Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
Q17RB0
(Retrotransposon Gag-like protein 8B) with a FATCAT P-Value: 0.0 and RMSD of 1.58 angstrom. The sequence alignment identity is 92.9%.
Structural alignment shown in left. Query protein A6ZKI3 colored as red in alignment, homolog Q17RB0 colored as blue.
Query protein A6ZKI3 is also shown in right top, homolog Q17RB0 showed in right bottom. They are colored based on secondary structures.
A6ZKI3 MDGRVQLIKALLALPIRPATRRWRNPIPFPETFDGDTDRLPEFIVQTGSYMFVDENTFSSDALKVTFLITRLTGPALQWVIPYIKKESPLLNDYRGFLAE 100 Q17RB0 MEGRVQLMKALLARPLRPAARRWRNPIPFPETFDGDTDRLPEFIVQTSSYMFVDENTFSNDALKVTFLITRLTGPALQWVIPYIKKESPLLSDYRGFLAE 100 A6ZKI3 MKRVFGWEEDEDF 113 Q17RB0 MKRVFGWEEDEDF 113
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:1903547 | regulation of growth hormone activity |
| 1. PB | GO:0071225 | cellular response to muramyl dipeptide |
| 1. PB | GO:0071222 | cellular response to lipopolysaccharide |
| 1. PB | GO:0001893 | maternal placenta development |
| 1. PB | GO:0060137 | maternal process involved in parturition |
| 1. PB | GO:0005730 | nucleolus |
| 1. PB | GO:0005654 | nucleoplasm |
| 2. P | GO:0008285 | negative regulation of cell population proliferation |
| 3. B | GO:0030512 | negative regulation of transforming growth factor beta receptor signaling pathway |
| 3. B | GO:0006915 | apoptotic process |
| 3. B | GO:0097345 | mitochondrial outer membrane permeabilization |
| 3. B | GO:0001890 | placenta development |
| 3. B | GO:0008270 | zinc ion binding |
| 3. B | GO:0030154 | cell differentiation |
| 3. B | GO:0051881 | regulation of mitochondrial membrane potential |
| 3. B | GO:0003676 | nucleic acid binding |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q1JQ94 | Retrotransposon Gag-like protein 8 | 0.00e+00 | 8.77e-99 | 2.91e-73 |
| 1. PB | A6ZKI3 | Retrotransposon Gag-like protein 8C | 0 | 8.34e-151 | 2.96e-79 |
| 1. PB | Q17QF6 | Protein LDOC1 | 1.26e-11 | 2.13e-17 | 9.34e-38 |
| 1. PB | Q6SEH5 | Protein LDOC1 | 4.87e-12 | 1.15e-17 | 1.03e-37 |
| 1. PB | Q17RB0 | Retrotransposon Gag-like protein 8B | 0.00e+00 | 7.10e-97 | 2.84e-74 |
| 1. PB | O95751 | Protein LDOC1 | 9.26e-12 | 3.10e-16 | 1.06e-37 |
| 1. PB | Q9BWD3 | Retrotransposon Gag-like protein 8A | 0.00e+00 | 6.02e-100 | 7.60e-75 |
| 1. PB | Q7TPY9 | Protein LDOC1 | 1.18e-10 | 3.01e-12 | 4.69e-29 |
| 1. PB | Q6SEH4 | Protein LDOC1 | 7.15e-12 | 3.20e-16 | 1.06e-37 |
| 3. B | Q7TN75 | Retrotransposon-derived protein PEG10 | 6.20e-02 | NA | 1.33e-08 |
| 3. B | Q505G4 | Retrotransposon Gag-like protein 6 | 4.32e-06 | NA | 1.49e-18 |
| 3. B | Q5R6M8 | Protein Bop | 4.32e-04 | NA | 2.79e-07 |
| 3. B | A6NKG5 | Retrotransposon-like protein 1 | 7.40e-02 | NA | 2.48e-09 |
| 3. B | Q5HYW3 | Retrotransposon Gag-like protein 5 | 1.76e-03 | NA | 1.01e-06 |
| 3. B | Q8N8U3 | Retrotransposon Gag-like protein 3 | 9.42e-04 | NA | 3.07e-07 |
| 3. B | Q5DTT4 | Retrotransposon Gag-like protein 5 | 3.22e-03 | NA | 2.49e-06 |
| 3. B | Q6ICC9 | Retrotransposon Gag-like protein 6 | 1.32e-05 | NA | 2.67e-19 |
| 3. B | Q6P1Y1 | Retrotransposon Gag-like protein 3 | 2.07e-02 | NA | 0.014 |
| 3. B | Q52QI2 | Retrotransposon-like protein 1 | 2.19e-01 | NA | 3.94e-08 |
| 3. B | Q86TG7 | Retrotransposon-derived protein PEG10 | 4.21e-03 | NA | 5.59e-10 |
| 3. B | Q7M732 | Retrotransposon-like protein 1 | 1.78e-01 | NA | 1.91e-05 |
| 3. B | Q7L3V2 | Protein Bop | 5.24e-06 | NA | 4.16e-07 |