Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
Q978J0
(Putative ankyrin repeat protein TV1425) with a FATCAT P-Value: 0.0 and RMSD of 1.91 angstrom. The sequence alignment identity is 19.8%.
Structural alignment shown in left. Query protein A7E2S9 colored as red in alignment, homolog Q978J0 colored as blue.
Query protein A7E2S9 is also shown in right top, homolog Q978J0 showed in right bottom. They are colored based on secondary structures.
A7E2S9 MERLSAAPVKGQTGPERPSPFSQLVYTNNDSYVIHHGDLRKIHKAASRGQAWKLERMMKKTTMDLNIRDAKKRTALYWACANGHAEVVTLLVDRKC---Q 97 Q978J0 --------------------------------------------------------------MD------K----------NG--EIVEKIKDEKSINQN 20 A7E2S9 LDVL----DGENRTILMKALQCQ--REACANILI---DSGADPNIVDVYGNTAVHYAVNSENLSVVAKLLSCGADIEVKNKAGHTPLLLAIRKRSEEIVE 188 Q978J0 LDFLRNYRDSYNRTPLM--VACMLGMENAIDKLVENFDKLEDK---DIEGSTALIWAVKNNRLGIAEKLLSKGSNVNTKDFSGKTPLMWSIIFGYSEMSY 115 A7E2S9 FLLTKNANANAVDKFKCVHQQLLEYKQKISKNSQNSNP--EGTSEGTPDEAAPLAERTPD-TAESLVERTPDE-------------------- 258 Q978J0 FLLEHGANVN--D-----------------RNLEGETPLIVASKYGRSEIVKKLLELGADISARDLTGLTAEASARIFGRQEVIKIFTEVRRA 189
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0045581 | negative regulation of T cell differentiation |
| 1. PB | GO:0036336 | dendritic cell migration |
| 1. PB | GO:0042994 | cytoplasmic sequestering of transcription factor |
| 1. PB | GO:0032496 | response to lipopolysaccharide |
| 1. PB | GO:0000122 | negative regulation of transcription by RNA polymerase II |
| 1. PB | GO:0050729 | positive regulation of inflammatory response |
| 1. PB | GO:0048709 | oligodendrocyte differentiation |
| 1. PB | GO:0043619 | regulation of transcription from RNA polymerase II promoter in response to oxidative stress |
| 1. PB | GO:0031670 | cellular response to nutrient |
| 1. PB | GO:0043161 | proteasome-mediated ubiquitin-dependent protein catabolic process |
| 1. PB | GO:0071345 | cellular response to cytokine stimulus |
| 1. PB | GO:0090263 | positive regulation of canonical Wnt signaling pathway |
| 1. PB | GO:0042088 | T-helper 1 type immune response |
| 1. PB | GO:0051059 | NF-kappaB binding |
| 1. PB | GO:0016567 | protein ubiquitination |
| 1. PB | GO:0007605 | sensory perception of sound |
| 1. PB | GO:0010888 | negative regulation of lipid storage |
| 1. PB | GO:0044877 | protein-containing complex binding |
| 1. PB | GO:0070198 | protein localization to chromosome, telomeric region |
| 1. PB | GO:0019887 | protein kinase regulator activity |
| 1. PB | GO:0010468 | regulation of gene expression |
| 1. PB | GO:0085020 | protein K6-linked ubiquitination |
| 1. PB | GO:0036371 | protein localization to T-tubule |
| 1. PB | GO:0033309 | SBF transcription complex |
| 1. PB | GO:0002467 | germinal center formation |
| 1. PB | GO:0001569 | branching involved in blood vessel morphogenesis |
| 1. PB | GO:0043066 | negative regulation of apoptotic process |
| 1. PB | GO:0007165 | signal transduction |
| 1. PB | GO:2000812 | regulation of barbed-end actin filament capping |
| 1. PB | GO:0010745 | negative regulation of macrophage derived foam cell differentiation |
| 1. PB | GO:1904355 | positive regulation of telomere capping |
| 1. PB | GO:0051101 | regulation of DNA binding |
| 1. PB | GO:0055013 | cardiac muscle cell development |
| 1. PB | GO:0045737 | positive regulation of cyclin-dependent protein serine/threonine kinase activity |
| 1. PB | GO:0061630 | ubiquitin protein ligase activity |
| 1. PB | GO:0033257 | Bcl3/NF-kappaB2 complex |
| 1. PB | GO:0031466 | Cul5-RING ubiquitin ligase complex |
| 1. PB | GO:0046822 | regulation of nucleocytoplasmic transport |
| 1. PB | GO:2000321 | positive regulation of T-helper 17 cell differentiation |
| 1. PB | GO:0019901 | protein kinase binding |
| 1. PB | GO:1902367 | negative regulation of Notch signaling pathway involved in somitogenesis |
| 1. PB | GO:0010225 | response to UV-C |
| 1. PB | GO:0030907 | MBF transcription complex |
| 1. PB | GO:0007219 | Notch signaling pathway |
| 1. PB | GO:2001214 | positive regulation of vasculogenesis |
| 1. PB | GO:0048536 | spleen development |
| 1. PB | GO:0035994 | response to muscle stretch |
| 1. PB | GO:0042826 | histone deacetylase binding |
| 1. PB | GO:1902230 | negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage |
| 1. PB | GO:0070427 | nucleotide-binding oligomerization domain containing 1 signaling pathway |
| 1. PB | GO:0050931 | pigment cell differentiation |
| 1. PB | GO:1902807 | negative regulation of cell cycle G1/S phase transition |
| 1. PB | GO:0033280 | response to vitamin D |
| 1. PB | GO:0006913 | nucleocytoplasmic transport |
| 1. PB | GO:0002040 | sprouting angiogenesis |
| 1. PB | GO:0045064 | T-helper 2 cell differentiation |
| 1. PB | GO:0080173 | male-female gamete recognition during double fertilization forming a zygote and endosperm |
| 1. PB | GO:0071222 | cellular response to lipopolysaccharide |
| 1. PB | GO:0000731 | DNA synthesis involved in DNA repair |
| 1. PB | GO:0035914 | skeletal muscle cell differentiation |
| 1. PB | GO:0032996 | Bcl3-Bcl10 complex |
| 1. PB | GO:0071800 | podosome assembly |
| 1. PB | GO:0043517 | positive regulation of DNA damage response, signal transduction by p53 class mediator |
| 1. PB | GO:0034142 | toll-like receptor 4 signaling pathway |
| 1. PB | GO:0000082 | G1/S transition of mitotic cell cycle |
| 1. PB | GO:0002455 | humoral immune response mediated by circulating immunoglobulin |
| 1. PB | GO:1901222 | regulation of NIK/NF-kappaB signaling |
| 1. PB | GO:0000151 | ubiquitin ligase complex |
| 1. PB | GO:0043409 | negative regulation of MAPK cascade |
| 1. PB | GO:0045859 | regulation of protein kinase activity |
| 1. PB | GO:0055007 | cardiac muscle cell differentiation |
| 1. PB | GO:0031625 | ubiquitin protein ligase binding |
| 1. PB | GO:0003713 | transcription coactivator activity |
| 1. PB | GO:0007249 | I-kappaB kinase/NF-kappaB signaling |
| 1. PB | GO:0008285 | negative regulation of cell population proliferation |
| 1. PB | GO:0010313 | phytochrome binding |
| 1. PB | GO:0045638 | negative regulation of myeloid cell differentiation |
| 1. PB | GO:0071931 | positive regulation of transcription involved in G1/S transition of mitotic cell cycle |
| 1. PB | GO:0033209 | tumor necrosis factor-mediated signaling pathway |
| 1. PB | GO:0008139 | nuclear localization sequence binding |
| 1. PB | GO:0090201 | negative regulation of release of cytochrome c from mitochondria |
| 1. PB | GO:0001947 | heart looping |
| 1. PB | GO:0048102 | autophagic cell death |
| 1. PB | GO:0030496 | midbody |
| 1. PB | GO:0005634 | nucleus |
| 1. PB | GO:0045732 | positive regulation of protein catabolic process |
| 1. PB | GO:0097129 | cyclin D2-CDK4 complex |
| 1. PB | GO:0007253 | cytoplasmic sequestering of NF-kappaB |
| 1. PB | GO:1990756 | ubiquitin ligase-substrate adaptor activity |
| 1. PB | GO:0014732 | skeletal muscle atrophy |
| 1. PB | GO:0031432 | titin binding |
| 1. PB | GO:0010875 | positive regulation of cholesterol efflux |
| 1. PB | GO:0022407 | regulation of cell-cell adhesion |
| 1. PB | GO:0045746 | negative regulation of Notch signaling pathway |
| 1. PB | GO:0043518 | negative regulation of DNA damage response, signal transduction by p53 class mediator |
| 1. PB | GO:0043330 | response to exogenous dsRNA |
| 1. PB | GO:0010923 | negative regulation of phosphatase activity |
| 1. PB | GO:0002043 | blood vessel endothelial cell proliferation involved in sprouting angiogenesis |
| 1. PB | GO:0009411 | response to UV |
| 1. PB | GO:0031663 | lipopolysaccharide-mediated signaling pathway |
| 1. PB | GO:0002315 | marginal zone B cell differentiation |
| 1. PB | GO:0010832 | negative regulation of myotube differentiation |
| 1. PB | GO:0070682 | proteasome regulatory particle assembly |
| 1. PB | GO:0045648 | positive regulation of erythrocyte differentiation |
| 1. PB | GO:0033256 | I-kappaB/NF-kappaB complex |
| 1. PB | GO:0032991 | protein-containing complex |
| 1. PB | GO:0032495 | response to muramyl dipeptide |
| 1. PB | GO:0005829 | cytosol |
| 1. PB | GO:0004861 | cyclin-dependent protein serine/threonine kinase inhibitor activity |
| 1. PB | GO:0009644 | response to high light intensity |
| 1. PB | GO:0070431 | nucleotide-binding oligomerization domain containing 2 signaling pathway |
| 1. PB | GO:0051726 | regulation of cell cycle |
| 1. PB | GO:0002268 | follicular dendritic cell differentiation |
| 1. PB | GO:1902531 | regulation of intracellular signal transduction |
| 1. PB | GO:0031436 | BRCA1-BARD1 complex |
| 1. PB | GO:0032525 | somite rostral/caudal axis specification |
| 1. PB | GO:0035556 | intracellular signal transduction |
| 1. PB | GO:0032436 | positive regulation of proteasomal ubiquitin-dependent protein catabolic process |
| 1. PB | GO:0045944 | positive regulation of transcription by RNA polymerase II |
| 1. PB | GO:0071407 | cellular response to organic cyclic compound |
| 1. PB | GO:0042326 | negative regulation of phosphorylation |
| 1. PB | GO:0030307 | positive regulation of cell growth |
| 1. PB | GO:0045893 | positive regulation of transcription, DNA-templated |
| 1. PB | GO:0014070 | response to organic cyclic compound |
| 1. PB | GO:0019730 | antimicrobial humoral response |
| 1. PB | GO:0032270 | positive regulation of cellular protein metabolic process |
| 1. PB | GO:0032088 | negative regulation of NF-kappaB transcription factor activity |
| 1. PB | GO:0005654 | nucleoplasm |
| 2. P | GO:1902510 | regulation of apoptotic DNA fragmentation |
| 2. P | GO:0002523 | leukocyte migration involved in inflammatory response |
| 2. P | GO:0001938 | positive regulation of endothelial cell proliferation |
| 2. P | GO:2000346 | negative regulation of hepatocyte proliferation |
| 2. P | GO:0090398 | cellular senescence |
| 2. P | GO:0031542 | positive regulation of anthocyanin biosynthetic process |
| 2. P | GO:0008134 | transcription factor binding |
| 2. P | GO:0090399 | replicative senescence |
| 2. P | GO:0042771 | intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator |
| 2. P | GO:0031398 | positive regulation of protein ubiquitination |
| 2. P | GO:0032717 | negative regulation of interleukin-8 production |
| 2. P | GO:0035986 | obsolete senescence-associated heterochromatin focus assembly |
| 2. P | GO:0060058 | positive regulation of apoptotic process involved in mammary gland involution |
| 2. P | GO:0045111 | intermediate filament cytoskeleton |
| 2. P | GO:2000291 | regulation of myoblast proliferation |
| 2. P | GO:0032720 | negative regulation of tumor necrosis factor production |
| 2. P | GO:0030430 | host cell cytoplasm |
| 2. P | GO:2000813 | negative regulation of barbed-end actin filament capping |
| 2. P | GO:0030308 | negative regulation of cell growth |
| 2. P | GO:1903214 | regulation of protein targeting to mitochondrion |
| 2. P | GO:0051882 | mitochondrial depolarization |
| 2. P | GO:0031532 | actin cytoskeleton reorganization |
| 2. P | GO:1902253 | regulation of intrinsic apoptotic signaling pathway by p53 class mediator |
| 2. P | GO:0039517 | modulation by virus of host protein serine/threonine phosphatase activity |
| 2. P | GO:0061408 | positive regulation of transcription from RNA polymerase II promoter in response to heat stress |
| 2. P | GO:1904667 | negative regulation of ubiquitin protein ligase activity |
| 2. P | GO:1990948 | ubiquitin ligase inhibitor activity |
| 2. P | GO:2000111 | positive regulation of macrophage apoptotic process |
| 2. P | GO:0070316 | regulation of G0 to G1 transition |
| 2. P | GO:0033600 | negative regulation of mammary gland epithelial cell proliferation |
| 2. P | GO:0097371 | MDM2/MDM4 family protein binding |
| 2. P | GO:0000079 | regulation of cyclin-dependent protein serine/threonine kinase activity |
| 2. P | GO:0030539 | male genitalia development |
| 2. P | GO:0034393 | positive regulation of smooth muscle cell apoptotic process |
| 2. P | GO:0035985 | senescence-associated heterochromatin focus |
| 2. P | GO:1903051 | negative regulation of proteolysis involved in cellular protein catabolic process |
| 2. P | GO:0010218 | response to far red light |
| 2. P | GO:0032733 | positive regulation of interleukin-10 production |
| 2. P | GO:0000502 | proteasome complex |
| 2. P | GO:0019902 | phosphatase binding |
| 2. P | GO:0033235 | positive regulation of protein sumoylation |
| 2. P | GO:0043154 | negative regulation of cysteine-type endopeptidase activity involved in apoptotic process |
| 2. P | GO:0050852 | T cell receptor signaling pathway |
| 2. P | GO:0009567 | double fertilization forming a zygote and endosperm |
| 2. P | GO:0033085 | negative regulation of T cell differentiation in thymus |
| 2. P | GO:0032729 | positive regulation of interferon-gamma production |
| 2. P | GO:0006606 | protein import into nucleus |
| 2. P | GO:0030330 | DNA damage response, signal transduction by p53 class mediator |
| 2. P | GO:0039513 | suppression by virus of host catalytic activity |
| 2. P | GO:0070245 | positive regulation of thymocyte apoptotic process |
| 2. P | GO:0004864 | protein phosphatase inhibitor activity |
| 2. P | GO:0009615 | response to virus |
| 2. P | GO:0045736 | negative regulation of cyclin-dependent protein serine/threonine kinase activity |
