 | 3.62e-03 | NA | 5.81e-10 |
| 3. B | Q07E30 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 5.13e-02 | NA | 0.045 |
| 3. B | Q5DW34 | Histone-lysine N-methyltransferase EHMT1 | 6.36e-01 | NA | 2.69e-14 |
| 3. B | Q80YE7 | Death-associated protein kinase 1 | 7.27e-02 | NA | 7.17e-10 |
| 3. B | Q5UPG0 | Putative ankyrin repeat protein L86 | NA | NA | 0.001 |
| 3. B | E9PTT0 | Palmitoyltransferase ZDHHC17 | 2.08e-03 | NA | 2.51e-09 |
| 3. B | P0DJE3 | Alpha-latrotoxin-Lhe1a | 5.18e-02 | NA | 1.92e-05 |
| 3. B | Q978J0 | Putative ankyrin repeat protein TV1425 | 1.14e-04 | NA | 6.45e-12 |
| 3. B | O00221 | NF-kappa-B inhibitor epsilon | 5.26e-05 | NA | 3.76e-05 |
| 3. B | Q2IBF5 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 3.69e-02 | NA | 0.048 |
| 3. B | Q9VSA4 | Tonsoku-like protein | 7.73e-01 | NA | 0.025 |
| 3. B | Q3UYR4 | Espin-like protein | 8.38e-02 | NA | 4.00e-07 |
| 3. B | Q8IWZ3 | Ankyrin repeat and KH domain-containing protein 1 | 1.78e-01 | NA | 5.66e-11 |
| 3. B | Q8IVF6 | Ankyrin repeat domain-containing protein 18A | 4.46e-04 | NA | 8.64e-65 |
| 3. B | Q9J5H5 | Putative ankyrin repeat protein FPV026 | NA | NA | 5.24e-10 |
| 3. B | Q9J4Z4 | Putative ankyrin repeat protein FPV246 | NA | NA | 4.09e-10 |
| 3. B | A6NC57 | Ankyrin repeat domain-containing protein 62 | 1.11e-03 | NA | 1.02e-145 |
| 3. B | B0G124 | Ankyrin repeat-containing protein DDB_G0279043 | 1.77e-03 | NA | 3.27e-08 |
| 3. B | Q8C6Y6 | Ankyrin repeat and SOCS box protein 14 | 6.94e-03 | NA | 2.66e-10 |
| 3. B | Q5UPJ9 | Putative ankyrin repeat protein L122 | NA | NA | 3.67e-04 |
| 3. B | Q91974 | NF-kappa-B inhibitor alpha | 7.08e-03 | NA | 9.13e-06 |
| 3. B | Q54F46 | Homeobox protein Wariai | 6.40e-02 | NA | 5.92e-11 |
| 3. B | A2RUR9 | Coiled-coil domain-containing protein 144A | 5.20e-03 | NA | 1.42e-87 |
| 3. B | Q108T9 | Cortactin-binding protein 2 | 4.93e-01 | NA | 7.54e-06 |
| 3. B | Q9H672 | Ankyrin repeat and SOCS box protein 7 | 8.34e-06 | NA | 2.24e-06 |
| 3. B | Q9ET47 | Espin | 5.74e-02 | NA | 1.08e-04 |
| 3. B | Q9GKW8 | Ankyrin repeat and death domain-containing protein 1A (Fragment) | 1.25e-04 | NA | 5.99e-13 |
| 3. B | Q05921 | 2-5A-dependent ribonuclease | 3.98e-03 | NA | 9.40e-07 |
| 3. B | Q5ZIJ9 | E3 ubiquitin-protein ligase MIB2 | 3.03e-02 | NA | 0.002 |
| 3. B | Q80VM7 | Ankyrin repeat domain-containing protein 24 | 1.48e-01 | NA | 9.78e-10 |
| 3. B | P50086 | Probable 26S proteasome regulatory subunit p28 | 4.28e-05 | NA | 0.002 |
| 3. B | Q1RHT6 | Putative ankyrin repeat protein RBE_0997 | 1.15e-02 | NA | 2.01e-05 |
| 3. B | Q505D1 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A | 5.88e-03 | NA | 2.76e-13 |
| 3. B | O90760 | Putative ankyrin repeat protein FPV031 | NA | NA | 1.23e-06 |
| 3. B | Q8IUH4 | Palmitoyltransferase ZDHHC13 | 1.73e-03 | NA | 2.69e-10 |
| 3. B | P81069 | GA-binding protein subunit beta-2 | 1.19e-01 | NA | 8.25e-13 |
| 3. B | Q54GC8 | Acyl-CoA-binding domain-containing protein 6 homolog | 3.77e-01 | NA | 0.005 |
| 3. B | Q9UPS8 | Ankyrin repeat domain-containing protein 26 | 3.98e-03 | NA | 3.70e-155 |
| 3. B | Q9VUW9 | Palmitoyltransferase Hip14 | 3.23e-03 | NA | 1.17e-05 |
| 3. B | Q96Q27 | Ankyrin repeat and SOCS box protein 2 | 9.09e-04 | NA | 2.23e-08 |
| 3. B | Q00420 | GA-binding protein subunit beta-1 | 2.85e-02 | NA | 3.02e-12 |
| 3. B | Q6NLQ8 | E3 ubiquitin-protein ligase XBAT32 | 5.66e-02 | NA | 2.05e-04 |
| 3. B | Q9J508 | Putative ankyrin repeat protein FPV227 | NA | NA | 1.26e-07 |
| 3. B | Q86WC6 | Protein phosphatase 1 regulatory subunit 27 | 8.77e-02 | NA | 3.38e-05 |
| 3. B | Q1RI12 | Putative ankyrin repeat protein RBE_0921 | 2.09e-01 | NA | 1.46e-04 |
| 3. B | A4D7T3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.32e-02 | NA | 2.79e-04 |
| 3. B | Q8R516 | E3 ubiquitin-protein ligase MIB2 | 6.24e-02 | NA | 0.004 |
| 3. B | Q5ZXN6 | Phosphocholine transferase AnkX | 7.25e-02 | NA | 0.012 |
| 3. B | Q8BG95 | Protein phosphatase 1 regulatory subunit 12B | 1.52e-02 | NA | 1.12e-04 |
| 3. B | Q13418 | Integrin-linked protein kinase | 5.75e-02 | NA | 3.34e-07 |
| 3. B | Q6ZVH7 | Espin-like protein | 3.35e-02 | NA | 2.96e-08 |
| 3. B | P83757 | NF-kappa-B inhibitor cactus | NA | NA | 0.009 |
| 3. B | Q9C0D5 | Protein TANC1 | 2.91e-02 | NA | 1.14e-10 |
| 3. B | Q5BKI6 | Ankyrin repeat domain-containing protein 1 | 1.35e-02 | NA | 3.38e-07 |
| 3. B | Q9Z1P7 | KN motif and ankyrin repeat domain-containing protein 3 | 2.62e-02 | NA | 1.87e-05 |
| 3. B | Q9J516 | Putative ankyrin repeat protein FPV219 | NA | NA | 4.37e-08 |
| 3. B | Q6ZQK5 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 | 1.98e-01 | NA | 4.48e-05 |
| 3. B | Q07DZ5 | Cortactin-binding protein 2 | 1.00e-01 | NA | 1.27e-05 |
| 3. B | Q09YN0 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 4.96e-02 | NA | 0.002 |
| 3. B | O14340 | Oxysterol-binding protein homolog C2F12.05c | 1.33e-01 | NA | 0.006 |
| 3. B | D3YZU1 | SH3 and multiple ankyrin repeat domains protein 1 | 9.75e-03 | NA | 0.002 |
| 3. B | Q92527 | Ankyrin repeat domain-containing protein 7 | 2.23e-03 | NA | 3.73e-44 |
| 3. B | Q02989 | Alpha-latroinsectotoxin-Lt1a (Fragment) | 1.36e-02 | NA | 1.83e-08 |
| 3. B | Q60J38 | Ankyrin repeat and KH domain-containing protein CBG24701 | 2.42e-01 | NA | 3.22e-08 |
| 3. B | D3ZD05 | KN motif and ankyrin repeat domain-containing protein 2 | 6.86e-01 | NA | 3.98e-04 |
| 3. B | Q8T2Q0 | Putative ZDHHC-type palmitoyltransferase 6 | 2.66e-02 | NA | 1.51e-07 |