| 2. P | GO:0042832 | defense response to protozoan |
| 2. P | GO:0046825 | regulation of protein export from nucleus |
| 2. P | GO:0042127 | regulation of cell population proliferation |
| 2. P | GO:0030219 | megakaryocyte differentiation |
| 2. P | GO:0001953 | negative regulation of cell-matrix adhesion |
| 2. P | GO:1901798 | positive regulation of signal transduction by p53 class mediator |
| 2. P | GO:0140297 | DNA-binding transcription factor binding |
| 2. P | GO:0097602 | cullin family protein binding |
| 2. P | GO:0043422 | protein kinase B binding |
| 2. P | GO:2000435 | negative regulation of protein neddylation |
| 2. P | GO:0039644 | suppression by virus of host NF-kappaB cascade |
| 2. P | GO:0046426 | negative regulation of receptor signaling pathway via JAK-STAT |
| 2. P | GO:0010845 | positive regulation of reciprocal meiotic recombination |
| 2. P | GO:0048145 | regulation of fibroblast proliferation |
| 2. P | GO:0032526 | response to retinoic acid |
| 2. P | GO:2000774 | positive regulation of cellular senescence |
| 2. P | GO:0006878 | cellular copper ion homeostasis |
| 3. B | GO:0005770 | late endosome |
| 3. B | GO:0034765 | regulation of ion transmembrane transport |
| 3. B | GO:0007094 | mitotic spindle assembly checkpoint signaling |
| 3. B | GO:0071625 | vocalization behavior |
| 3. B | GO:0048337 | positive regulation of mesodermal cell fate specification |
| 3. B | GO:0090037 | positive regulation of protein kinase C signaling |
| 3. B | GO:0051835 | positive regulation of synapse structural plasticity |
| 3. B | GO:0006511 | ubiquitin-dependent protein catabolic process |
| 3. B | GO:0043011 | myeloid dendritic cell differentiation |
| 3. B | GO:0035148 | tube formation |
| 3. B | GO:0007507 | heart development |
| 3. B | GO:0001701 | in utero embryonic development |
| 3. B | GO:0072104 | glomerular capillary formation |
| 3. B | GO:1903779 | regulation of cardiac conduction |
| 3. B | GO:0070563 | negative regulation of vitamin D receptor signaling pathway |
| 3. B | GO:0030334 | regulation of cell migration |
| 3. B | GO:0032421 | stereocilium bundle |
| 3. B | GO:0003270 | Notch signaling pathway involved in regulation of secondary heart field cardioblast proliferation |
| 3. B | GO:0010812 | negative regulation of cell-substrate adhesion |
| 3. B | GO:0001756 | somitogenesis |
| 3. B | GO:2001259 | positive regulation of cation channel activity |
| 3. B | GO:0051247 | positive regulation of protein metabolic process |
| 3. B | GO:0021514 | ventral spinal cord interneuron differentiation |
| 3. B | GO:1903522 | regulation of blood circulation |
| 3. B | GO:0070372 | regulation of ERK1 and ERK2 cascade |
| 3. B | GO:0060412 | ventricular septum morphogenesis |
| 3. B | GO:0014044 | Schwann cell development |
| 3. B | GO:0006306 | DNA methylation |
| 3. B | GO:0097190 | apoptotic signaling pathway |
| 3. B | GO:0106310 | protein serine kinase activity |
| 3. B | GO:0003252 | negative regulation of cell proliferation involved in heart valve morphogenesis |
| 3. B | GO:0006959 | humoral immune response |
| 3. B | GO:0004842 | ubiquitin-protein transferase activity |
| 3. B | GO:0047499 | calcium-independent phospholipase A2 activity |
| 3. B | GO:0043403 | skeletal muscle tissue regeneration |
| 3. B | GO:0007140 | male meiotic nuclear division |
| 3. B | GO:0001837 | epithelial to mesenchymal transition |
| 3. B | GO:0051494 | negative regulation of cytoskeleton organization |
| 3. B | GO:0048259 | regulation of receptor-mediated endocytosis |
| 3. B | GO:0045070 | positive regulation of viral genome replication |
| 3. B | GO:0003950 | NAD+ ADP-ribosyltransferase activity |
| 3. B | GO:0050885 | neuromuscular process controlling balance |
| 3. B | GO:0021519 | spinal cord association neuron specification |
| 3. B | GO:0035264 | multicellular organism growth |
| 3. B | GO:0015095 | magnesium ion transmembrane transporter activity |
| 3. B | GO:0045611 | negative regulation of hemocyte differentiation |
| 3. B | GO:0035622 | intrahepatic bile duct development |
| 3. B | GO:2000822 | regulation of behavioral fear response |
| 3. B | GO:0045036 | protein targeting to chloroplast |
| 3. B | GO:0016571 | histone methylation |
| 3. B | GO:0043254 | regulation of protein-containing complex assembly |
| 3. B | GO:0010765 | positive regulation of sodium ion transport |
| 3. B | GO:0035304 | regulation of protein dephosphorylation |
| 3. B | GO:0071546 | pi-body |
| 3. B | GO:0010557 | positive regulation of macromolecule biosynthetic process |
| 3. B | GO:0003162 | atrioventricular node development |
| 3. B | GO:0035690 | |
| 3. B | GO:0007283 | spermatogenesis |
| 3. B | GO:0007492 | endoderm development |
| 3. B | GO:0048549 | positive regulation of pinocytosis |
| 3. B | GO:0010956 | negative regulation of calcidiol 1-monooxygenase activity |
| 3. B | GO:0030534 | adult behavior |
| 3. B | GO:0031069 | hair follicle morphogenesis |
| 3. B | GO:0086015 | SA node cell action potential |
| 3. B | GO:0032466 | negative regulation of cytokinesis |
| 3. B | GO:0110156 | methylguanosine-cap decapping |
| 3. B | GO:1990404 | protein ADP-ribosylase activity |
| 3. B | GO:0005903 | brush border |
| 3. B | GO:0097107 | postsynaptic density assembly |
| 3. B | GO:0061073 | ciliary body morphogenesis |
| 3. B | GO:0051092 | positive regulation of NF-kappaB transcription factor activity |
| 3. B | GO:0036464 | cytoplasmic ribonucleoprotein granule |
| 3. B | GO:0003151 | outflow tract morphogenesis |
| 3. B | GO:0007520 | myoblast fusion |
| 3. B | GO:0072014 | proximal tubule development |
| 3. B | GO:0002437 | inflammatory response to antigenic stimulus |
| 3. B | GO:0002039 | p53 binding |
| 3. B | GO:0002052 | positive regulation of neuroblast proliferation |
| 3. B | GO:0071354 | cellular response to interleukin-6 |
| 3. B | GO:0042734 | presynaptic membrane |
| 3. B | GO:0031462 | Cul2-RING ubiquitin ligase complex |
| 3. B | GO:0048715 | negative regulation of oligodendrocyte differentiation |
| 3. B | GO:0006742 | NADP catabolic process |
| 3. B | GO:1990433 | CSL-Notch-Mastermind transcription factor complex |
| 3. B | GO:0005123 | death receptor binding |
| 3. B | GO:0032426 | stereocilium tip |
| 3. B | GO:0008608 | attachment of spindle microtubules to kinetochore |
| 3. B | GO:1900273 | positive regulation of long-term synaptic potentiation |
| 3. B | GO:0043008 | ATP-dependent protein binding |
| 3. B | GO:0048056 | R3/R4 cell differentiation |
| 3. B | GO:0003160 | endocardium morphogenesis |
| 3. B | GO:0043086 | negative regulation of catalytic activity |
| 3. B | GO:0022011 | myelination in peripheral nervous system |
| 3. B | GO:0050894 | determination of affect |
| 3. B | GO:0001709 | cell fate determination |
| 3. B | GO:0099562 | maintenance of postsynaptic density structure |
| 3. B | GO:0000209 | protein polyubiquitination |
| 3. B | GO:0097546 | ciliary base |
| 3. B | GO:0002027 | regulation of heart rate |
| 3. B | GO:0035116 | embryonic hindlimb morphogenesis |
| 3. B | GO:2000178 | negative regulation of neural precursor cell proliferation |
| 3. B | GO:1904970 | brush border assembly |
| 3. B | GO:0044325 | transmembrane transporter binding |
| 3. B | GO:0008593 | regulation of Notch signaling pathway |
| 3. B | GO:0072116 | pronephros formation |
| 3. B | GO:0072574 | hepatocyte proliferation |
| 3. B | GO:1990760 | osmolarity-sensing cation channel activity |
| 3. B | GO:0010629 | negative regulation of gene expression |
| 3. B | GO:0046875 | ephrin receptor binding |
| 3. B | GO:0010366 | negative regulation of ethylene biosynthetic process |
| 3. B | GO:0001763 | morphogenesis of a branching structure |
| 3. B | GO:0030660 | Golgi-associated vesicle membrane |
| 3. B | GO:0002789 | negative regulation of antifungal peptide production |
| 3. B | GO:0072044 | collecting duct development |
| 3. B | GO:0046826 | negative regulation of protein export from nucleus |
| 3. B | GO:1900246 | positive regulation of RIG-I signaling pathway |
| 3. B | GO:1904901 | positive regulation of myosin II filament organization |
| 3. B | GO:0070528 | protein kinase C signaling |
| 3. B | GO:0060999 | positive regulation of dendritic spine development |
| 3. B | GO:0005516 | calmodulin binding |
| 3. B | GO:0045603 | positive regulation of endothelial cell differentiation |
| 3. B | GO:0110153 | RNA NAD-cap (NMN-forming) hydrolase activity |
| 3. B | GO:0035774 | positive regulation of insulin secretion involved in cellular response to glucose stimulus |
| 3. B | GO:0097604 | temperature-gated cation channel activity |
| 3. B | GO:0070213 | protein auto-ADP-ribosylation |
| 3. B | GO:0004672 | protein kinase activity |
| 3. B | GO:0046427 | positive regulation of receptor signaling pathway via JAK-STAT |
| 3. B | GO:0055016 | hypochord development |
| 3. B | GO:0031877 | somatostatin receptor binding |
| 3. B | GO:0048812 | neuron projection morphogenesis |
| 3. B | GO:0033292 | T-tubule organization |
| 3. B | GO:0006967 | positive regulation of antifungal peptide biosynthetic process |
| 3. B | GO:0005769 | early endosome |
| 3. B | GO:0071356 | cellular response to tumor necrosis factor |
| 3. B | GO:0045665 | negative regulation of neuron differentiation |
| 3. B | GO:0071372 | cellular response to follicle-stimulating hormone stimulus |
| 3. B | GO:0061629 | RNA polymerase II-specific DNA-binding transcription factor binding |
| 3. B | GO:1904108 | protein localization to ciliary inversin compartment |
| 3. B | GO:0009950 | dorsal/ventral axis specification |
| 3. B | GO:0005525 | GTP binding |
| 3. B | GO:1900245 | positive regulation of MDA-5 signaling pathway |
| 3. B | GO:0045747 | positive regulation of Notch signaling pathway |
| 3. B | GO:0006915 | apoptotic process |
| 3. B | GO:0035924 | cellular response to vascular endothelial growth factor stimulus |
| 3. B | GO:0097114 | NMDA glutamate receptor clustering |
| 3. B | GO:0106311 | |
| 3. B | GO:0014832 | urinary bladder smooth muscle contraction |
| 3. B | GO:0071889 | 14-3-3 protein binding |
| 3. B | GO:0090521 | glomerular visceral epithelial cell migration |
| 3. B | GO:0050768 | negative regulation of neurogenesis |
| 3. B | GO:0099092 | postsynaptic density, intracellular component |
| 3. B | GO:0005249 | voltage-gated potassium channel activity |
| 3. B | GO:0045211 | postsynaptic membrane |
| 3. B | GO:0010838 | positive regulation of keratinocyte proliferation |
| 3. B | GO:0046834 | lipid phosphorylation |
| 3. B | GO:0090083 | regulation of inclusion body assembly |
| 3. B | GO:0010976 | positive regulation of neuron projection development |
| 3. B | GO:0030017 | sarcomere |
| 3. B | GO:0043491 | protein kinase B signaling |
| 3. B | GO:0005902 | microvillus |
| 3. B | GO:0016055 | Wnt signaling pathway |
| 3. B | GO:0048873 | homeostasis of number of cells within a tissue |
| 3. B | GO:0051967 | negative regulation of synaptic transmission, glutamatergic |
| 3. B | GO:0061195 | taste bud formation |
| 3. B | GO:0018345 | protein palmitoylation |
| 3. B | GO:1904106 | protein localization to microvillus |
| 3. B | GO:0032288 | myelin assembly |
| 3. B | GO:0021515 | cell differentiation in spinal cord |
| 3. B | GO:1900127 | positive regulation of hyaluronan biosynthetic process |
| 3. B | GO:0002011 | morphogenesis of an epithelial sheet |
| 3. B | GO:0071212 | subsynaptic reticulum |
| 3. B | GO:0014807 | regulation of somitogenesis |
| 3. B | GO:0090090 | negative regulation of canonical Wnt signaling pathway |
| 3. B | GO:0030279 | negative regulation of ossification |
| 3. B | GO:0048663 | neuron fate commitment |
| 3. B | GO:0030016 | myofibril |
| 3. B | GO:0006584 | catecholamine metabolic process |
| 3. B | GO:0060743 | epithelial cell maturation involved in prostate gland development |
| 3. B | GO:0003182 | coronary sinus valve morphogenesis |
| 3. B | GO:0055117 | regulation of cardiac muscle contraction |
| 3. B | GO:1902339 | positive regulation of apoptotic process involved in morphogenesis |
| 3. B | GO:0044605 | phosphocholine transferase activity |
| 3. B | GO:0006929 | substrate-dependent cell migration |
| 3. B | GO:0030424 | axon |
| 3. B | GO:0007409 | axonogenesis |
| 3. B | GO:0051146 | striated muscle cell differentiation |
| 3. B | GO:0045171 | intercellular bridge |
| 3. B | GO:0110155 | NAD-cap decapping |
| 3. B | GO:0035255 | ionotropic glutamate receptor binding |
| 3. B | GO:0003714 | transcription corepressor activity |
| 3. B | GO:0043069 | negative regulation of programmed cell death |
| 3. B | GO:1902260 | negative regulation of delayed rectifier potassium channel activity |
| 3. B | GO:0031013 | troponin I binding |
| 3. B | GO:0031430 | M band |
| 3. B | GO:0043046 | DNA methylation involved in gamete generation |
| 3. B | GO:0090238 | positive regulation of arachidonic acid secretion |
| 3. B | GO:0045751 | negative regulation of Toll signaling pathway |
| 3. B | GO:0072576 | liver morphogenesis |
| 3. B | GO:0007030 | Golgi organization |
| 3. B | GO:0045838 | positive regulation of membrane potential |
| 3. B | GO:0005929 | cilium |
| 3. B | GO:1902263 | apoptotic process involved in embryonic digit morphogenesis |