| 3. B | B2RXR6 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B | 4.48e-03 | NA | 3.98e-15 |
| 3. B | Q502K3 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 3.07e-03 | NA | 3.84e-13 |
| 3. B | Q862Z2 | Ankyrin repeat and SOCS box protein 5 | 7.96e-04 | NA | 0.001 |
| 3. B | Q66H07 | Fibronectin type 3 and ankyrin repeat domains 1 protein | 2.06e-05 | NA | 5.06e-05 |
| 3. B | Q571F8 | Glutaminase liver isoform, mitochondrial | 6.27e-01 | NA | 0.023 |
| 3. B | Q9EP71 | Ankycorbin | 2.43e-02 | NA | 1.53e-09 |
| 3. B | Q9FIT8 | ADP-ribosylation factor GTPase-activating protein AGD1 | 4.53e-01 | NA | 1.30e-04 |
| 3. B | Q5PQ89 | Ankyrin repeat domain-containing protein 34B | 3.83e-01 | NA | 0.007 |
| 3. B | Q8HYY4 | Uveal autoantigen with coiled-coil domains and ankyrin repeats protein | 5.53e-02 | NA | 1.27e-11 |
| 3. B | Q05753 | Ankyrin repeat domain-containing protein, chloroplastic | 5.38e-02 | NA | 3.69e-09 |
| 3. B | Q2QLB3 | Cortactin-binding protein 2 | 6.62e-01 | NA | 3.83e-05 |
| 3. B | Q6UB99 | Ankyrin repeat domain-containing protein 11 | 1.14e-01 | NA | 9.92e-09 |
| 3. B | Q9JIA3 | NF-kappa-B inhibitor beta | 1.96e-02 | NA | 0.012 |
| 3. B | O55222 | Integrin-linked protein kinase | 5.62e-02 | NA | 3.15e-07 |
| 3. B | Q9J569 | Putative ankyrin repeat protein FPV162 | NA | NA | 1.27e-05 |
| 3. B | Q3SX45 | Ankyrin repeat and SOCS box protein 2 | 1.33e-03 | NA | 1.06e-10 |
| 3. B | Q08DV6 | Ankyrin repeat and SOCS box protein 3 | 4.04e-04 | NA | 3.33e-10 |
| 3. B | Q9SAR5 | Ankyrin repeat domain-containing protein 2A | 2.75e-01 | NA | 3.68e-08 |
| 3. B | Q76K24 | Ankyrin repeat domain-containing protein 46 | 9.05e-02 | NA | 2.96e-04 |
| 3. B | Q4V8X4 | Acyl-CoA-binding domain-containing protein 6 | 2.84e-01 | NA | 9.33e-05 |
| 3. B | Q04721 | Neurogenic locus notch homolog protein 2 | 4.68e-01 | NA | 2.50e-06 |
| 3. B | Q09YI1 | Cortactin-binding protein 2 | 3.13e-01 | NA | 2.29e-05 |
| 3. B | Q3UMT1 | Protein phosphatase 1 regulatory subunit 12C | 1.23e-02 | NA | 0.045 |
| 3. B | Q8N6D5 | Ankyrin repeat domain-containing protein 29 | 1.54e-03 | NA | 7.94e-06 |
| 3. B | O15084 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A | 6.23e-03 | NA | 2.43e-13 |
| 3. B | Q5NVB9 | Palmitoyltransferase ZDHHC13 | 3.53e-03 | NA | 2.69e-10 |
| 3. B | Q7T2B9 | Myotrophin | 5.18e-03 | NA | 9.38e-07 |
| 3. B | Q9J4Z5 | Putative ankyrin repeat protein FPV245 | NA | NA | 3.13e-08 |
| 3. B | Q8BTI7 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 7.63e-02 | NA | 1.17e-12 |
| 3. B | E5RJM6 | Ankyrin repeat domain-containing protein 65 | 2.63e-03 | NA | 1.90e-05 |
| 3. B | Q6P9Z4 | Protein fem-1 homolog A | 5.59e-03 | NA | 5.21e-04 |
| 3. B | Q9GZV1 | Ankyrin repeat domain-containing protein 2 | 4.07e-02 | NA | 8.67e-10 |