| 3. B | GO:0035172 | hemocyte proliferation |
| 3. B | GO:0003344 | pericardium morphogenesis |
| 3. B | GO:0044030 | regulation of DNA methylation |
| 3. B | GO:0060076 | excitatory synapse |
| 3. B | GO:0070742 | C2H2 zinc finger domain binding |
| 3. B | GO:0140627 | ubiquitin-dependent protein catabolic process via the C-end degron rule pathway |
| 3. B | GO:0003208 | cardiac ventricle morphogenesis |
| 3. B | GO:0003214 | cardiac left ventricle morphogenesis |
| 3. B | GO:0007613 | memory |
| 3. B | GO:0010424 | DNA methylation on cytosine within a CG sequence |
| 3. B | GO:0014731 | spectrin-associated cytoskeleton |
| 3. B | GO:0044309 | neuron spine |
| 3. B | GO:0005737 | cytoplasm |
| 3. B | GO:0098978 | glutamatergic synapse |
| 3. B | GO:2000001 | regulation of DNA damage checkpoint |
| 3. B | GO:0072114 | pronephros morphogenesis |
| 3. B | GO:0010882 | regulation of cardiac muscle contraction by calcium ion signaling |
| 3. B | GO:0043005 | neuron projection |
| 3. B | GO:0098871 | postsynaptic actin cytoskeleton |
| 3. B | GO:0097435 | supramolecular fiber organization |
| 3. B | GO:1904385 | cellular response to angiotensin |
| 3. B | GO:0035153 | epithelial cell type specification, open tracheal system |
| 3. B | GO:0046331 | lateral inhibition |
| 3. B | GO:0014704 | intercalated disc |
| 3. B | GO:0097113 | AMPA glutamate receptor clustering |
| 3. B | GO:0046959 | habituation |
| 3. B | GO:0001955 | blood vessel maturation |
| 3. B | GO:0099519 | dense core granule cytoskeletal transport |
| 3. B | GO:0038023 | signaling receptor activity |
| 3. B | GO:0060354 | negative regulation of cell adhesion molecule production |
| 3. B | GO:0031441 | negative regulation of mRNA 3'-end processing |
| 3. B | GO:0032232 | negative regulation of actin filament bundle assembly |
| 3. B | GO:0034638 | phosphatidylcholine catabolic process |
| 3. B | GO:0021546 | rhombomere development |
| 3. B | GO:0003332 | negative regulation of extracellular matrix constituent secretion |
| 3. B | GO:0046976 | histone methyltransferase activity (H3-K27 specific) |
| 3. B | GO:1905274 | regulation of modification of postsynaptic actin cytoskeleton |
| 3. B | GO:0045794 | negative regulation of cell volume |
| 3. B | GO:0005856 | cytoskeleton |
| 3. B | GO:0009862 | systemic acquired resistance, salicylic acid mediated signaling pathway |
| 3. B | GO:1904717 | regulation of AMPA glutamate receptor clustering |
| 3. B | GO:0031047 | gene silencing by RNA |
| 3. B | GO:0042048 | olfactory behavior |
| 3. B | GO:0071447 | cellular response to hydroperoxide |
| 3. B | GO:0032580 | Golgi cisterna membrane |
| 3. B | GO:0016529 | sarcoplasmic reticulum |
| 3. B | GO:0060288 | formation of a compartment boundary |
| 3. B | GO:0051497 | negative regulation of stress fiber assembly |
| 3. B | GO:0140374 | antiviral innate immune response |
| 3. B | GO:0030034 | microvillar actin bundle assembly |
| 3. B | GO:1904743 | negative regulation of telomeric DNA binding |
| 3. B | GO:0071347 | cellular response to interleukin-1 |
| 3. B | GO:1900383 | regulation of synaptic plasticity by receptor localization to synapse |
| 3. B | GO:0003241 | growth involved in heart morphogenesis |
| 3. B | GO:0072660 | maintenance of protein location in plasma membrane |
| 3. B | GO:0015629 | actin cytoskeleton |
| 3. B | GO:0009967 | positive regulation of signal transduction |
| 3. B | GO:0071359 | cellular response to dsRNA |
| 3. B | GO:0060289 | compartment boundary maintenance |
| 3. B | GO:0031674 | I band |
| 3. B | GO:2000134 | negative regulation of G1/S transition of mitotic cell cycle |
| 3. B | GO:0043197 | dendritic spine |
| 3. B | GO:0005112 | Notch binding |
| 3. B | GO:0003198 | epithelial to mesenchymal transition involved in endocardial cushion formation |
| 3. B | GO:0102991 | myristoyl-CoA hydrolase activity |
| 3. B | GO:1901187 | regulation of ephrin receptor signaling pathway |
| 3. B | GO:0001889 | liver development |
| 3. B | GO:0045197 | establishment or maintenance of epithelial cell apical/basal polarity |
| 3. B | GO:0060674 | placenta blood vessel development |
| 3. B | GO:0039529 | RIG-I signaling pathway |
| 3. B | GO:0036309 | protein localization to M-band |
| 3. B | GO:0065001 | specification of axis polarity |
| 3. B | GO:0000287 | magnesium ion binding |
| 3. B | GO:0060317 | cardiac epithelial to mesenchymal transition |
| 3. B | GO:0097117 | guanylate kinase-associated protein clustering |
| 3. B | GO:0086069 | bundle of His cell to Purkinje myocyte communication |
| 3. B | GO:0060948 | cardiac vascular smooth muscle cell development |
| 3. B | GO:0098919 | structural constituent of postsynaptic density |
| 3. B | GO:0034446 | substrate adhesion-dependent cell spreading |
| 3. B | GO:0002357 | defense response to tumor cell |
| 3. B | GO:0002070 | epithelial cell maturation |
| 3. B | GO:0051968 | positive regulation of synaptic transmission, glutamatergic |
| 3. B | GO:0034112 | positive regulation of homotypic cell-cell adhesion |
| 3. B | GO:0060442 | branching involved in prostate gland morphogenesis |
| 3. B | GO:0006471 | protein ADP-ribosylation |
| 3. B | GO:0070531 | BRCA1-A complex |
| 3. B | GO:0030154 | cell differentiation |
| 3. B | GO:0060842 | arterial endothelial cell differentiation |
| 3. B | GO:0086070 | SA node cell to atrial cardiac muscle cell communication |
| 3. B | GO:1900452 | regulation of long-term synaptic depression |
| 3. B | GO:0045955 | negative regulation of calcium ion-dependent exocytosis |
| 3. B | GO:0070972 | protein localization to endoplasmic reticulum |
| 3. B | GO:0090160 | Golgi to lysosome transport |
| 3. B | GO:2001027 | negative regulation of endothelial cell chemotaxis |
| 3. B | GO:0043268 | positive regulation of potassium ion transport |
| 3. B | GO:0016021 | integral component of membrane |
| 3. B | GO:0031267 | small GTPase binding |
| 3. B | GO:0060035 | notochord cell development |
| 3. B | GO:0002193 | MAML1-RBP-Jkappa- ICN1 complex |
| 3. B | GO:0046579 | positive regulation of Ras protein signal transduction |
| 3. B | GO:0045685 | regulation of glial cell differentiation |
| 3. B | GO:0030513 | positive regulation of BMP signaling pathway |
| 3. B | GO:2000737 | negative regulation of stem cell differentiation |
| 3. B | GO:0048754 | branching morphogenesis of an epithelial tube |
| 3. B | GO:2001279 | regulation of unsaturated fatty acid biosynthetic process |
| 3. B | GO:0010001 | glial cell differentiation |
| 3. B | GO:0000062 | fatty-acyl-CoA binding |
| 3. B | GO:1900827 | positive regulation of membrane depolarization during cardiac muscle cell action potential |
| 3. B | GO:0031960 | response to corticosteroid |
| 3. B | GO:0060074 | synapse maturation |
| 3. B | GO:0003256 | regulation of transcription from RNA polymerase II promoter involved in myocardial precursor cell differentiation |
| 3. B | GO:1901201 | regulation of extracellular matrix assembly |
| 3. B | GO:0048892 | lateral line nerve development |
| 3. B | GO:0032049 | cardiolipin biosynthetic process |
| 3. B | GO:0008093 | cytoskeletal anchor activity |
| 3. B | GO:0010667 | negative regulation of cardiac muscle cell apoptotic process |
| 3. B | GO:0038061 | NIK/NF-kappaB signaling |
| 3. B | GO:0003170 | heart valve development |
| 3. B | GO:0005938 | cell cortex |
| 3. B | GO:0042802 | identical protein binding |
| 3. B | GO:0048708 | astrocyte differentiation |
| 3. B | GO:0030674 | protein-macromolecule adaptor activity |
| 3. B | GO:0001708 | cell fate specification |
| 3. B | GO:0046486 | glycerolipid metabolic process |
| 3. B | GO:0034058 | endosomal vesicle fusion |
| 3. B | GO:0003222 | ventricular trabecula myocardium morphogenesis |
| 3. B | GO:0030326 | embryonic limb morphogenesis |
| 3. B | GO:0060740 | prostate gland epithelium morphogenesis |
| 3. B | GO:0030837 | negative regulation of actin filament polymerization |
| 3. B | GO:0071286 | cellular response to magnesium ion |
| 3. B | GO:0090309 | positive regulation of DNA methylation-dependent heterochromatin assembly |
| 3. B | GO:0060411 | cardiac septum morphogenesis |
| 3. B | GO:0097237 | cellular response to toxic substance |
| 3. B | GO:1905938 | positive regulation of germ cell proliferation |
| 3. B | GO:0050775 | positive regulation of dendrite morphogenesis |
| 3. B | GO:0060113 | inner ear receptor cell differentiation |
| 3. B | GO:0045967 | negative regulation of growth rate |
| 3. B | GO:0043034 | costamere |
| 3. B | GO:0021986 | habenula development |
| 3. B | GO:0018230 | peptidyl-L-cysteine S-palmitoylation |
| 3. B | GO:0032791 | lead ion binding |
| 3. B | GO:0031297 | replication fork processing |
| 3. B | GO:0030046 | parallel actin filament bundle assembly |
| 3. B | GO:0046843 | dorsal appendage formation |
| 3. B | GO:0036166 | phenotypic switching |
| 3. B | GO:0046469 | platelet activating factor metabolic process |
| 3. B | GO:0070986 | left/right axis specification |
| 3. B | GO:1990416 | cellular response to brain-derived neurotrophic factor stimulus |
| 3. B | GO:0005576 | extracellular region |
| 3. B | GO:0046974 | histone methyltransferase activity (H3-K9 specific) |
| 3. B | GO:0098908 | regulation of neuronal action potential |
| 3. B | GO:0018024 | histone-lysine N-methyltransferase activity |
| 3. B | GO:0045814 | negative regulation of gene expression, epigenetic |
| 3. B | GO:0021915 | neural tube development |
| 3. B | GO:0030018 | Z disc |
| 3. B | GO:0042805 | actinin binding |
| 3. B | GO:0036377 | arbuscular mycorrhizal association |
| 3. B | GO:0043063 | intercellular bridge organization |
| 3. B | GO:0046473 | phosphatidic acid metabolic process |
| 3. B | GO:0007221 | positive regulation of transcription of Notch receptor target |
| 3. B | GO:0099612 | protein localization to axon |
| 3. B | GO:0061419 | positive regulation of transcription from RNA polymerase II promoter in response to hypoxia |
| 3. B | GO:0005524 | ATP binding |
| 3. B | GO:1902041 | regulation of extrinsic apoptotic signaling pathway via death domain receptors |
| 3. B | GO:1905456 | regulation of lymphoid progenitor cell differentiation |
| 3. B | GO:0045669 | positive regulation of osteoblast differentiation |
| 3. B | GO:0042686 | regulation of cardioblast cell fate specification |
| 3. B | GO:0046338 | phosphatidylethanolamine catabolic process |
| 3. B | GO:0071260 | cellular response to mechanical stimulus |
| 3. B | GO:0090216 | positive regulation of 1-phosphatidylinositol-4-phosphate 5-kinase activity |
| 3. B | GO:0097422 | tubular endosome |
| 3. B | GO:0071316 | cellular response to nicotine |
| 3. B | GO:0018027 | peptidyl-lysine dimethylation |
| 3. B | GO:0035176 | social behavior |
| 3. B | GO:0010960 | magnesium ion homeostasis |
| 3. B | GO:0080085 | signal recognition particle, chloroplast targeting |
| 3. B | GO:2001204 | regulation of osteoclast development |
| 3. B | GO:0001650 | fibrillar center |
| 3. B | GO:0140261 | BCOR complex |
| 3. B | GO:0035418 | protein localization to synapse |
| 3. B | GO:0005886 | plasma membrane |
| 3. B | GO:0042325 | regulation of phosphorylation |
| 3. B | GO:0010614 | negative regulation of cardiac muscle hypertrophy |
| 3. B | GO:0021675 | nerve development |
| 3. B | GO:2000022 | regulation of jasmonic acid mediated signaling pathway |
| 3. B | GO:0035646 | endosome to melanosome transport |
| 3. B | GO:0044232 | organelle membrane contact site |
| 3. B | GO:0048899 | anterior lateral line development |
| 3. B | GO:0033147 | negative regulation of intracellular estrogen receptor signaling pathway |
| 3. B | GO:0062043 | positive regulation of cardiac epithelial to mesenchymal transition |
| 3. B | GO:0070208 | protein heterotrimerization |
| 3. B | GO:0001222 | transcription corepressor binding |
| 3. B | GO:0045316 | negative regulation of compound eye photoreceptor development |
| 3. B | GO:0007009 | plasma membrane organization |
| 3. B | GO:0045607 | regulation of inner ear auditory receptor cell differentiation |
| 3. B | GO:0043292 | contractile fiber |
| 3. B | GO:0019843 | rRNA binding |
| 3. B | GO:0070212 | protein poly-ADP-ribosylation |
| 3. B | GO:1900271 | regulation of long-term synaptic potentiation |
| 3. B | GO:2000048 | negative regulation of cell-cell adhesion mediated by cadherin |
| 3. B | GO:1904058 | positive regulation of sensory perception of pain |
| 3. B | GO:0060979 | vasculogenesis involved in coronary vascular morphogenesis |
| 3. B | GO:0007160 | cell-matrix adhesion |
| 3. B | GO:0009066 | aspartate family amino acid metabolic process |
| 3. B | GO:0030160 | synaptic receptor adaptor activity |
| 3. B | GO:0045662 | negative regulation of myoblast differentiation |
| 3. B | GO:0019228 | neuronal action potential |
| 3. B | GO:0072017 | distal tubule development |
| 3. B | GO:0046339 | diacylglycerol metabolic process |
| 3. B | GO:0007440 | foregut morphogenesis |
| 3. B | GO:0048711 | positive regulation of astrocyte differentiation |
| 3. B | GO:0072073 | kidney epithelium development |
| 3. B | GO:0004622 | lysophospholipase activity |
| 3. B | GO:0035023 | regulation of Rho protein signal transduction |
| 3. B | GO:0072357 | PTW/PP1 phosphatase complex |
| 3. B | GO:0007386 | compartment pattern specification |
| 3. B | GO:0008022 | protein C-terminus binding |
| 3. B | GO:0010650 | positive regulation of cell communication by electrical coupling |
| 3. B | GO:0003181 | atrioventricular valve morphogenesis |
| 3. B | GO:0090051 | negative regulation of cell migration involved in sprouting angiogenesis |
| 3. B | GO:0021773 | striatal medium spiny neuron differentiation |
| 3. B | GO:0010638 | positive regulation of organelle organization |
| 3. B | GO:0060768 | regulation of epithelial cell proliferation involved in prostate gland development |
| 3. B | GO:0060998 | regulation of dendritic spine development |
| 3. B | GO:2000811 | negative regulation of anoikis |
| 3. B | GO:0045608 | negative regulation of inner ear auditory receptor cell differentiation |
| 3. B | GO:0055008 | cardiac muscle tissue morphogenesis |
| 3. B | GO:1901339 | regulation of store-operated calcium channel activity |
| 3. B | GO:2000630 | positive regulation of miRNA metabolic process |
| 3. B | GO:0006887 | exocytosis |
| 3. B | GO:0071314 | cellular response to cocaine |
| 3. B | GO:0000242 | pericentriolar material |
| 3. B | GO:2000096 | positive regulation of Wnt signaling pathway, planar cell polarity pathway |
| 3. B | GO:0003197 | endocardial cushion development |
| 3. B | GO:0016604 | nuclear body |
| 3. B | GO:0003723 | RNA binding |
| 3. B | GO:0098685 | Schaffer collateral - CA1 synapse |
| 3. B | GO:0042665 | regulation of ectodermal cell fate specification |
| 3. B | GO:0098907 | regulation of SA node cell action potential |
| 3. B | GO:0003203 | endocardial cushion morphogenesis |
| 3. B | GO:1900026 | positive regulation of substrate adhesion-dependent cell spreading |
| 3. B | GO:0035965 | cardiolipin acyl-chain remodeling |
| 3. B | GO:0003677 | DNA binding |
| 3. B | GO:0048471 | perinuclear region of cytoplasm |
| 3. B | GO:0030155 | regulation of cell adhesion |
| 3. B | GO:0086014 | atrial cardiac muscle cell action potential |
| 3. B | GO:0016409 | palmitoyltransferase activity |
| 3. B | GO:0008270 | zinc ion binding |
| 3. B | GO:0003184 | pulmonary valve morphogenesis |
| 3. B | GO:0030507 | spectrin binding |
| 3. B | GO:0032695 | negative regulation of interleukin-12 production |
| 3. B | GO:0003169 | coronary vein morphogenesis |
| 3. B | GO:1904908 | negative regulation of maintenance of mitotic sister chromatid cohesion, telomeric |
| 3. B | GO:0060528 | secretory columnal luminar epithelial cell differentiation involved in prostate glandular acinus development |
| 3. B | GO:0071532 | ankyrin repeat binding |
| 3. B | GO:0070936 | protein K48-linked ubiquitination |
| 3. B | GO:0070412 | R-SMAD binding |
| 3. B | GO:0140439 | protein-cysteine S-stearoyltransferase activity |
| 3. B | GO:0051438 | regulation of ubiquitin-protein transferase activity |
| 3. B | GO:0000210 | NAD+ diphosphatase activity |
| 3. B | GO:0031143 | pseudopodium |
| 3. B | GO:0051017 | actin filament bundle assembly |
| 3. B | GO:0007368 | determination of left/right symmetry |
| 3. B | GO:0071244 | cellular response to carbon dioxide |
| 3. B | GO:0060982 | coronary artery morphogenesis |
| 3. B | GO:0014069 | postsynaptic density |
| 3. B | GO:0007616 | long-term memory |
| 3. B | GO:0045687 | positive regulation of glial cell differentiation |
| 3. B | GO:0001954 | positive regulation of cell-matrix adhesion |
| 3. B | GO:0014912 | negative regulation of smooth muscle cell migration |
| 3. B | GO:0031359 | integral component of chloroplast outer membrane |
| 3. B | GO:0010780 | meiotic DNA double-strand break formation involved in reciprocal meiotic recombination |
| 3. B | GO:0031867 | EP4 subtype prostaglandin E2 receptor binding |
| 3. B | GO:0015248 | sterol transporter activity |
| 3. B | GO:0048103 | somatic stem cell division |
| 3. B | GO:0043266 | regulation of potassium ion transport |
| 3. B | GO:1902412 | regulation of mitotic cytokinesis |
| 3. B | GO:0050955 | thermoception |
| 3. B | GO:0060843 | venous endothelial cell differentiation |
| 3. B | GO:0001838 | embryonic epithelial tube formation |
| 3. B | GO:0060153 | modulation by virus of host cell cycle |
| 3. B | GO:2000651 | positive regulation of sodium ion transmembrane transporter activity |
| 3. B | GO:0006528 | asparagine metabolic process |
| 3. B | GO:0140031 | phosphorylation-dependent protein binding |
| 3. B | GO:0051306 | mitotic sister chromatid separation |
| 3. B | GO:0050957 | equilibrioception |
| 3. B | GO:0003207 | cardiac chamber formation |
| 3. B | GO:0061384 | heart trabecula morphogenesis |
| 3. B | GO:0048060 | negative gravitaxis |
| 3. B | GO:0072015 | glomerular visceral epithelial cell development |
| 3. B | GO:2000304 | positive regulation of ceramide biosynthetic process |
| 3. B | GO:0070171 | negative regulation of tooth mineralization |
| 3. B | GO:0019208 | phosphatase regulator activity |
| 3. B | GO:0030315 | T-tubule |
| 3. B | GO:0043280 | positive regulation of cysteine-type endopeptidase activity involved in apoptotic process |
| 3. B | GO:0003209 | cardiac atrium morphogenesis |
| 3. B | GO:1905936 | regulation of germ cell proliferation |
| 3. B | GO:0048052 | R1/R6 cell differentiation |
| 3. B | GO:0021531 | spinal cord radial glial cell differentiation |
| 3. B | GO:0010761 | fibroblast migration |
| 3. B | GO:2000969 | positive regulation of AMPA receptor activity |
| 3. B | GO:0005262 | calcium channel activity |
| 3. B | GO:0008290 | F-actin capping protein complex |
| 3. B | GO:0102545 | phosphatidyl phospholipase B activity |
| 3. B | GO:0097062 | dendritic spine maintenance |
| 3. B | GO:0031901 | early endosome membrane |
| 3. B | GO:0031672 | A band |
| 3. B | GO:0003213 | cardiac right atrium morphogenesis |
| 3. B | GO:0045869 | negative regulation of single stranded viral RNA replication via double stranded DNA intermediate |
| 3. B | GO:0045602 | negative regulation of endothelial cell differentiation |
| 3. B | GO:0050793 | regulation of developmental process |
| 3. B | GO:0098910 | regulation of atrial cardiac muscle cell action potential |
| 3. B | GO:0043194 | axon initial segment |
| 3. B | GO:0090575 | RNA polymerase II transcription regulator complex |
| 3. B | GO:0009912 | auditory receptor cell fate commitment |
| 3. B | GO:0030941 | chloroplast targeting sequence binding |
| 3. B | GO:0099527 | postsynapse to nucleus signaling pathway |
| 3. B | GO:0046849 | bone remodeling |
| 3. B | GO:2000249 | regulation of actin cytoskeleton reorganization |
| 3. B | GO:0048265 | response to pain |
| 3. B | GO:0016279 | protein-lysine N-methyltransferase activity |
| 3. B | GO:0001895 | retina homeostasis |
| 3. B | GO:1901223 | negative regulation of NIK/NF-kappaB signaling |
| 3. B | GO:0097543 | ciliary inversin compartment |
| 3. B | GO:0017124 | SH3 domain binding |
| 3. B | GO:0003847 | 1-alkyl-2-acetylglycerophosphocholine esterase activity |
| 3. B | GO:0048170 | positive regulation of long-term neuronal synaptic plasticity |
| 3. B | GO:0048854 | brain morphogenesis |
| 3. B | GO:0003219 | cardiac right ventricle formation |
| 3. B | GO:0043235 | receptor complex |
| 3. B | GO:0001658 | branching involved in ureteric bud morphogenesis |
| 3. B | GO:0017171 | serine hydrolase activity |
| 3. B | GO:0072144 | glomerular mesangial cell development |
| 3. B | GO:2000031 | regulation of salicylic acid mediated signaling pathway |
| 3. B | GO:0016235 | aggresome |
| 3. B | GO:0060956 | endocardial cell differentiation |
| 3. B | GO:1904632 | cellular response to glucoside |
| 3. B | GO:0042383 | sarcolemma |
| 3. B | GO:0071322 | cellular response to carbohydrate stimulus |
| 3. B | GO:1901189 | positive regulation of ephrin receptor signaling pathway |
| 3. B | GO:0060038 | cardiac muscle cell proliferation |
| 3. B | GO:0032212 | positive regulation of telomere maintenance via telomerase |
| 3. B | GO:0042297 | vocal learning |
| 3. B | GO:0061001 | regulation of dendritic spine morphogenesis |
| 3. B | GO:2000279 | negative regulation of DNA biosynthetic process |
| 3. B | GO:0045596 | negative regulation of cell differentiation |
| 3. B | GO:0061025 | membrane fusion |
| 3. B | GO:0051386 | regulation of neurotrophin TRK receptor signaling pathway |
| 3. B | GO:0097110 | scaffold protein binding |
| 3. B | GO:1990393 | 3M complex |
| 3. B | GO:0060803 | BMP signaling pathway involved in mesodermal cell fate specification |
| 3. B | GO:0045618 | positive regulation of keratinocyte differentiation |
| 3. B | GO:0003180 | aortic valve morphogenesis |
| 3. B | GO:1990705 | cholangiocyte proliferation |
| 3. B | GO:0060013 | righting reflex |
| 3. B | GO:0007411 | axon guidance |
| 3. B | GO:0050968 | detection of chemical stimulus involved in sensory perception of pain |
| 3. B | GO:0042246 | tissue regeneration |
| 3. B | GO:0003157 | endocardium development |
| 3. B | GO:0007229 | integrin-mediated signaling pathway |
| 3. B | GO:1900451 | positive regulation of glutamate receptor signaling pathway |
| 3. B | GO:1903343 | positive regulation of meiotic DNA double-strand break formation |
| 3. B | GO:0090029 | negative regulation of pheromone-dependent signal transduction involved in conjugation with cellular fusion |
| 3. B | GO:0046533 | negative regulation of photoreceptor cell differentiation |
| 3. B | GO:0097150 | neuronal stem cell population maintenance |
| 3. B | GO:0060045 | positive regulation of cardiac muscle cell proliferation |
| 3. B | GO:0048013 | ephrin receptor signaling pathway |
| 3. B | GO:1901019 | regulation of calcium ion transmembrane transporter activity |
| 3. B | GO:0035171 | lamellocyte differentiation |
| 3. B | GO:0004067 | asparaginase activity |
| 3. B | GO:1903849 | positive regulation of aorta morphogenesis |
| 3. B | GO:0045162 | clustering of voltage-gated sodium channels |
| 3. B | GO:0060413 | atrial septum morphogenesis |
| 3. B | GO:0051865 | protein autoubiquitination |
| 3. B | GO:0050728 | negative regulation of inflammatory response |
| 3. B | GO:0003192 | mitral valve formation |
| 3. B | GO:0043065 | positive regulation of apoptotic process |
| 3. B | GO:0030027 | lamellipodium |
| 3. B | GO:0000415 | negative regulation of histone H3-K36 methylation |
| 3. B | GO:0033268 | node of Ranvier |
| 3. B | GO:0048665 | neuron fate specification |
| 3. B | GO:0090200 | positive regulation of release of cytochrome c from mitochondria |
| 3. B | GO:1904630 | cellular response to diterpene |
| 3. B | GO:0003264 | regulation of cardioblast proliferation |
| 3. B | GO:0019705 | protein-cysteine S-myristoyltransferase activity |
| 3. B | GO:0010613 | positive regulation of cardiac muscle hypertrophy |
| 3. B | GO:0043596 | nuclear replication fork |
| 3. B | GO:0001835 | blastocyst hatching |
| 3. B | GO:0050807 | regulation of synapse organization |
| 3. B | GO:0061314 | Notch signaling involved in heart development |
| 3. B | GO:0008361 | regulation of cell size |
| 3. B | GO:0071709 | membrane assembly |
| 3. B | GO:0015278 | calcium-release channel activity |
| 3. B | GO:0060992 | response to fungicide |
| 3. B | GO:2000463 | positive regulation of excitatory postsynaptic potential |
| 3. B | GO:0016290 | palmitoyl-CoA hydrolase activity |
| 3. B | GO:0019899 | enzyme binding |
| 3. B | GO:0099173 | postsynapse organization |
| 3. B | GO:0051570 | regulation of histone H3-K9 methylation |
| 3. B | GO:0034587 | piRNA metabolic process |
| 3. B | GO:0004857 | enzyme inhibitor activity |
| 3. B | GO:2000974 | negative regulation of pro-B cell differentiation |
| 3. B | GO:0060997 | dendritic spine morphogenesis |
| 3. B | GO:0048845 | venous blood vessel morphogenesis |
| 3. B | GO:1901018 | positive regulation of potassium ion transmembrane transporter activity |
| 3. B | GO:0050714 | positive regulation of protein secretion |
| 3. B | GO:0004143 | diacylglycerol kinase activity |
| 3. B | GO:0060135 | maternal process involved in female pregnancy |
| 3. B | GO:2000311 | regulation of AMPA receptor activity |
| 3. B | GO:0043055 | maintenance of dauer |
| 3. B | GO:0086066 | atrial cardiac muscle cell to AV node cell communication |
| 3. B | GO:1901021 | positive regulation of calcium ion transmembrane transporter activity |
| 3. B | GO:1901224 | positive regulation of NIK/NF-kappaB signaling |
| 3. B | GO:0060253 | negative regulation of glial cell proliferation |
| 3. B | GO:0050966 | detection of mechanical stimulus involved in sensory perception of pain |
| 3. B | GO:0021707 | cerebellar granule cell differentiation |
| 3. B | GO:0014031 | mesenchymal cell development |
| 3. B | GO:0051151 | negative regulation of smooth muscle cell differentiation |
| 3. B | GO:0046872 | metal ion binding |
| 3. B | GO:0035544 | negative regulation of SNARE complex assembly |
| 3. B | GO:0035508 | positive regulation of myosin-light-chain-phosphatase activity |
| 3. B | GO:0097553 | calcium ion transmembrane import into cytosol |
| 3. B | GO:2000821 | regulation of grooming behavior |
| 3. B | GO:0000139 | Golgi membrane |
| 3. B | GO:0060708 | spongiotrophoblast differentiation |
| 3. B | GO:0019706 | protein-cysteine S-palmitoyltransferase activity |