| 3. B | Q9QW30 | Neurogenic locus notch homolog protein 2 | 3.74e-01 | NA | 1.77e-05 |
| 3. B | Q6GQX6 | Ankyrin repeat and SAM domain-containing protein 6 | 1.25e-01 | NA | 4.85e-04 |
| 3. B | Q9NGC3 | Centaurin-gamma-1A | 9.04e-01 | NA | 0.022 |
| 3. B | Q3SX00 | Ankyrin repeat domain-containing protein 46 | 1.16e-01 | NA | 0.003 |
| 3. B | Q6IVG4 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 | 2.03e-01 | NA | 1.13e-04 |
| 3. B | Q59H18 | Serine/threonine-protein kinase TNNI3K | 1.68e-01 | NA | 2.20e-06 |
| 3. B | Q9SM23 | Acyl-CoA-binding domain-containing protein 1 | 4.01e-01 | NA | 0.007 |
| 3. B | Q8VHQ3 | Protein phosphatase 1 regulatory inhibitor subunit 16B | 1.09e-02 | NA | 0.014 |
| 3. B | Q99PE2 | Ankyrin repeat family A protein 2 | 7.95e-02 | NA | 1.96e-07 |
| 3. B | Q9BSK4 | Protein fem-1 homolog A | 2.36e-02 | NA | 0.036 |
| 3. B | Q9H9B1 | Histone-lysine N-methyltransferase EHMT1 | 7.51e-02 | NA | 1.68e-13 |
| 3. B | P35210 | Protein SPT23 | 6.03e-01 | NA | 0.023 |
| 3. B | Q28BK1 | E3 ubiquitin-protein ligase HACE1 | 1.40e-01 | NA | 2.90e-08 |
| 3. B | Q8IYA2 | Putative coiled-coil domain-containing protein 144C | 3.26e-03 | NA | 1.99e-61 |
| 3. B | Q9J5I7 | Putative ankyrin repeat protein FPV014 | NA | NA | 1.48e-06 |
| 3. B | H3BUK9 | POTE ankyrin domain family member B2 | 1.28e-03 | NA | 3.06e-61 |
| 3. B | Q9BZF9 | Uveal autoantigen with coiled-coil domains and ankyrin repeats | 1.01e-02 | NA | 5.64e-10 |
| 3. B | Q9DAM9 | Fibronectin type 3 and ankyrin repeat domains 1 protein | 2.02e-05 | NA | 2.53e-05 |
| 3. B | Q8N283 | Ankyrin repeat domain-containing protein 35 | 1.30e-01 | NA | 7.52e-12 |
| 3. B | Q8WXH4 | Ankyrin repeat and SOCS box protein 11 | 1.22e-03 | NA | 0.015 |
| 3. B | Q1RJR4 | Putative ankyrin repeat protein RBE_0319 | 1.76e-02 | NA | 0.004 |
| 3. B | O60733 | 85/88 kDa calcium-independent phospholipase A2 | 1.25e-01 | NA | 3.24e-06 |
| 3. B | Q8BLB8 | Ankyrin repeat domain-containing protein 34C | 1.37e-01 | NA | 9.89e-06 |
| 3. B | Q9ERK0 | Receptor-interacting serine/threonine-protein kinase 4 | 2.92e-03 | NA | 3.23e-10 |
| 3. B | Q810B6 | Rabankyrin-5 | 7.28e-03 | NA | 9.42e-05 |
| 3. B | Q9J517 | Putative ankyrin repeat protein FPV218 | NA | NA | 1.15e-08 |
| 3. B | Q96IX9 | Putative ankyrin repeat domain-containing protein 26-like 1 | 1.76e-02 | NA | 5.71e-42 |
| 3. B | Q12955 | Ankyrin-3 | NA | NA | 7.20e-15 |
| 3. B | Q09YJ3 | Cortactin-binding protein 2 | 7.59e-01 | NA | 1.10e-05 |
| 3. B | Q8VHS5 | Ankyrin repeat and SOCS box protein 16 | 2.78e-03 | NA | 0.006 |
| 3. B | Q6TNT2 | Ankyrin repeat domain-containing protein 46 | 1.94e-01 | NA | 0.016 |
| 3. B | A2RUV0 | Neurogenic locus notch homolog protein 1 | 2.46e-01 | NA | 8.93e-06 |