| 3. B | GO:0003273 | cell migration involved in endocardial cushion formation |
| 3. B | GO:0051572 | negative regulation of histone H3-K4 methylation |
| 3. B | GO:0030900 | forebrain development |
| 3. B | GO:1903793 | positive regulation of anion transport |
| 3. B | GO:0070168 | negative regulation of biomineral tissue development |
| 3. B | GO:0044354 | macropinosome |
| 3. B | GO:0035507 | regulation of myosin-light-chain-phosphatase activity |
| 3. B | GO:1904357 | negative regulation of telomere maintenance via telomere lengthening |
| 3. B | GO:0061344 | regulation of cell adhesion involved in heart morphogenesis |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q9H560 | Putative ankyrin repeat domain-containing protein 19 | 2.27e-10 | 4.75e-14 | 1.03e-55 |
| 1. PB | Q9D738 | Ankyrin repeat and SOCS box protein 12 | 3.12e-10 | 8.27e-06 | 0.034 |
| 1. PB | Q91WK7 | Ankyrin repeat domain-containing protein 54 | 6.70e-07 | 1.87e-02 | 7.32e-09 |
| 1. PB | Q92527 | Ankyrin repeat domain-containing protein 7 | 4.44e-16 | 3.98e-19 | 1.21e-51 |
| 1. PB | Q5U2S6 | Ankyrin repeat and SOCS box protein 2 | 1.20e-05 | 5.28e-05 | 1.02e-10 |
| 1. PB | Q5EA33 | Ankyrin repeat domain-containing protein 49 | 2.13e-10 | 4.15e-02 | 9.61e-06 |
| 1. PB | A4II29 | Notch-regulated ankyrin repeat-containing protein | 1.74e-08 | 9.82e-07 | 7.15e-04 |
| 1. PB | Q862Z2 | Ankyrin repeat and SOCS box protein 5 | 1.52e-08 | 6.26e-06 | 4.09e-05 |
| 1. PB | Q53RE8 | Ankyrin repeat domain-containing protein 39 | 3.69e-13 | 2.20e-11 | 1.20e-09 |
| 1. PB | Q8WWX0 | Ankyrin repeat and SOCS box protein 5 | 3.30e-09 | 1.26e-05 | 5.45e-06 |
| 1. PB | Q9WV74 | Ankyrin repeat and SOCS box protein 1 | 3.68e-08 | 2.43e-05 | 8.93e-06 |
| 1. PB | Q54HW1 | 26S proteasome non-ATPase regulatory subunit 10 | 3.16e-12 | 4.28e-03 | 6.56e-11 |
| 1. PB | Q0P5B9 | Ankyrin repeat domain-containing protein 39 | 1.69e-14 | 5.47e-09 | 8.57e-11 |
| 1. PB | Q566C8 | Ankyrin repeat domain-containing protein 54 | 6.02e-06 | 5.78e-03 | 7.18e-09 |
| 1. PB | Q9JIA3 | NF-kappa-B inhibitor beta | 1.86e-06 | 1.28e-04 | 0.003 |
| 1. PB | Q60773 | Cyclin-dependent kinase 4 inhibitor D | 0.00e+00 | 2.77e-05 | 6.32e-07 |
| 1. PB | Q3SX45 | Ankyrin repeat and SOCS box protein 2 | 1.12e-05 | 5.53e-05 | 2.53e-13 |
| 1. PB | Q9D1A4 | Ankyrin repeat and SOCS box protein 5 | 2.79e-08 | 1.77e-05 | 3.35e-05 |
| 1. PB | Q9Y576 | Ankyrin repeat and SOCS box protein 1 | 1.24e-08 | 5.10e-05 | 4.15e-05 |
| 1. PB | Q9Z2X2 | 26S proteasome non-ATPase regulatory subunit 10 | 1.11e-15 | 3.55e-03 | 2.78e-10 |
| 1. PB | Q9WV06 | Ankyrin repeat domain-containing protein 2 | 1.38e-10 | 1.37e-03 | 2.75e-12 |
| 1. PB | B2RU33 | POTE ankyrin domain family member C | 9.90e-08 | 6.21e-05 | 7.00e-49 |
| 1. PB | Q60772 | Cyclin-dependent kinase 4 inhibitor C | 1.11e-16 | 1.37e-03 | 1.43e-06 |
| 1. PB | Q6NSI1 | Putative ankyrin repeat domain-containing protein 26-like protein | 4.17e-09 | 2.00e-09 | 1.45e-65 |
| 1. PB | Q5RFS1 | Ankyrin repeat and SOCS box protein 11 | 1.32e-08 | 1.14e-06 | 2.42e-04 |
| 1. PB | E5RJM6 | Ankyrin repeat domain-containing protein 65 | 3.49e-08 | 3.52e-02 | 1.60e-08 |
| 1. PB | Q9D504 | Ankyrin repeat domain-containing protein 7 | 3.61e-13 | 1.43e-13 | 2.09e-55 |
| 1. PB | Q15653 | NF-kappa-B inhibitor beta | 1.91e-06 | 1.75e-03 | 0.039 |
| 1. PB | Q6S5H5 | POTE ankyrin domain family member G | 3.70e-08 | 9.52e-05 | 9.20e-49 |
| 1. PB | B4E2M5 | Ankyrin repeat domain-containing protein 66 | 1.90e-07 | 2.67e-13 | 1.53e-06 |
| 1. PB | P42773 | Cyclin-dependent kinase 4 inhibitor C | 0.00e+00 | 3.12e-04 | 1.68e-05 |
| 1. PB | Q08353 | NF-kappa-B inhibitor alpha | 2.90e-07 | 5.76e-12 | 4.56e-05 |
| 1. PB | Q14DN9 | Ankyrin repeat and death domain-containing protein 1B | 3.09e-07 | 7.22e-04 | 9.14e-07 |
| 1. PB | Q8K0L0 | Ankyrin repeat and SOCS box protein 2 | 1.35e-05 | 4.87e-04 | 4.40e-11 |
| 1. PB | A0PJZ0 | Putative ankyrin repeat domain-containing protein 20A5 | 1.38e-10 | 1.94e-09 | 1.76e-47 |
| 1. PB | Q8WXH4 | Ankyrin repeat and SOCS box protein 11 | 5.04e-08 | 2.76e-07 | 1.85e-04 |
| 1. PB | Q8VHS5 | Ankyrin repeat and SOCS box protein 16 | 7.23e-07 | 6.37e-09 | 0.001 |
| 1. PB | Q54KH3 | Ankyrin repeat domain-containing protein 39 homolog | 2.19e-11 | 7.22e-04 | 0.023 |
| 1. PB | Q9Z2X3 | 26S proteasome non-ATPase regulatory subunit 10 | 1.11e-15 | 1.56e-03 | 5.22e-11 |
| 1. PB | P20749 | B-cell lymphoma 3 protein | 1.36e-07 | 6.61e-12 | 1.37e-11 |
| 1. PB | Q63746 | NF-kappa-B inhibitor alpha | 2.05e-09 | 5.95e-10 | 2.06e-04 |
| 1. PB | Q9FNP4 | Phytochrome-interacting ankyrin-repeat protein 2 | 1.98e-06 | 1.09e-04 | 0.008 |
| 1. PB | O75832 | 26S proteasome non-ATPase regulatory subunit 10 | 2.52e-12 | 2.62e-03 | 4.72e-10 |
| 1. PB | Q9CQM6 | Ankyrin repeat domain-containing protein 61 | 3.46e-08 | 2.06e-04 | 0.027 |
| 1. PB | Q4R3S3 | Ankyrin repeat domain-containing protein 7 | 6.48e-13 | 1.07e-13 | 1.28e-51 |
| 1. PB | Q9Z1E3 | NF-kappa-B inhibitor alpha | 2.63e-09 | 6.30e-10 | 7.15e-05 |
| 1. PB | Q17QS6 | Ankyrin repeat and SOCS box protein 5 | 7.72e-09 | 3.19e-05 | 4.37e-06 |
| 1. PB | A6NI47 | Putative POTE ankyrin domain family member M | 1.32e-08 | 9.90e-04 | 2.17e-49 |
| 1. PB | Q7T3X9 | Notch-regulated ankyrin repeat-containing protein B | 5.11e-07 | 1.36e-06 | 0.010 |
| 1. PB | Q7T3Y0 | Notch-regulated ankyrin repeat-containing protein A | 2.69e-07 | 5.96e-06 | 7.82e-04 |
| 1. PB | Q9Y574 | Ankyrin repeat and SOCS box protein 4 | 3.54e-09 | 2.67e-02 | 4.10e-05 |
| 1. PB | Q9D2X0 | Ankyrin repeat domain-containing protein 39 | 2.95e-12 | 1.33e-11 | 4.05e-09 |
| 1. PB | Q9Z2F6 | B-cell lymphoma 3 protein homolog | 6.95e-08 | 6.85e-11 | 2.97e-10 |
| 1. PB | Q55FM5 | Myotrophin homolog | 2.79e-12 | 3.52e-02 | 0.021 |
| 1. PB | Q9HYV6 | Putative ankyrin repeat protein PA3287 | 0.00e+00 | 1.80e-07 | 1.29e-08 |
| 1. PB | Q91ZA8 | Notch-regulated ankyrin repeat-containing protein | 1.64e-08 | 2.06e-05 | 8.12e-04 |
| 1. PB | Q9D119 | Protein phosphatase 1 regulatory subunit 27 | 2.20e-08 | 6.37e-07 | 0.001 |
| 1. PB | Q2TB02 | NF-kappa-B inhibitor delta | 2.80e-07 | 1.47e-02 | 1.36e-04 |
| 1. PB | Q8VHA6 | Ankyrin repeat and SOCS box protein 18 | 6.19e-07 | 1.69e-03 | 1.72e-07 |
| 1. PB | Q91ZT7 | Ankyrin repeat and SOCS box protein 10 | 7.57e-08 | 5.87e-09 | 1.79e-09 |
| 1. PB | Q4UMP3 | Putative ankyrin repeat protein RF_0314 | 3.67e-04 | 8.58e-05 | 1.12e-05 |
| 1. PB | Q6S545 | POTE ankyrin domain family member H | 2.69e-08 | 2.01e-03 | 1.09e-48 |
| 1. PB | P55273 | Cyclin-dependent kinase 4 inhibitor D | 0.00e+00 | 2.17e-06 | 2.13e-06 |
| 1. PB | P18954 | Protein PhlB | 2.62e-10 | 6.06e-04 | 7.33e-07 |
| 1. PB | Q1RK83 | Putative ankyrin repeat protein RBE_0150 | 3.10e-11 | 8.45e-03 | 1.27e-04 |
| 1. PB | Q9HFE7 | Ankyrin repeat-containing protein P16F5.05c | 5.81e-10 | 1.64e-05 | 0.002 |
| 1. PB | Q7Z6K4 | Notch-regulated ankyrin repeat-containing protein | 2.09e-08 | 2.06e-05 | 8.12e-04 |
| 1. PB | Q978J0 | Putative ankyrin repeat protein TV1425 | 0.00e+00 | 2.09e-04 | 1.71e-09 |
| 1. PB | Q6ZVZ8 | Ankyrin repeat and SOCS box protein 18 | 7.44e-07 | 3.59e-03 | 0.007 |
| 1. PB | Q91ZT8 | Ankyrin repeat and SOCS box protein 9 | 3.22e-08 | 3.23e-04 | 4.31e-06 |
| 1. PB | Q8NI38 | NF-kappa-B inhibitor delta | 2.81e-07 | 1.09e-03 | 2.06e-04 |
| 1. PB | Q8WXI3 | Ankyrin repeat and SOCS box protein 10 | 2.39e-07 | 1.97e-09 | 1.20e-07 |
| 1. PB | Q29RV0 | Cyclin-dependent kinase 4 inhibitor D | 1.11e-16 | 1.51e-05 | 7.32e-07 |
| 1. PB | Q9HLN1 | Putative ankyrin repeat protein Ta0196 | 3.28e-11 | 1.57e-12 | 7.82e-10 |
| 1. PB | B0G124 | Ankyrin repeat-containing protein DDB_G0279043 | 1.93e-10 | 2.77e-05 | 7.88e-09 |
| 1. PB | Q91974 | NF-kappa-B inhibitor alpha | 1.37e-08 | 1.23e-06 | 1.39e-07 |
| 1. PB | P25963 | NF-kappa-B inhibitor alpha | 4.30e-07 | 7.04e-13 | 1.05e-06 |
| 1. PB | P0C927 | Ankyrin repeat and SOCS box protein 14 | 1.82e-07 | 8.79e-04 | 2.91e-04 |
| 1. PB | Q9CQ31 | Ankyrin repeat and SOCS box protein 11 | 8.43e-09 | 3.98e-06 | 2.85e-05 |
| 1. PB | Q1RK82 | Putative ankyrin repeat protein RBE_0151 | 4.04e-07 | 1.62e-05 | 0.024 |
| 1. PB | Q5U5A6 | Notch-regulated ankyrin repeat-containing protein | 7.56e-09 | 7.62e-07 | 7.66e-04 |
| 1. PB | Q96NS5 | Ankyrin repeat and SOCS box protein 16 | 9.12e-07 | 8.71e-08 | 0.021 |
| 1. PB | Q60778 | NF-kappa-B inhibitor beta | 9.90e-07 | 5.61e-03 | 0.007 |
| 1. PB | P46683 | Ankyrin repeat-containing protein YAR1 | 1.08e-08 | 2.68e-06 | 0.004 |
| 1. PB | Q96Q27 | Ankyrin repeat and SOCS box protein 2 | 3.06e-06 | 9.01e-06 | 1.69e-13 |
| 1. PB | Q86WC6 | Protein phosphatase 1 regulatory subunit 27 | 5.73e-08 | 3.02e-07 | 3.23e-04 |
| 1. PB | Q3SZE4 | Ankyrin repeat and SOCS box protein 11 | 7.62e-09 | 2.96e-09 | 7.75e-06 |
| 1. PB | Q96DX5 | Ankyrin repeat and SOCS box protein 9 | 1.71e-08 | 7.60e-06 | 5.29e-07 |
| 1. PB | Q4UKI1 | Putative ankyrin repeat protein RF_1099 | 9.72e-08 | 8.45e-03 | 0.030 |
| 1. PB | A7E2S9 | Putative ankyrin repeat domain-containing protein 30B-like | 0 | 1.80e-164 | 0.0 |
| 1. PB | Q8WVL7 | Ankyrin repeat domain-containing protein 49 | 1.10e-08 | 1.15e-02 | 1.26e-04 |
| 1. PB | Q9FF09 | Phytochrome-interacting ankyrin-repeat protein 1 | 1.98e-06 | 1.77e-03 | 0.002 |
| 1. PB | Q8VE42 | Ankyrin repeat domain-containing protein 49 | 1.22e-07 | 9.80e-04 | 4.25e-05 |
| 2. P | Q5EFR1 | I-Kappa-B like protein I1 | NA | 1.56e-02 | NA |
| 2. P | A6NGH8 | Ankyrin repeat domain-containing protein 61 | 6.09e-08 | 6.29e-05 | NA |
| 2. P | Q5I159 | I-Kappa-B like protein C2 | NA | 6.82e-03 | NA |
| 2. P | Q5UPB2 | Putative ankyrin repeat protein L38 | NA | 3.13e-03 | NA |
| 2. P | Q5I144 | I-Kappa-B like protein H1 | NA | 3.77e-07 | NA |
| 2. P | P51480 | Cyclin-dependent kinase inhibitor 2A | 1.31e-05 | 4.75e-03 | NA |
| 2. P | A6NJG2 | Ankyrin repeat domain-containing protein SOWAHD | 4.59e-05 | 6.92e-04 | NA |
| 2. P | Q5I140 | I-Kappa-B like protein J1 | NA | 6.29e-05 | NA |
| 2. P | Q5I126 | I-kappa-B like protein N2 | NA | 4.34e-07 | NA |
| 2. P | Q4ULD9 | Putative ankyrin repeat protein RF_0783 | 6.36e-08 | 2.94e-03 | NA |
| 2. P | Q810N6 | Ankyrin repeat domain-containing protein 45 | 1.28e-06 | 4.93e-07 | NA |
| 2. P | Q5I160 | I-Kappa-B like protein C1 | NA | 4.52e-13 | NA |
| 2. P | Q95LR4 | Ankyrin repeat and SOCS box protein 17 | 6.77e-03 | 1.58e-02 | NA |
| 2. P | Q8BY98 | Ankyrin repeat domain-containing protein SOWAHD | 1.00e-04 | 3.72e-05 | NA |
| 2. P | Q9P7I0 | Ankyrin repeat-containing protein C105.02c | 3.09e-05 | 4.95e-03 | NA |
| 2. P | P09959 | Regulatory protein SWI6 | 9.93e-03 | 1.99e-02 | NA |
| 2. P | Q8WXK4 | Ankyrin repeat and SOCS box protein 12 | 5.60e-10 | 1.39e-05 | NA |
| 2. P | Q5I125 | I-Kappa-B like protein N3 | NA | 1.87e-03 | NA |
| 2. P | Q1RIW0 | Putative ankyrin repeat protein RBE_0623 | 1.12e-04 | 3.70e-03 | NA |
| 2. P | Q5I155 | I-Kappa-B like protein F2 | NA | 3.16e-02 | NA |
| 2. P | Q96BM1 | Ankyrin repeat domain-containing protein 9 | 1.38e-06 | 5.44e-03 | NA |
| 2. P | P0C965 | IkB-like protein | NA | 1.26e-06 | NA |
| 2. P | O36972 | IkB-like protein | NA | 3.26e-06 | NA |
| 2. P | Q641X1 | Ankyrin repeat domain-containing protein 61 | 6.94e-07 | 1.49e-05 | NA |
| 2. P | O51360 | Putative ankyrin repeat protein BB_0399 | 5.22e-08 | 4.80e-02 | NA |
| 2. P | P42771 | Cyclin-dependent kinase inhibitor 2A | 6.87e-11 | 4.98e-05 | NA |
| 2. P | Q2T9W8 | Ankyrin repeat domain-containing protein 61 | 1.32e-07 | 1.51e-05 | NA |
| 2. P | Q76U48 | IkB-like protein | NA | 1.31e-04 | NA |
| 2. P | Q4UKJ5 | Putative ankyrin repeat protein RF_1081 | 1.03e-03 | 3.88e-02 | NA |
| 2. P | Q5I149 | I-Kappa-B like protein G1 | NA | 1.38e-12 | NA |
| 2. P | Q5TZF3 | Ankyrin repeat domain-containing protein 45 | 3.36e-06 | 3.16e-03 | NA |
| 2. P | Q1RJ94 | Putative ankyrin repeat protein RBE_0489 | 3.54e-06 | 1.54e-03 | NA |
| 2. P | Q5I148 | I-Kappa-B like protein G2 | NA | 2.67e-04 | NA |
| 2. P | Q8BH83 | Ankyrin repeat domain-containing protein 9 | 1.44e-06 | 1.17e-04 | NA |
| 2. P | P0C966 | IkB-like protein | NA | 5.47e-06 | NA |
| 2. P | Q8VHP9 | Ankyrin repeat and SOCS box protein 17 | 6.09e-03 | 4.84e-02 | NA |
| 2. P | P0C964 | IkB-like protein | NA | 1.16e-05 | NA |
| 2. P | Q5I156 | I-Kappa-B like protein F1 | NA | 1.94e-07 | NA |
| 2. P | P53066 | Ankyrin repeat-containing protein YGL242C | 5.70e-05 | 1.37e-04 | NA |
| 2. P | P42772 | Cyclin-dependent kinase 4 inhibitor B | 2.91e-12 | 1.55e-02 | NA |
| 2. P | Q5UNX2 | Putative ankyrin repeat protein L715 | NA | 2.09e-04 | NA |
| 3. B | Q7TQI7 | Ankyrin repeat and BTB/POZ domain-containing protein 2 | 9.72e-04 | NA | 0.004 |
| 3. B | Q8N9V6 | Ankyrin repeat domain-containing protein 53 | 9.96e-06 | NA | 9.21e-05 |
| 3. B | Q8BX02 | KN motif and ankyrin repeat domain-containing protein 2 | 5.88e-04 | NA | 1.06e-04 |
| 3. B | Q8VHS6 | Ankyrin repeat and SOCS box protein 15 | 5.50e-07 | NA | 0.003 |
| 3. B | Q5URB9 | Putative ankyrin repeat protein R840 | NA | NA | 7.59e-05 |
| 3. B | Q5UPD5 | Putative ankyrin repeat protein L59 | NA | NA | 0.002 |
| 3. B | P20632 | Interferon antagonist K1L | NA | NA | 9.51e-05 |
| 3. B | Q1RGM2 | Putative ankyrin repeat protein RBE_1411 | 4.47e-06 | NA | 0.003 |
| 3. B | Q9J5H9 | Putative ankyrin repeat protein FPV022 | NA | NA | 1.56e-08 |
| 3. B | Q8IUH5 | Palmitoyltransferase ZDHHC17 | 7.27e-06 | NA | 1.70e-11 |
| 3. B | Q54KA7 | Ankyrin repeat, PH and SEC7 domain containing protein secG | 8.27e-04 | NA | 2.25e-20 |
| 3. B | Q0V8G2 | GA-binding protein subunit beta-2 | 5.66e-07 | NA | 1.27e-04 |
| 3. B | P59672 | Ankyrin repeat and SAM domain-containing protein 1A | 5.78e-04 | NA | 2.31e-06 |
| 3. B | Q6AFL2 | Putative ankyrin-containing lipoprotein Lxx09580 | 3.25e-11 | NA | 2.87e-04 |
| 3. B | O14974 | Protein phosphatase 1 regulatory subunit 12A | 2.39e-04 | NA | 0.010 |
| 3. B | Q99NH0 | Ankyrin repeat domain-containing protein 17 | 7.03e-02 | NA | 1.49e-13 |
| 3. B | Q2QL84 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.71e-06 | NA | 1.75e-06 |
| 3. B | A9JR78 | Tonsoku-like protein | 1.22e-02 | NA | 7.03e-07 |
| 3. B | P57078 | Receptor-interacting serine/threonine-protein kinase 4 | 1.59e-08 | NA | 9.00e-08 |
| 3. B | Q6P9J5 | KN motif and ankyrin repeat domain-containing protein 4 | 3.83e-03 | NA | 4.36e-05 |
| 3. B | Q499M5 | Ankyrin repeat domain-containing protein 16 | 8.77e-12 | NA | 0.002 |
| 3. B | Q2QLB5 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.20e-07 | NA | 4.80e-07 |
| 3. B | Q1LZC5 | Ankyrin repeat domain-containing protein 54 | 5.77e-07 | NA | 5.95e-09 |
| 3. B | Q9Y575 | Ankyrin repeat and SOCS box protein 3 | 8.63e-11 | NA | 2.15e-06 |
| 3. B | P0C6P7 | Protein fem-1 homolog B | 6.62e-08 | NA | 7.03e-07 |
| 3. B | Q8CEF1 | Protein fem-1 homolog C | 1.08e-07 | NA | 6.25e-11 |
| 3. B | Q4FE45 | E3 ubiquitin-protein ligase XBAT33 | 1.24e-10 | NA | 0.001 |
| 3. B | Q9J5H8 | Putative ankyrin repeat protein FPV023 | NA | NA | 3.20e-11 |
| 3. B | D3J162 | Protein VAPYRIN | 2.50e-06 | NA | 5.76e-06 |
| 3. B | Q4UJ75 | Putative ankyrin repeat domain-containing protein 20A4 | 1.37e-05 | NA | 7.08e-56 |
| 3. B | Q06527 | Ankyrin homolog | 7.00e-11 | NA | 8.12e-11 |
| 3. B | Q9UM47 | Neurogenic locus notch homolog protein 3 | 6.42e-02 | NA | 1.15e-10 |
| 3. B | Q8N7Z5 | Ankyrin repeat domain-containing protein 31 | 6.09e-02 | NA | 0.018 |
| 3. B | Q01317 | Ankyrin repeat protein nuc-2 | 5.20e-03 | NA | 0.038 |
| 3. B | P14585 | Protein lin-12 | 5.25e-03 | NA | 3.81e-05 |
| 3. B | O14593 | DNA-binding protein RFXANK | 1.85e-09 | NA | 3.13e-13 |
| 3. B | Q8LSQ2 | Probable signal recognition particle 43 kDa protein, chloroplastic | 3.02e-04 | NA | 9.44e-05 |
| 3. B | Q99466 | Neurogenic locus notch homolog protein 4 | 1.92e-02 | NA | 1.34e-07 |
| 3. B | Q07E41 | Cortactin-binding protein 2 | 1.50e-02 | NA | 2.39e-10 |
| 3. B | Q00PJ3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 9.98e-08 | NA | 2.51e-06 |
| 3. B | P62774 | Myotrophin | 2.37e-12 | NA | 0.006 |
| 3. B | Q8K4M9 | Oxysterol-binding protein-related protein 1 | 3.40e-04 | NA | 0.019 |
| 3. B | P97819 | 85/88 kDa calcium-independent phospholipase A2 | 9.12e-05 | NA | 4.07e-10 |
| 3. B | Q02357 | Ankyrin-1 | 5.46e-03 | NA | 1.55e-09 |
| 3. B | O44997 | Death-associated protein kinase dapk-1 | 1.77e-03 | NA | 6.96e-11 |
| 3. B | P41412 | Cell division cycle-related protein res2/pct1 | 2.19e-04 | NA | 1.52e-04 |
| 3. B | Q2QLC6 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.49e-07 | NA | 7.45e-06 |
| 3. B | Q4ULZ2 | Putative ankyrin repeat protein RF_0580 | 4.67e-10 | NA | 1.14e-10 |
| 3. B | Q5D0W8 | BTB/POZ domain and ankyrin repeat-containing protein NPR1 | 9.47e-04 | NA | 0.007 |
| 3. B | Q8N8A2 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B | 4.43e-05 | NA | 1.27e-12 |
| 3. B | Q9NU02 | Ankyrin repeat and EF-hand domain-containing protein 1 | 6.35e-04 | NA | 5.34e-08 |
| 3. B | Q29RM5 | Protein fem-1 homolog A | 2.71e-05 | NA | 7.95e-10 |
| 3. B | Q9ZU96 | Ankyrin repeat-containing protein At2g01680 | 3.83e-07 | NA | 1.43e-05 |
| 3. B | Q5TYM7 | CARD- and ANK-domain containing inflammasome adapter protein | 1.16e-06 | NA | 5.61e-07 |
| 3. B | B2FKA7 | Actin-binding protein Smlt3054 | 1.17e-06 | NA | 6.65e-06 |
| 3. B | Q5U312 | Ankycorbin | 1.25e-04 | NA | 1.67e-10 |
| 3. B | Q21920 | Ankyrin repeat and KH domain-containing protein mask-1 | 7.31e-02 | NA | 9.01e-06 |
| 3. B | Q65XV2 | E3 ubiquitin-protein ligase XB3 | 1.06e-06 | NA | 2.54e-04 |
| 3. B | Q5R6D7 | Ankyrin repeat and SOCS box protein 8 | 2.16e-09 | NA | 3.70e-12 |
| 3. B | S0DPL8 | Apicidin F cluster transcription factor apf2 | 2.02e-06 | NA | 1.26e-07 |
| 3. B | A1ZBY1 | Protein fem-1 homolog B | 3.27e-06 | NA | 5.52e-08 |
| 3. B | Q554E7 | Putative ZDHHC-type palmitoyltransferase 5 | 1.60e-05 | NA | 7.93e-08 |
| 3. B | A6QL64 | Ankyrin repeat domain-containing protein 36A | 9.59e-03 | NA | 1.94e-45 |
| 3. B | Q9VUX2 | E3 ubiquitin-protein ligase mind-bomb | 1.56e-03 | NA | 1.64e-09 |
| 3. B | Q4JHE0 | Probable E3 ubiquitin-protein ligase XBOS36 | 4.24e-07 | NA | 2.15e-05 |
| 3. B | P53356 | Tyrosine-protein kinase HTK16 | 1.00e-04 | NA | 1.70e-06 |
| 3. B | Q9SQK3 | Ankyrin repeat domain-containing protein EMB506, chloroplastic | 4.85e-07 | NA | 5.78e-12 |
| 3. B | Q7T0Q1 | Myotrophin | 4.00e-12 | NA | 5.74e-05 |
| 3. B | Q6P6B7 | Ankyrin repeat domain-containing protein 16 | 4.32e-08 | NA | 3.16e-06 |
| 3. B | A2AQH4 | BCL-6 corepressor-like protein 1 | 1.88e-01 | NA | 8.21e-04 |
| 3. B | O70511 | Ankyrin-3 | 6.17e-02 | NA | 9.23e-13 |
| 3. B | Q5R8C8 | Ankyrin repeat domain-containing protein 46 | 3.19e-08 | NA | 1.66e-04 |
| 3. B | Q3U0D9 | E3 ubiquitin-protein ligase HACE1 | 2.26e-05 | NA | 1.25e-07 |
| 3. B | Q90623 | Protein phosphatase 1 regulatory subunit 12A | 4.49e-04 | NA | 0.003 |
| 3. B | Q9TXQ1 | Poly [ADP-ribose] polymerase tankyrase | 2.61e-02 | NA | 3.08e-05 |
| 3. B | Q7Z8U2 | Palmitoyltransferase akr1 | 8.18e-06 | NA | 1.36e-12 |
| 3. B | Q5UPE2 | Putative ankyrin repeat protein L63 | NA | NA | 4.06e-06 |
| 3. B | Q7T163 | Kinase D-interacting substrate of 220 kDa B | 5.69e-03 | NA | 3.74e-15 |
| 3. B | Q68DC2 | Ankyrin repeat and SAM domain-containing protein 6 | 2.64e-04 | NA | 5.24e-08 |
| 3. B | Q9J505 | Putative ankyrin repeat protein FPV230 | NA | NA | 0.012 |
| 3. B | A1X154 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.94e-06 | NA | 1.83e-04 |
| 3. B | Q7XUW4 | Potassium channel KOR2 | 2.37e-05 | NA | 4.38e-05 |
| 3. B | Q6RI86 | Transient receptor potential cation channel subfamily A member 1 | 1.31e-03 | NA | 1.21e-06 |
| 3. B | Q1RMI3 | GA-binding protein subunit beta-1 | 1.16e-08 | NA | 3.54e-05 |
| 3. B | Q9WV48 | SH3 and multiple ankyrin repeat domains protein 1 | 4.86e-02 | NA | 0.002 |
| 3. B | Q8N2N9 | Ankyrin repeat domain-containing protein 36B | 9.14e-04 | NA | 5.32e-48 |
| 3. B | Q6BP80 | Palmitoyltransferase AKR1 | 4.47e-06 | NA | 0.007 |
| 3. B | Q63369 | Nuclear factor NF-kappa-B p105 subunit (Fragment) | 6.56e-06 | NA | 0.002 |
| 3. B | D3J163 | Protein VAPYRIN-LIKE | 7.78e-07 | NA | 0.007 |
| 3. B | Q10311 | Ankyrin repeat-containing protein C6C3.08 | 1.97e-11 | NA | 2.06e-08 |
| 3. B | Q07DW4 | Cortactin-binding protein 2 | 1.06e-02 | NA | 9.61e-11 |
| 3. B | A5A3E0 | POTE ankyrin domain family member F | 8.80e-05 | NA | 2.24e-47 |
| 3. B | A2A690 | Protein TANC2 | 9.17e-03 | NA | 3.58e-10 |
| 3. B | Q6KAE5 | Probable E3 ubiquitin-protein ligase XBOS32 | 2.43e-10 | NA | 0.006 |
| 3. B | Q38898 | Potassium channel AKT2/3 | 5.23e-04 | NA | 0.001 |
| 3. B | Q1RJM6 | Putative ankyrin repeat protein RBE_0357 | 2.65e-04 | NA | 6.96e-04 |
| 3. B | Q8CGN4 | BCL-6 corepressor | 2.76e-01 | NA | 0.012 |
| 3. B | Q61982 | Neurogenic locus notch homolog protein 3 | 6.86e-02 | NA | 5.74e-11 |
| 3. B | Q7T3P8 | Protein fem-1 homolog C | 1.15e-07 | NA | 1.13e-11 |
| 3. B | Q80UP3 | Diacylglycerol kinase zeta | 6.35e-03 | NA | 0.002 |
| 3. B | Q5UPX1 | Putative ankyrin repeat protein L289 | NA | NA | 0.001 |
| 3. B | P17221 | Sex-determining protein fem-1 | 6.84e-06 | NA | 3.04e-06 |
| 3. B | Q8BXP5 | Photoreceptor ankyrin repeat protein | 1.44e-06 | NA | 1.04e-06 |
| 3. B | O83515 | Putative ankyrin repeat-containing protein TP_0502 | 1.65e-11 | NA | 8.28e-05 |
| 3. B | A7MB89 | Protein fem-1 homolog C | 1.19e-07 | NA | 5.81e-11 |
| 3. B | Q9WTT2 | Caseinolytic peptidase B protein homolog | 3.24e-03 | NA | 2.87e-05 |
| 3. B | Q80T11 | Usher syndrome type-1G protein homolog | 2.69e-05 | NA | 6.88e-08 |
| 3. B | Q9D2J7 | Ankyrin repeat and EF-hand domain-containing protein 1 | 8.93e-07 | NA | 0.001 |
| 3. B | Q5UQF1 | Putative ankyrin repeat protein L483 | NA | NA | 0.006 |
| 3. B | Q9H2K2 | Poly [ADP-ribose] polymerase tankyrase-2 | 8.86e-04 | NA | 4.23e-06 |
| 3. B | Q9D061 | Acyl-CoA-binding domain-containing protein 6 | 1.30e-06 | NA | 4.10e-09 |
| 3. B | Q9BXX2 | Ankyrin repeat domain-containing protein 30B | 1.06e-03 | NA | 1.02e-113 |
| 3. B | Q06547 | GA-binding protein subunit beta-1 | 9.86e-08 | NA | 6.75e-05 |
| 3. B | A6NHY2 | Ankyrin repeat and death domain-containing protein 1B | 3.15e-07 | NA | 6.74e-08 |
| 3. B | Q5RCK5 | Ankyrin repeat and SOCS box protein 7 | 1.74e-10 | NA | 9.62e-06 |
| 3. B | Q8UVC1 | Inversin | 3.15e-04 | NA | 2.81e-13 |
| 3. B | Q5SQ80 | Putative ankyrin repeat domain-containing protein 20A2 | 1.74e-05 | NA | 3.36e-56 |
| 3. B | Q2IBD4 | Cortactin-binding protein 2 | 8.85e-03 | NA | 6.20e-09 |
| 3. B | P0CG39 | POTE ankyrin domain family member J | 1.61e-04 | NA | 1.40e-46 |
| 3. B | P46530 | Neurogenic locus notch homolog protein 1 | 7.93e-02 | NA | 1.86e-11 |
| 3. B | Q6TGW5 | Osteoclast-stimulating factor 1 | 1.94e-07 | NA | 6.12e-05 |
| 3. B | Q2IBE3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.48e-07 | NA | 2.09e-06 |
| 3. B | Q63618 | Espin | 1.58e-04 | NA | 7.58e-05 |
| 3. B | Q1RIZ4 | Putative ankyrin repeat protein RBE_0589 | 1.25e-08 | NA | 0.004 |
| 3. B | B9EJA2 | Cortactin-binding protein 2 | 1.02e-02 | NA | 4.45e-09 |
| 3. B | Q8MJ50 | Osteoclast-stimulating factor 1 | 6.02e-07 | NA | 0.037 |
| 3. B | Q8CGB3 | Uveal autoantigen with coiled-coil domains and ankyrin repeats | 6.47e-04 | NA | 1.31e-08 |
| 3. B | Q8IWB6 | Inactive serine/threonine-protein kinase TEX14 | 1.08e-01 | NA | 3.45e-08 |
| 3. B | Q3UES3 | Poly [ADP-ribose] polymerase tankyrase-2 | 6.10e-04 | NA | 4.36e-08 |
| 3. B | A5WVX9 | Palmitoyltransferase ZDHHC17 | 5.40e-06 | NA | 5.27e-12 |
| 3. B | Q9J504 | Putative ankyrin repeat protein FPV231 | NA | NA | 1.83e-15 |
| 3. B | Q91ZT9 | Ankyrin repeat and SOCS box protein 8 | 2.13e-08 | NA | 4.49e-12 |
| 3. B | Q6W2J9 | BCL-6 corepressor | 3.58e-01 | NA | 0.012 |
| 3. B | Q9Y2G4 | Ankyrin repeat domain-containing protein 6 | 6.12e-07 | NA | 1.07e-14 |
| 3. B | Q58CT0 | Dynein axonemal heavy chain 12 | 3.38e-06 | NA | 0.012 |
| 3. B | F1LTE0 | Protein TANC2 | 8.15e-03 | NA | 3.75e-10 |
| 3. B | O08764 | Ankyrin repeat and BTB/POZ domain-containing protein 2 | 1.01e-03 | NA | 0.006 |
| 3. B | B1AK53 | Espin | 1.57e-04 | NA | 4.85e-05 |
| 3. B | Q495M9 | Usher syndrome type-1G protein | 9.25e-05 | NA | 6.04e-08 |
| 3. B | Q9ERC1 | Unconventional myosin-XVI | 1.97e-02 | NA | 0.036 |
| 3. B | Q9P2R3 | Rabankyrin-5 | 1.19e-03 | NA | 3.85e-07 |
| 3. B | Q8BZ25 | Ankyrin repeat and protein kinase domain-containing protein 1 | 1.11e-05 | NA | 6.68e-14 |
| 3. B | Q8UVC3 | Inversin | 4.61e-04 | NA | 7.89e-13 |
| 3. B | P13508 | Protein glp-1 | 2.73e-03 | NA | 2.99e-04 |
| 3. B | Q9SCX5 | Probable potassium channel AKT5 | 2.87e-04 | NA | 6.60e-10 |
| 3. B | Q2QLG0 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 7.26e-07 | NA | 3.27e-07 |
| 3. B | Q05823 | 2-5A-dependent ribonuclease | 9.57e-05 | NA | 1.35e-05 |
| 3. B | P57044 | Integrin-linked protein kinase | 8.38e-08 | NA | 3.06e-09 |
| 3. B | Q8ZWC4 | Putative ankyrin repeat protein PAE1861 | 1.10e-09 | NA | 4.11e-08 |
| 3. B | Q91XL9 | Oxysterol-binding protein-related protein 1 | 3.00e-04 | NA | 0.011 |
| 3. B | O54910 | NF-kappa-B inhibitor epsilon | 4.63e-08 | NA | 3.79e-06 |
| 3. B | Q75HP9 | Potassium channel AKT2 | 2.22e-03 | NA | 1.77e-05 |
| 3. B | Q4X251 | Palmitoyltransferase akr1 | 7.21e-06 | NA | 1.76e-12 |
| 3. B | Q8WMX7 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.95e-06 | NA | 7.66e-07 |
| 3. B | Q12013 | Probable palmitoyltransferase AKR2 | 1.06e-04 | NA | 8.48e-05 |
| 3. B | Q08E43 | Ankyrin repeat and SOCS box protein 8 | 2.64e-08 | NA | 3.74e-12 |
| 3. B | Q5UPG6 | Putative ankyrin repeat protein L92 | NA | NA | 6.19e-05 |
| 3. B | Q8VBX0 | Ankyrin repeat and SOCS box protein 13 | 1.59e-10 | NA | 5.30e-09 |
| 3. B | B7WN72 | Protein shank | 2.59e-03 | NA | 6.32e-05 |
| 3. B | Q9Z205 | DNA-binding protein RFXANK | 1.68e-08 | NA | 2.09e-11 |
| 3. B | Q14678 | KN motif and ankyrin repeat domain-containing protein 1 | 7.19e-03 | NA | 1.33e-06 |
| 3. B | Q9BXW6 | Oxysterol-binding protein-related protein 1 | 3.35e-04 | NA | 0.037 |
| 3. B | Q00653 | Nuclear factor NF-kappa-B p100 subunit | 3.05e-04 | NA | 3.57e-05 |
| 3. B | Q5ZLC8 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 6.38e-04 | NA | 8.14e-09 |
| 3. B | Q9ULT8 | E3 ubiquitin-protein ligase HECTD1 | 2.11e-01 | NA | 0.003 |
| 3. B | Q68LP1 | E3 ubiquitin-protein ligase MIB2 | 1.71e-05 | NA | 3.58e-06 |
| 3. B | Q01484 | Ankyrin-2 | NA | NA | 6.51e-11 |