| 3. B | Q38998 | Potassium channel AKT1 | 2.92e-01 | NA | 0.001 |
| 3. B | Q80TN5 | Palmitoyltransferase ZDHHC17 | 1.38e-03 | NA | 1.64e-09 |
| 3. B | P20749 | B-cell lymphoma 3 protein | 6.04e-03 | NA | 2.03e-13 |
| 3. B | Q7S3M5 | Palmitoyltransferase akr1 | 3.06e-03 | NA | 4.12e-10 |
| 3. B | Q7Z6G8 | Ankyrin repeat and sterile alpha motif domain-containing protein 1B | 6.90e-02 | NA | 1.87e-07 |
| 3. B | A5PLL1 | Ankyrin repeat domain-containing protein 34B | 1.48e-01 | NA | 0.045 |
| 3. B | Q5R5V4 | Integrin-linked protein kinase | 1.19e-01 | NA | 2.86e-07 |
| 3. B | Q4UKX2 | Putative ankyrin repeat protein RF_0950 | 1.28e-02 | NA | 8.09e-06 |
| 3. B | O75832 | 26S proteasome non-ATPase regulatory subunit 10 | 2.47e-06 | NA | 4.63e-11 |
| 3. B | P62775 | Myotrophin | 3.57e-03 | NA | 2.79e-05 |
| 3. B | Q6ZW76 | Ankyrin repeat and SAM domain-containing protein 3 | 2.73e-02 | NA | 7.07e-12 |
| 3. B | Q2IBB4 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 4.29e-02 | NA | 0.018 |
| 3. B | P31695 | Neurogenic locus notch homolog protein 4 | 9.94e-01 | NA | 0.003 |
| 3. B | Q8GXE6 | Potassium channel AKT6 | 3.71e-01 | NA | 2.47e-05 |
| 3. B | A0A140LI88 | Ankyrin repeat domain-containing protein 31 | 3.79e-01 | NA | 7.73e-06 |
| 3. B | Q09YK4 | Cortactin-binding protein 2 | 3.24e-01 | NA | 1.69e-04 |
| 3. B | Q8C8R3 | Ankyrin-2 | NA | NA | 1.81e-17 |
| 3. B | E1C656 | E3 ubiquitin-protein ligase HACE1 | 5.72e-02 | NA | 3.12e-07 |
| 3. B | Q6F6B3 | Protein TANC1 | 2.19e-01 | NA | 1.96e-09 |
| 3. B | Q17QS6 | Ankyrin repeat and SOCS box protein 5 | 7.78e-04 | NA | 4.70e-05 |
| 3. B | Q86W74 | Ankyrin repeat domain-containing protein 46 | 2.27e-01 | NA | 0.003 |
| 3. B | Q8N8V4 | Ankyrin repeat and SAM domain-containing protein 4B | 4.01e-01 | NA | 0.002 |
| 3. B | P40480 | Protein HOS4 | 4.22e-02 | NA | 1.07e-04 |
| 3. B | Q9Y574 | Ankyrin repeat and SOCS box protein 4 | 1.24e-03 | NA | 1.89e-04 |
| 3. B | Q9H9E1 | Ankyrin repeat family A protein 2 | 5.08e-02 | NA | 1.92e-07 |
| 3. B | Q6NXT1 | Ankyrin repeat domain-containing protein 54 | 3.26e-01 | NA | 7.04e-08 |
| 3. B | Q8BIZ1 | Ankyrin repeat and sterile alpha motif domain-containing protein 1B | 4.10e-02 | NA | 1.40e-07 |
| 3. B | Q5T7N3 | KN motif and ankyrin repeat domain-containing protein 4 | 7.21e-01 | NA | 1.63e-07 |
| 3. B | Q9QZH2 | BRCA1-associated RING domain protein 1 | 7.27e-01 | NA | 8.35e-06 |
| 3. B | Q6AWW5 | Ankyrin repeat-containing protein At5g02620 | 1.03e-02 | NA | 0.002 |
| 3. B | Q7ZT11 | Ankyrin repeat domain-containing protein 1 | 2.33e-02 | NA | 1.35e-08 |
| 3. B | Q8TC84 | Fibronectin type 3 and ankyrin repeat domains protein 1 | 2.05e-05 | NA | 2.18e-07 |
| 3. B | Q54HT1 | Protein tirA | 2.91e-01 | NA | 0.015 |