| 3. B | Q9UK73 | Protein fem-1 homolog B | 7.94e-08 | NA | 6.66e-07 |
| 3. B | Q2QLH1 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.38e-07 | NA | 4.98e-07 |
| 3. B | F8W2M1 | E3 ubiquitin-protein ligase HACE1 | 2.05e-06 | NA | 3.87e-06 |
| 3. B | Q9WV71 | Ankyrin repeat and SOCS box protein 4 | 3.88e-09 | NA | 1.24e-04 |
| 3. B | Q4R739 | Ankyrin repeat domain-containing protein 53 | 2.78e-06 | NA | 4.92e-04 |
| 3. B | Q9J513 | Putative ankyrin repeat protein FPV222 | NA | NA | 1.08e-09 |
| 3. B | Q9DBR7 | Protein phosphatase 1 regulatory subunit 12A | 5.99e-04 | NA | 0.017 |
| 3. B | Q9U518 | L-asparaginase | 6.22e-06 | NA | 1.13e-06 |
| 3. B | Q9Y283 | Inversin | 4.63e-04 | NA | 3.62e-12 |
| 3. B | Q9J512 | Putative ankyrin repeat protein FPV223 | NA | NA | 0.001 |
| 3. B | Q495B1 | Ankyrin repeat and death domain-containing protein 1A | 1.88e-09 | NA | 3.50e-12 |
| 3. B | Q9M8S6 | Potassium channel SKOR | 2.87e-04 | NA | 1.37e-05 |
| 3. B | Q9ULH0 | Kinase D-interacting substrate of 220 kDa | 5.19e-04 | NA | 1.84e-16 |
| 3. B | G3I6Z6 | Neurogenic locus notch homolog protein 1 | NA | NA | 1.18e-10 |
| 3. B | Q5XJ13 | Ankyrin repeat and SAM domain-containing protein 6 | 1.78e-04 | NA | 2.48e-06 |
| 3. B | Q9BGT9 | Ankyrin repeat and SOCS box protein 7 | 1.71e-10 | NA | 9.70e-06 |
| 3. B | P14360 | Putative ankyrin repeat protein FPV240 | NA | NA | 5.27e-06 |
| 3. B | O70445 | BRCA1-associated RING domain protein 1 | 5.72e-04 | NA | 2.49e-05 |
| 3. B | Q4UKJ3 | Putative ankyrin repeat protein RF_1087 | 1.70e-06 | NA | 0.008 |
| 3. B | Q3U0L2 | Ankyrin repeat domain-containing protein 33B | 2.00e-05 | NA | 0.004 |
| 3. B | Q09YK6 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.15e-06 | NA | 7.00e-07 |
| 3. B | Q86SG2 | Ankyrin repeat domain-containing protein 23 | 2.03e-11 | NA | 2.70e-14 |
| 3. B | Q5UPG5 | Putative ankyrin repeat protein L93 | NA | NA | 6.74e-14 |
| 3. B | Q9J502 | Putative ankyrin repeat protein FPV233 | NA | NA | 2.02e-09 |
| 3. B | Q9WV72 | Ankyrin repeat and SOCS box protein 3 | 4.97e-11 | NA | 2.65e-06 |
| 3. B | Q876L4 | Probable palmitoyltransferase AKR2 | 5.34e-05 | NA | 4.56e-05 |
| 3. B | Q80SY4 | E3 ubiquitin-protein ligase MIB1 | 2.72e-04 | NA | 3.80e-11 |
| 3. B | Q876L5 | Palmitoyltransferase AKR1 | 2.71e-05 | NA | 2.44e-07 |
| 3. B | Q4I8B6 | Palmitoyltransferase AKR1 | 2.58e-05 | NA | 1.25e-10 |
| 3. B | P16157 | Ankyrin-1 | 4.69e-03 | NA | 3.80e-10 |
| 3. B | Q5VUR7 | Putative ankyrin repeat domain-containing protein 20A3 | 6.23e-05 | NA | 3.10e-56 |
| 3. B | O88202 | 60 kDa lysophospholipase | 3.36e-07 | NA | 1.52e-07 |
| 3. B | Q502M6 | Ankyrin repeat domain-containing protein 29 | 9.34e-11 | NA | 4.72e-09 |
| 3. B | Q337A0 | Probable E3 ubiquitin-protein ligase XBOS33 | 8.79e-06 | NA | 3.78e-04 |
| 3. B | Q6S8J3 | POTE ankyrin domain family member E | 3.50e-05 | NA | 1.60e-47 |
| 3. B | Q0VGY8 | Protein TANC1 | 2.06e-03 | NA | 2.71e-11 |
| 3. B | P0C0T2 | Ankyrin repeat and SAM domain-containing protein 6 | 4.01e-04 | NA | 4.36e-10 |
| 3. B | O95271 | Poly [ADP-ribose] polymerase tankyrase-1 | 2.29e-03 | NA | 1.59e-07 |
| 3. B | G0LXV8 | Alpha-latrotoxin-Lh1a (Fragment) | 2.26e-03 | NA | 2.05e-07 |
| 3. B | Q15027 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 | 5.47e-03 | NA | 0.041 |
| 3. B | Q9Y566 | SH3 and multiple ankyrin repeat domains protein 1 | 7.10e-02 | NA | 5.87e-04 |
| 3. B | Q653P0 | Potassium channel KOR1 | 5.43e-04 | NA | 1.08e-05 |
| 3. B | Q6PFX9 | Poly [ADP-ribose] polymerase tankyrase-1 | 3.02e-03 | NA | 1.50e-07 |
| 3. B | Q2IBG0 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 4.73e-07 | NA | 4.83e-06 |
| 3. B | Q9J5I3 | Putative ankyrin repeat protein FPV018 | NA | NA | 1.26e-05 |
| 3. B | Q94B55 | Putative E3 ubiquitin-protein ligase XBAT31 | 1.55e-08 | NA | 8.85e-08 |
| 3. B | Q6P1S6 | Myotrophin | 2.23e-11 | NA | 0.001 |
| 3. B | C7B178 | Protein VAPYRIN | 2.39e-07 | NA | 1.29e-05 |
| 3. B | Q5R4M7 | Ankyrin repeat and SOCS box protein 6 | 1.66e-07 | NA | 0.003 |
| 3. B | Q875M2 | Palmitoyltransferase AKR1 | 2.45e-05 | NA | 6.98e-08 |
| 3. B | Q71S21 | Inversin-B | 1.86e-04 | NA | 2.31e-12 |
| 3. B | Q8VHK2 | Caskin-1 | 2.66e-03 | NA | 6.48e-07 |
| 3. B | Q9R172 | Neurogenic locus notch homolog protein 3 | 7.02e-02 | NA | 4.31e-11 |
| 3. B | Q29Q26 | Ankyrin repeat domain-containing protein 2B | 7.33e-06 | NA | 4.08e-05 |
| 3. B | Q5JPF3 | Ankyrin repeat domain-containing protein 36C | 4.30e-03 | NA | 1.44e-44 |
| 3. B | Q4P6L3 | Palmitoyltransferase AKR1 | 6.07e-05 | NA | 8.01e-08 |
| 3. B | Q9P0K7 | Ankycorbin | 1.08e-04 | NA | 2.34e-12 |
| 3. B | Q6DGX3 | Ankyrin repeat domain-containing protein 54 | 2.56e-06 | NA | 2.46e-07 |
| 3. B | Q3V096 | Ankyrin repeat domain-containing protein 42 | 1.39e-07 | NA | 7.14e-04 |
| 3. B | O13987 | Ankyrin and IPT/TIG repeat-containing protein C26H5.05 | 1.06e-01 | NA | 0.019 |
| 3. B | Q7Z020 | Transient receptor potential cation channel subfamily A member 1 | 4.12e-04 | NA | 0.033 |
| 3. B | Q96AX9 | E3 ubiquitin-protein ligase MIB2 | 2.93e-05 | NA | 1.59e-06 |
| 3. B | A0A3L7I2I8 | 85/88 kDa calcium-independent phospholipase A2 | 3.98e-04 | NA | 3.29e-10 |
| 3. B | Q5UPH0 | Putative ankyrin repeat protein L100 | NA | NA | 0.019 |
| 3. B | Q86YR6 | POTE ankyrin domain family member D | 6.19e-07 | NA | 2.06e-48 |
| 3. B | Q5UPE3 | Putative ankyrin repeat protein L62 | NA | NA | 0.003 |
| 3. B | Q83DF6 | Putative ankyrin repeat protein CBU_0781 | 2.65e-05 | NA | 0.014 |
| 3. B | Q923M0 | Protein phosphatase 1 regulatory subunit 16A | 6.89e-07 | NA | 0.009 |
| 3. B | Q94527 | Nuclear factor NF-kappa-B p110 subunit | 3.19e-03 | NA | 2.58e-06 |
| 3. B | Q6F3J0 | Nuclear factor NF-kappa-B p105 subunit | 2.13e-04 | NA | 2.43e-04 |
| 3. B | Q8N9B4 | Ankyrin repeat domain-containing protein 42 | 1.89e-07 | NA | 0.001 |
| 3. B | Q07E28 | Cortactin-binding protein 2 | 1.06e-02 | NA | 4.12e-10 |
| 3. B | Q5H9F3 | BCL-6 corepressor-like protein 1 | 3.43e-01 | NA | 7.69e-04 |
| 3. B | Q8WXK3 | Ankyrin repeat and SOCS box protein 13 | 3.75e-09 | NA | 7.05e-09 |
| 3. B | Q5TYW2 | Ankyrin repeat domain-containing protein 20A1 | 2.41e-05 | NA | 6.34e-56 |
| 3. B | Q5GIG6 | Serine/threonine-protein kinase TNNI3K | 5.24e-07 | NA | 7.46e-06 |
| 3. B | Q92625 | Ankyrin repeat and SAM domain-containing protein 1A | 1.47e-03 | NA | 8.88e-07 |
| 3. B | Q3UUF8 | Ankyrin repeat domain-containing protein 34B | 1.04e-04 | NA | 0.006 |
| 3. B | Q09YI3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.55e-06 | NA | 2.83e-06 |
| 3. B | A0M8T5 | Cortactin-binding protein 2 | 1.17e-02 | NA | 1.86e-09 |
| 3. B | Q9J5I9 | Putative ankyrin repeat protein FPV012 | NA | NA | 1.82e-04 |
| 3. B | Q2KI79 | Ankyrin repeat family A protein 2 | 6.69e-07 | NA | 3.43e-08 |
| 3. B | Q5ZM55 | Protein fem-1 homolog B | 1.80e-07 | NA | 9.08e-07 |
| 3. B | Q07E15 | Cortactin-binding protein 2 | 6.23e-03 | NA | 2.19e-10 |
| 3. B | Q6UB98 | Ankyrin repeat domain-containing protein 12 | 1.53e-01 | NA | 0.001 |
| 3. B | A6QPE7 | Ankyrin repeat domain-containing protein 65 | 4.58e-09 | NA | 8.26e-12 |
| 3. B | Q9XZC0 | Alpha-latrocrustotoxin-Lt1a (Fragment) | 8.40e-05 | NA | 1.50e-04 |
| 3. B | Q9NVP4 | Double zinc ribbon and ankyrin repeat-containing protein 1 | 8.37e-03 | NA | 0.013 |
| 3. B | Q94A76 | Potassium channel GORK | 3.86e-05 | NA | 2.26e-08 |
| 3. B | Q1ZXR2 | Probable serine/threonine-protein kinase DDB_G0267566 | 3.17e-02 | NA | 0.005 |
| 3. B | Q8Q0U0 | Putative ankyrin repeat protein MM_0045 | 6.29e-09 | NA | 2.98e-18 |
| 3. B | Q8N961 | Ankyrin repeat and BTB/POZ domain-containing protein 2 | 9.79e-04 | NA | 0.004 |
| 3. B | Q7EZ44 | Probable E3 ubiquitin-protein ligase XBOS35 | 2.74e-10 | NA | 0.002 |
| 3. B | O35516 | Neurogenic locus notch homolog protein 2 | 3.44e-02 | NA | 4.35e-10 |
| 3. B | Q5VYY1 | Ankyrin repeat domain-containing protein 22 | 2.22e-16 | NA | 4.64e-12 |
| 3. B | Q6XJU9 | Osteoclast-stimulating factor 1 | 2.51e-07 | NA | 1.77e-04 |
| 3. B | Q03017 | NF-kappa-B inhibitor cactus | 9.15e-07 | NA | 2.67e-05 |
| 3. B | B8N0E6 | Ankyrin-repeat domain containing transcription coregulator asaA | 3.10e-04 | NA | 1.66e-07 |
| 3. B | O75762 | Transient receptor potential cation channel subfamily A member 1 | 4.46e-04 | NA | 1.62e-07 |
| 3. B | Q5M9H0 | Ankyrin repeat and SAM domain-containing protein 3 | 2.80e-06 | NA | 4.78e-15 |
| 3. B | Q8VD46 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 3.01e-07 | NA | 2.00e-06 |
| 3. B | Q5UPA0 | Putative ankyrin repeat protein L25 | NA | NA | 3.09e-05 |
| 3. B | Q6NY19 | KN motif and ankyrin repeat domain-containing protein 3 | 4.44e-04 | NA | 5.21e-05 |
| 3. B | E7BQV0 | BTB/POZ domain and ankyrin repeat-containing protein NPR1 | 1.22e-03 | NA | 0.005 |
| 3. B | O74977 | VMS1 homolog C1827.04 | 1.94e-02 | NA | 0.005 |
| 3. B | P19838 | Nuclear factor NF-kappa-B p105 subunit | 6.65e-04 | NA | 1.64e-05 |
| 3. B | A0M8S4 | Cortactin-binding protein 2 | 1.46e-02 | NA | 1.82e-09 |
| 3. B | Q24145 | Tyrosine-protein kinase Shark | 9.20e-04 | NA | 0.004 |
| 3. B | Q9TU71 | Ankyrin repeat domain-containing protein 1 | 1.51e-09 | NA | 7.18e-15 |
| 3. B | Q18297 | Transient receptor potential cation channel subfamily A member 1 homolog | 1.61e-03 | NA | 1.90e-08 |
| 3. B | E9Q4F7 | Ankyrin repeat domain-containing protein 11 | 1.93e-01 | NA | 8.23e-06 |
| 3. B | Q8WWH4 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.14e-07 | NA | 1.88e-06 |
| 3. B | Q1RJN6 | Putative ankyrin repeat protein RBE_0347 | 1.33e-06 | NA | 3.31e-04 |
| 3. B | P98150 | Nuclear factor NF-kappa-B p100 subunit | 3.74e-05 | NA | 6.32e-06 |
| 3. B | Q5UQZ7 | Putative ankyrin repeat protein R901 | NA | NA | 8.49e-05 |
| 3. B | Q5RF15 | Serine/threonine-protein kinase TNNI3K | 1.24e-08 | NA | 1.10e-04 |
| 3. B | Q8C008 | Double zinc ribbon and ankyrin repeat-containing protein 1 | 2.18e-02 | NA | 0.001 |
| 3. B | Q9VFD5 | Protein fem-1 homolog CG6966 | 4.15e-07 | NA | 9.35e-10 |
| 3. B | Q6P9K8 | Caskin-1 | 7.35e-04 | NA | 1.26e-06 |
| 3. B | Q2IBA2 | Cortactin-binding protein 2 | 1.21e-02 | NA | 1.76e-09 |
| 3. B | Q5UR04 | Putative ankyrin repeat protein R911 | NA | NA | 2.51e-04 |
| 3. B | Q812A3 | Ankyrin repeat domain-containing protein 23 | 3.39e-10 | NA | 1.17e-12 |
| 3. B | Q3SWY2 | Integrin-linked protein kinase | 2.62e-06 | NA | 4.39e-09 |
| 3. B | A5PMU4 | Ankyrin repeat and sterile alpha motif domain-containing protein 1B | 2.41e-04 | NA | 9.80e-05 |
| 3. B | Q876A6 | Palmitoyltransferase AKR1 | 2.26e-05 | NA | 3.13e-12 |
| 3. B | P0C7A6 | Ankyrin repeat and BTB/POZ domain-containing protein BTBD11-B | 5.97e-04 | NA | 0.039 |
| 3. B | Q5UR87 | Putative ankyrin repeat protein R634 | NA | NA | 0.016 |
| 3. B | Q96KQ7 | Histone-lysine N-methyltransferase EHMT2 | 9.08e-04 | NA | 2.68e-11 |
| 3. B | P25799 | Nuclear factor NF-kappa-B p105 subunit | 4.91e-04 | NA | 3.32e-04 |
| 3. B | Q92882 | Osteoclast-stimulating factor 1 | 5.64e-07 | NA | 0.017 |
| 3. B | Q99LW0 | Ankyrin repeat domain-containing protein 10 | 7.85e-07 | NA | 1.34e-04 |
| 3. B | Q6GNY1 | E3 ubiquitin-protein ligase mib1 | 1.11e-04 | NA | 1.37e-10 |
| 3. B | Q91ZU0 | Ankyrin repeat and SOCS box protein 7 | 1.94e-10 | NA | 1.01e-05 |
| 3. B | Q5UPV1 | Putative ankyrin repeat protein L271 | NA | NA | 6.78e-06 |
| 3. B | Q9JLU4 | SH3 and multiple ankyrin repeat domains protein 3 | 1.33e-02 | NA | 0.029 |
| 3. B | A2A2Z9 | Ankyrin repeat domain-containing protein 18B | 6.74e-05 | NA | 3.12e-55 |
| 3. B | Q5UPU4 | Putative ankyrin repeat protein R267 | NA | NA | 0.038 |
| 3. B | Q9J5H7 | Putative ankyrin repeat protein FPV024 | NA | NA | 1.42e-07 |
| 3. B | Q09701 | Palmitoyltransferase akr1 | 1.60e-06 | NA | 2.19e-08 |
| 3. B | Q01705 | Neurogenic locus notch homolog protein 1 | 1.08e-01 | NA | 1.13e-10 |
| 3. B | Q9Z2G1 | Protein fem-1 homolog A-A | 2.12e-05 | NA | 6.72e-12 |
| 3. B | P0C550 | Potassium channel AKT1 | 1.23e-03 | NA | 5.83e-08 |
| 3. B | X1WE18 | KN motif and ankyrin repeat domain-containing protein 2 | 4.78e-03 | NA | 0.002 |
| 3. B | G5EGA3 | Ankyrin repeat and LEM domain-containing protein 1 homolog | 3.99e-02 | NA | 0.008 |
| 3. B | Q5UQI7 | Putative ankyrin repeat protein R838 | NA | NA | 0.002 |
| 3. B | Q8WXK1 | Ankyrin repeat and SOCS box protein 15 | 8.47e-07 | NA | 0.021 |
| 3. B | Q2IBF8 | Cortactin-binding protein 2 | 9.78e-03 | NA | 7.72e-10 |
| 3. B | Q2T9K6 | Protein fem-1 homolog C | 1.27e-07 | NA | 4.60e-13 |
| 3. B | Q9ULJ7 | Ankyrin repeat domain-containing protein 50 | 1.79e-03 | NA | 2.91e-11 |
| 3. B | Q07DX6 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.22e-07 | NA | 4.64e-06 |
| 3. B | A5PK26 | Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 | 3.68e-03 | NA | 0.004 |
| 3. B | Q8VHK1 | Caskin-2 | 5.72e-04 | NA | 0.024 |
| 3. B | Q9ZCL3 | Putative ankyrin repeat protein RP714 | 2.37e-12 | NA | 8.59e-06 |
| 3. B | Q9Y6X6 | Unconventional myosin-XVI | 1.05e-02 | NA | 0.028 |
| 3. B | P46531 | Neurogenic locus notch homolog protein 1 | 7.24e-02 | NA | 2.16e-10 |
| 3. B | Q2IBE6 | Cortactin-binding protein 2 | 1.02e-02 | NA | 1.69e-08 |
| 3. B | Q3ZBX7 | Ankyrin repeat domain-containing protein 1 | 2.30e-09 | NA | 3.92e-12 |