| 3. B | Q96P50 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 3 | 1.75e-01 | NA | 0.003 |
| 3. B | Q9J503 | Putative ankyrin repeat protein FPV232 | NA | NA | 1.90e-05 |
| 3. B | Q99728 | BRCA1-associated RING domain protein 1 | 2.91e-01 | NA | 3.33e-06 |
| 3. B | P97570 | 85/88 kDa calcium-independent phospholipase A2 | 1.42e-01 | NA | 0.005 |
| 3. B | Q6S8J7 | POTE ankyrin domain family member A | 3.28e-02 | NA | 6.14e-65 |
| 3. B | Q3UMR0 | Ankyrin repeat domain-containing protein 27 | 1.48e-01 | NA | 2.52e-10 |
| 3. B | Q07008 | Neurogenic locus notch homolog protein 1 | 1.69e-01 | NA | 7.87e-05 |
| 3. B | A3AYR1 | Acyl-CoA-binding domain-containing protein 4 | 1.48e-01 | NA | 4.80e-04 |
| 3. B | Q3T0F7 | Myotrophin | 3.46e-03 | NA | 8.02e-05 |
| 3. B | Q811D2 | Ankyrin repeat domain-containing protein 26 | 6.93e-03 | NA | 3.37e-109 |
| 3. B | Q07DY4 | Cortactin-binding protein 2 | 8.92e-01 | NA | 1.18e-06 |
| 3. B | Q9HCD6 | Protein TANC2 | 7.59e-02 | NA | 5.88e-11 |
| 3. B | A1X157 | Cortactin-binding protein 2 | 8.51e-02 | NA | 3.83e-05 |
| 3. B | Q9D3J5 | Ankyrin repeat domain-containing protein 22 | 3.65e-04 | NA | 0.038 |
| 3. B | Q6S545 | POTE ankyrin domain family member H | 4.09e-04 | NA | 3.63e-59 |
| 3. B | Q9Z148 | Histone-lysine N-methyltransferase EHMT2 | 7.94e-02 | NA | 4.33e-12 |
| 3. B | Q9GL21 | Uveal autoantigen with coiled-coil domains and ankyrin repeats | 3.70e-02 | NA | 7.77e-11 |
| 3. B | Q1RK13 | Putative ankyrin repeat protein RBE_0220 | 3.29e-02 | NA | 5.43e-10 |
| 3. B | Q54XX5 | Probable serine/threonine-protein kinase DDB_G0278535 | 6.99e-02 | NA | 0.004 |
| 3. B | Q9CZK6 | Ankyrin repeat and SAM domain-containing protein 3 | 8.87e-02 | NA | 2.55e-13 |
| 3. B | Q8TAK5 | GA-binding protein subunit beta-2 | 1.14e-01 | NA | 1.69e-13 |
| 3. B | Q5UPF8 | Putative ankyrin repeat protein L88 | NA | NA | 8.27e-05 |
| 3. B | Q99J82 | Integrin-linked protein kinase | 5.73e-02 | NA | 3.15e-07 |
| 3. B | Q2IBF7 | Cortactin-binding protein 2 | 1.07e-01 | NA | 7.48e-06 |
| 3. B | Q2QLF8 | Cortactin-binding protein 2 | 3.53e-01 | NA | 6.09e-05 |
| 3. B | Q1RK83 | Putative ankyrin repeat protein RBE_0150 | 1.33e-01 | NA | 2.55e-04 |
| 3. B | Q71S22 | Inversin-A | 1.09e-01 | NA | 7.86e-13 |
| 3. B | Q4UMH6 | Putative ankyrin repeat protein RF_0381 | 9.63e-04 | NA | 1.37e-10 |
| 3. B | P53355 | Death-associated protein kinase 1 | 7.02e-02 | NA | 5.15e-10 |
| 3. B | Q804S5 | E3 ubiquitin-protein ligase mib1 | 1.58e-02 | NA | 4.13e-07 |
| 3. B | Q8IYU2 | E3 ubiquitin-protein ligase HACE1 | 1.28e-01 | NA | 1.50e-07 |
| 3. B | P0CS66 | Palmitoyltransferase AKR1 | 1.44e-02 | NA | 3.94e-04 |
| 3. B | Q9HLN1 | Putative ankyrin repeat protein Ta0196 | 2.32e-04 | NA | 4.02e-05 |
| 3. B | Q6B858 | Fibronectin type 3 and ankyrin repeat domains protein 1 | 1.37e-05 | NA | 2.36e-07 |
| 3. B | Q8NB46 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 4.97e-02 | NA | 4.80e-13 |
| 3. B | Q0VCS9 | Ankyrin repeat and MYND domain-containing protein 2 | 4.91e-01 | NA | 0.006 |
| 3. B | P25963 | NF-kappa-B inhibitor alpha | 6.18e-03 | NA | 2.28e-07 |
| 3. B | Q5REW9 | Ankyrin repeat domain-containing protein 27 | 6.16e-02 | NA | 3.26e-10 |
| 3. B | Q863Z4 | Myotrophin | 3.57e-03 | NA | 8.02e-05 |
| 3. B | Q9CQ31 | Ankyrin repeat and SOCS box protein 11 | 1.04e-03 | NA | 8.12e-05 |
| 3. B | Q6JAN1 | Inversin | 1.51e-01 | NA | 5.27e-12 |
| 3. B | Q5RJK8 | Acyl-CoA-binding domain-containing protein 6 | 2.21e-01 | NA | 5.27e-04 |
| 3. B | D3ZBM7 | E3 ubiquitin-protein ligase HACE1 | 3.14e-02 | NA | 1.55e-07 |
| 3. B | Q9J5G9 | Putative ankyrin repeat protein FPV034 | NA | NA | 1.79e-07 |
| 3. B | A2AS55 | Ankyrin repeat domain-containing protein 16 | 1.51e-03 | NA | 0.001 |
| 3. B | Q2QLA4 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 4.08e-02 | NA | 0.038 |
| 3. B | P23631 | Alpha-latrotoxin-Lt1a | 1.12e-01 | NA | 2.45e-06 |
| 3. B | Q8WXD9 | Caskin-1 | 1.93e-02 | NA | 1.09e-09 |
| 3. B | Q8R560 | Ankyrin repeat domain-containing protein 1 | 1.40e-02 | NA | 1.89e-08 |
| 3. B | Q60778 | NF-kappa-B inhibitor beta | 3.45e-02 | NA | 0.001 |
| 3. B | Q9FY48 | E3 ubiquitin-protein ligase KEG | 8.06e-02 | NA | 0.008 |
| 3. B | Q5UPR3 | Putative ankyrin repeat protein R777 | NA | NA | 0.012 |
| 3. B | A0A084B9Z8 | Ankyrin repeat domain-containing protein SAT10 | 9.44e-01 | NA | 0.019 |
| 3. B | Q8WZ74 | Cortactin-binding protein 2 | 4.05e-01 | NA | 8.21e-06 |
| 3. B | Q3EC11 | Probable protein S-acyltransferase 23 | 4.47e-05 | NA | 0.037 |
| 3. B | Q8BLD6 | Ankyrin repeat domain-containing protein 55 | 1.25e-01 | NA | 1.11e-09 |
| 3. B | Q5B0V6 | Palmitoyltransferase akr1 | 1.46e-02 | NA | 1.94e-08 |
| 3. B | Q6DRG7 | Protein phosphatase 1 regulatory subunit 12A | 2.44e-02 | NA | 1.76e-04 |
| 3. B | Q96DX5 | Ankyrin repeat and SOCS box protein 9 | 4.61e-04 | NA | 5.34e-07 |
| 3. B | Q9VBP3 | Poly [ADP-ribose] polymerase tankyrase | 1.10e-01 | NA | 1.14e-06 |
| 3. B | Q6DCL5 | E3 ubiquitin-protein ligase HACE1 | 1.79e-01 | NA | 4.06e-08 |
| 3. B | Q9BR61 | Acyl-CoA-binding domain-containing protein 6 | 1.75e-01 | NA | 3.59e-05 |
| 3. B | Q2QL82 | Cortactin-binding protein 2 | 6.32e-01 | NA | 9.86e-06 |
| 3. B | Q96NW4 | Ankyrin repeat domain-containing protein 27 | 2.61e-01 | NA | 5.70e-11 |
| 3. B | A7E2S9 | Putative ankyrin repeat domain-containing protein 30B-like | 9.59e-03 | NA | 1.33e-44 |
| 3. B | Q8VE42 | Ankyrin repeat domain-containing protein 49 | 7.37e-02 | NA | 0.004 |