| 3. B | Q4V869 | Acyl-CoA-binding domain-containing protein 6 | 6.59e-06 | NA | 1.29e-10 |
| 3. B | Q09YG9 | Cortactin-binding protein 2 | 1.13e-02 | NA | 1.32e-08 |
| 3. B | Q8HXA6 | Ankyrin repeat and SOCS box protein 15 | 4.56e-06 | NA | 0.014 |
| 3. B | Q0P5G1 | Tonsoku-like protein | 1.57e-02 | NA | 1.05e-04 |
| 3. B | Q91ZU1 | Ankyrin repeat and SOCS box protein 6 | 1.08e-07 | NA | 0.021 |
| 3. B | Q52T38 | Protein S-acyltransferase 24 | 8.87e-06 | NA | 0.003 |
| 3. B | P0C6S7 | Ankyrin repeat and sterile alpha motif domain-containing protein 1B | 2.62e-04 | NA | 0.001 |
| 3. B | Q96JP0 | Protein fem-1 homolog C | 1.03e-07 | NA | 5.86e-11 |
| 3. B | P0C6C1 | Ankyrin repeat domain-containing protein 34C | 6.23e-05 | NA | 4.81e-05 |
| 3. B | F1N6G5 | E3 ubiquitin-protein ligase HACE1 | 2.34e-05 | NA | 8.84e-08 |
| 3. B | Q8NFD2 | Ankyrin repeat and protein kinase domain-containing protein 1 | 1.07e-05 | NA | 1.49e-15 |
| 3. B | Q865U8 | Ankyrin repeat domain-containing protein 1 | 9.74e-10 | NA | 1.59e-12 |
| 3. B | Q9DF58 | Integrin-linked protein kinase | 1.01e-07 | NA | 2.02e-10 |
| 3. B | Q6NZL6 | Tonsoku-like protein | 2.09e-02 | NA | 9.61e-05 |
| 3. B | O60237 | Protein phosphatase 1 regulatory subunit 12B | 6.07e-05 | NA | 0.003 |
| 3. B | Q1LZH7 | KN motif and ankyrin repeat domain-containing protein 2 | 7.95e-04 | NA | 1.27e-05 |
| 3. B | P17442 | Phosphate system positive regulatory protein PHO81 | 1.60e-02 | NA | 9.96e-05 |
| 3. B | Q8QN36 | Ankyrin repeat domain-containing protein CP77 | NA | NA | 0.007 |
| 3. B | A2VDR2 | Acyl-CoA-binding domain-containing protein 6 | 1.92e-06 | NA | 2.55e-12 |
| 3. B | Q00PJ1 | Cortactin-binding protein 2 | 2.38e-02 | NA | 9.03e-10 |
| 3. B | Q54BA2 | Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 | 3.99e-05 | NA | 8.18e-11 |
| 3. B | Q9VCA8 | Ankyrin repeat and KH domain-containing protein mask | NA | NA | 2.37e-13 |
| 3. B | Q04861 | Nuclear factor NF-kappa-B p105 subunit | 2.43e-04 | NA | 8.48e-04 |
| 3. B | A2ARS0 | Ankyrin repeat domain-containing protein 63 | 1.08e-07 | NA | 0.001 |
| 3. B | F1MJR8 | Inactive serine/threonine-protein kinase TEX14 | 5.76e-02 | NA | 8.03e-08 |
| 3. B | Q15327 | Ankyrin repeat domain-containing protein 1 | 8.98e-10 | NA | 1.42e-12 |
| 3. B | Q25338 | Delta-latroinsectotoxin-Lt1a | 1.39e-04 | NA | 2.96e-09 |
| 3. B | Q5UPB6 | Putative ankyrin repeat protein L45 | NA | NA | 0.011 |
| 3. B | Q9BXX3 | Ankyrin repeat domain-containing protein 30A | 6.28e-04 | NA | 5.07e-129 |
| 3. B | Q86YT6 | E3 ubiquitin-protein ligase MIB1 | 3.18e-04 | NA | 4.17e-11 |
| 3. B | Q94CT7 | Probable E3 ubiquitin-protein ligase XBOS31 | 8.31e-08 | NA | 1.12e-06 |
| 3. B | Q9TZC4 | Integrin-linked protein kinase homolog pat-4 | 1.82e-09 | NA | 2.41e-10 |
| 3. B | O89019 | Inversin | 7.69e-04 | NA | 9.70e-13 |
| 3. B | Q5SUE8 | Ankyrin repeat domain-containing protein 40 | 2.95e-03 | NA | 0.037 |
| 3. B | Q66JD7 | Acyl-CoA-binding domain-containing protein 6 | 1.62e-07 | NA | 6.54e-11 |
| 3. B | Q9J4Z8 | Putative ankyrin repeat protein FPV242 | NA | NA | 0.002 |
| 3. B | Q69ZU8 | Ankyrin repeat domain-containing protein 6 | 6.81e-07 | NA | 5.06e-14 |
| 3. B | Q8WMX8 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 3.64e-07 | NA | 2.76e-06 |
| 3. B | Q07DZ7 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.43e-07 | NA | 0.014 |
| 3. B | Q0JKV1 | Potassium channel AKT1 | 1.18e-03 | NA | 5.67e-08 |
| 3. B | Q09YH1 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.70e-07 | NA | 3.46e-07 |
| 3. B | Q2IBB2 | Cortactin-binding protein 2 | 1.38e-02 | NA | 1.38e-11 |
| 3. B | Q5UPG7 | Putative ankyrin repeat protein L91 | NA | NA | 0.016 |
| 3. B | Q9EQG6 | Kinase D-interacting substrate of 220 kDa | 7.05e-03 | NA | 3.29e-16 |
| 3. B | Q5ZLC6 | Ankyrin repeat domain-containing protein 10 | 1.55e-06 | NA | 3.46e-05 |
| 3. B | Q4KL97 | Ankyrin repeat domain-containing protein 1 | 7.18e-10 | NA | 8.48e-12 |
| 3. B | Q91955 | Myotrophin | 3.73e-12 | NA | 0.005 |
| 3. B | O43150 | Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 | 2.67e-02 | NA | 0.011 |
| 3. B | P58546 | Myotrophin | 2.44e-12 | NA | 0.006 |
| 3. B | Q2QLG9 | Cortactin-binding protein 2 | 1.04e-02 | NA | 2.29e-08 |
| 3. B | Q4R544 | Ankyrin repeat and SOCS box protein 8 | 2.22e-09 | NA | 9.57e-13 |
| 3. B | Q9J4Z6 | Putative ankyrin repeat protein FPV244 | NA | NA | 1.33e-06 |
| 3. B | Q9J5A7 | Putative ankyrin repeat protein FPV115 | NA | NA | 8.68e-06 |
| 3. B | Q5ZJJ9 | Osteoclast-stimulating factor 1 | 6.34e-07 | NA | 0.037 |
| 3. B | Q07E17 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.84e-07 | NA | 3.66e-06 |
| 3. B | Q9UVH3 | Palmitoyltransferase AKR1 (Fragment) | 5.81e-06 | NA | 1.60e-05 |
| 3. B | O08560 | Diacylglycerol kinase zeta | 5.79e-03 | NA | 0.024 |
| 3. B | P0CG38 | POTE ankyrin domain family member I | 1.78e-04 | NA | 2.14e-46 |
| 3. B | A0JP26 | POTE ankyrin domain family member B3 | 1.09e-05 | NA | 7.78e-49 |
| 3. B | Q5UPA2 | Putative ankyrin repeat protein L23 | NA | NA | 0.024 |
| 3. B | O74205 | Transcription factor TOXE | 2.16e-06 | NA | 2.52e-06 |
| 3. B | Q09YJ5 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 3.44e-07 | NA | 5.17e-06 |
| 3. B | Q8WMX6 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.36e-07 | NA | 2.36e-06 |
| 3. B | Q5F478 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B | 4.07e-05 | NA | 4.57e-13 |
| 3. B | Q8K3X6 | Ankyrin repeat and SAM domain-containing protein 4B | 1.77e-05 | NA | 7.80e-05 |
| 3. B | Q5UP14 | Putative ankyrin repeat protein R845 | NA | NA | 0.020 |
| 3. B | Q9J507 | Putative ankyrin repeat protein FPV228 | NA | NA | 6.60e-10 |
| 3. B | Q7TQP6 | Serine/threonine-protein kinase TNNI3K | 6.42e-07 | NA | 2.58e-05 |
| 3. B | P0CS67 | Palmitoyltransferase AKR1 | 8.78e-06 | NA | 1.49e-14 |
| 3. B | Q9Z2G0 | Protein fem-1 homolog B | 1.97e-06 | NA | 6.78e-07 |
| 3. B | Q5UP11 | Putative ankyrin repeat protein R848 | NA | NA | 3.21e-05 |
| 3. B | G5E8K5 | Ankyrin-3 | 1.54e-02 | NA | 7.69e-13 |
| 3. B | Q6DD51 | Caskin-2 | 4.92e-04 | NA | 0.001 |
| 3. B | Q3TYA6 | M-phase phosphoprotein 8 | 2.41e-04 | NA | 1.69e-04 |
| 3. B | P21783 | Neurogenic locus notch homolog protein 1 | 1.21e-01 | NA | 1.87e-06 |
| 3. B | Q8TF21 | Ankyrin repeat domain-containing protein 24 | 5.21e-04 | NA | 5.90e-06 |
| 3. B | A0A0A6YYL3 | POTE ankyrin domain family member B | 2.29e-07 | NA | 8.36e-50 |
| 3. B | A0A0R4IQZ2 | Putative palmitoyltransferase ZDHHC13 | 1.53e-05 | NA | 1.18e-13 |
| 3. B | Q96HA7 | Tonsoku-like protein | 5.96e-03 | NA | 4.27e-05 |
| 3. B | Q5CZ79 | Ankyrin repeat domain-containing protein 20B | 2.40e-05 | NA | 3.62e-57 |
| 3. B | Q9H765 | Ankyrin repeat and SOCS box protein 8 | 4.16e-09 | NA | 4.16e-12 |
| 3. B | Q3KP44 | Ankyrin repeat domain-containing protein 55 | 3.95e-05 | NA | 1.28e-05 |
| 3. B | Q99549 | M-phase phosphoprotein 8 | 4.54e-04 | NA | 1.15e-04 |
| 3. B | Q1RJR6 | Putative ankyrin repeat protein RBE_0317 | 1.40e-09 | NA | 4.12e-06 |
| 3. B | Q10728 | Protein phosphatase 1 regulatory subunit 12A | 2.19e-04 | NA | 0.017 |
| 3. B | P07207 | Neurogenic locus Notch protein | NA | NA | 3.65e-07 |
| 3. B | Q07DV1 | Cortactin-binding protein 2 | 1.16e-02 | NA | 4.88e-09 |
| 3. B | Q9CWU2 | Palmitoyltransferase ZDHHC13 | 1.24e-05 | NA | 6.36e-12 |
| 3. B | Q9W0T5 | Transient receptor potential channel pyrexia | 7.69e-05 | NA | 3.23e-09 |
| 3. B | Q9NWX5 | Ankyrin repeat and SOCS box protein 6 | 1.00e-07 | NA | 0.004 |
| 3. B | Q5W7F2 | ADP-ribosylation factor GTPase-activating protein AGD3 | 5.57e-02 | NA | 0.042 |
| 3. B | Q9STP8 | Acyl-CoA-binding domain-containing protein 2 | 1.44e-05 | NA | 1.90e-10 |
| 3. B | Q04749 | Target of rapamycin complex 2 subunit AVO2 | 2.24e-08 | NA | 0.015 |
| 3. B | A2CIR5 | Ankyrin repeat-containing protein NPR4 | 1.06e-06 | NA | 0.007 |
| 3. B | Q1RHQ8 | Putative ankyrin repeat protein RBE_1025 | 2.95e-09 | NA | 7.27e-07 |
| 3. B | Q07DX4 | Cortactin-binding protein 2 | 1.08e-02 | NA | 2.03e-08 |
| 3. B | Q63ZY3 | KN motif and ankyrin repeat domain-containing protein 2 | 8.53e-04 | NA | 5.33e-04 |
| 3. B | Q9CR42 | Ankyrin repeat domain-containing protein 1 | 3.09e-11 | NA | 7.95e-16 |
| 3. B | Q8BTZ5 | Ankyrin repeat domain-containing protein 46 | 4.02e-08 | NA | 6.09e-06 |
| 3. B | A6NK59 | Ankyrin repeat and SOCS box protein 14 | 3.08e-07 | NA | 2.96e-05 |
| 3. B | Q8BLA8 | Transient receptor potential cation channel subfamily A member 1 | 1.38e-03 | NA | 1.28e-06 |
| 3. B | Q8H569 | Potassium channel AKT3 | 1.12e-03 | NA | 3.08e-08 |
| 3. B | Q5UQ08 | Putative ankyrin repeat protein R787 | NA | NA | 0.002 |
| 3. B | A8VU90 | Ankyrin repeat and LEM domain-containing protein 1 | 2.74e-05 | NA | 0.016 |
| 3. B | O73630 | Nuclear factor NF-kappa-B p100 subunit | 4.82e-04 | NA | 8.23e-08 |
| 3. B | Q5UQV3 | Putative ankyrin repeat protein L371 | NA | NA | 5.67e-06 |
| 3. B | Q6C520 | Palmitoyltransferase AKR1 | 8.76e-06 | NA | 7.30e-08 |
| 3. B | Q2QLA2 | Cortactin-binding protein 2 | 1.39e-02 | NA | 7.57e-11 |
| 3. B | P12932 | Ankyrin repeat domain-containing protein CP77 | NA | NA | 0.017 |
| 3. B | O75179 | Ankyrin repeat domain-containing protein 17 | 6.38e-02 | NA | 1.53e-13 |
| 3. B | Q5UQJ2 | Putative ankyrin repeat protein R863 | NA | NA | 7.61e-04 |
| 3. B | Q86AT8 | Stress-activated protein kinase alpha | 1.58e-05 | NA | 0.002 |
| 3. B | Q09YM8 | Cortactin-binding protein 2 | 1.06e-02 | NA | 1.50e-10 |
| 3. B | Q9WTK5 | Nuclear factor NF-kappa-B p100 subunit | 1.61e-03 | NA | 1.88e-05 |
| 3. B | Q6GPE5 | Protein fem-1 homolog B | 1.57e-07 | NA | 4.18e-07 |
| 3. B | Q8WXE0 | Caskin-2 | 8.87e-04 | NA | 0.003 |
| 3. B | Q69ZR2 | E3 ubiquitin-protein ligase HECTD1 | 3.49e-01 | NA | 0.002 |
| 3. B | Q4R690 | Palmitoyltransferase ZDHHC13 | 3.96e-05 | NA | 1.04e-10 |
| 3. B | Q07E30 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.84e-07 | NA | 1.96e-06 |
| 3. B | Q5DW34 | Histone-lysine N-methyltransferase EHMT1 | 2.49e-03 | NA | 3.60e-12 |
| 3. B | Q80YE7 | Death-associated protein kinase 1 | 2.77e-03 | NA | 8.79e-16 |
| 3. B | Q5URB8 | Putative ankyrin repeat protein R841 | NA | NA | 0.025 |
| 3. B | Q5UPG0 | Putative ankyrin repeat protein L86 | NA | NA | 5.58e-06 |
| 3. B | E9PTT0 | Palmitoyltransferase ZDHHC17 | 8.30e-06 | NA | 1.57e-11 |
| 3. B | P0DJE3 | Alpha-latrotoxin-Lhe1a | 2.24e-03 | NA | 1.39e-06 |
| 3. B | O00221 | NF-kappa-B inhibitor epsilon | 6.92e-07 | NA | 1.64e-05 |
| 3. B | Q2IBF5 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 3.73e-07 | NA | 1.86e-06 |
| 3. B | Q9VSA4 | Tonsoku-like protein | 2.10e-02 | NA | 0.003 |
| 3. B | Q3UYR4 | Espin-like protein | 4.89e-04 | NA | 0.020 |
| 3. B | Q8IWZ3 | Ankyrin repeat and KH domain-containing protein 1 | 5.69e-02 | NA | 6.72e-14 |
| 3. B | Q4V890 | Protein fem-1 homolog A | 4.67e-06 | NA | 1.19e-11 |
| 3. B | Q8IVF6 | Ankyrin repeat domain-containing protein 18A | 1.89e-04 | NA | 8.81e-53 |
| 3. B | Q9J5H5 | Putative ankyrin repeat protein FPV026 | NA | NA | 2.55e-06 |
| 3. B | Q9J4Z4 | Putative ankyrin repeat protein FPV246 | NA | NA | 9.47e-14 |
| 3. B | A6NC57 | Ankyrin repeat domain-containing protein 62 | 1.67e-05 | NA | 3.69e-51 |
| 3. B | Q5RD76 | NAD-capped RNA hydrolase NUDT12 | 2.89e-03 | NA | 0.008 |
| 3. B | Q4ACU6 | SH3 and multiple ankyrin repeat domains protein 3 | 1.44e-02 | NA | 0.029 |
| 3. B | Q6AI12 | Ankyrin repeat domain-containing protein 40 | 1.84e-03 | NA | 0.034 |
| 3. B | Q8C6Y6 | Ankyrin repeat and SOCS box protein 14 | 2.27e-06 | NA | 3.46e-07 |
| 3. B | Q5UPJ9 | Putative ankyrin repeat protein L122 | NA | NA | 3.29e-07 |
| 3. B | Q5AL27 | Palmitoyltransferase AKR1 | 4.90e-05 | NA | 6.24e-05 |
| 3. B | Q54F46 | Homeobox protein Wariai | 8.24e-05 | NA | 5.51e-12 |
| 3. B | Q108T9 | Cortactin-binding protein 2 | 1.40e-02 | NA | 2.59e-10 |
| 3. B | Q9H672 | Ankyrin repeat and SOCS box protein 7 | 1.75e-10 | NA | 9.98e-06 |
| 3. B | Q9ET47 | Espin | 2.08e-04 | NA | 5.28e-05 |
| 3. B | Q9GKW8 | Ankyrin repeat and death domain-containing protein 1A (Fragment) | 3.59e-07 | NA | 7.18e-10 |
| 3. B | Q05921 | 2-5A-dependent ribonuclease | 9.53e-06 | NA | 1.31e-06 |
| 3. B | Q5ZIJ9 | E3 ubiquitin-protein ligase MIB2 | 6.97e-05 | NA | 1.15e-05 |
| 3. B | Q07DV3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.12e-07 | NA | 3.72e-07 |
| 3. B | Q80VM7 | Ankyrin repeat domain-containing protein 24 | 1.66e-04 | NA | 1.12e-07 |
| 3. B | P50086 | Probable 26S proteasome regulatory subunit p28 | 7.89e-14 | NA | 0.008 |
| 3. B | Q1RHT6 | Putative ankyrin repeat protein RBE_0997 | 6.61e-09 | NA | 1.92e-15 |
| 3. B | Q505D1 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A | 2.14e-04 | NA | 1.80e-15 |
| 3. B | O90760 | Putative ankyrin repeat protein FPV031 | NA | NA | 4.53e-04 |
| 3. B | Q8IUH4 | Palmitoyltransferase ZDHHC13 | 1.59e-04 | NA | 1.93e-12 |
| 3. B | P81069 | GA-binding protein subunit beta-2 | 1.40e-06 | NA | 1.47e-04 |
| 3. B | Q54GC8 | Acyl-CoA-binding domain-containing protein 6 homolog | 2.89e-06 | NA | 1.90e-07 |
| 3. B | Q9UPS8 | Ankyrin repeat domain-containing protein 26 | 3.55e-03 | NA | 8.96e-65 |
| 3. B | Q9VUW9 | Palmitoyltransferase Hip14 | 1.20e-05 | NA | 5.16e-11 |
| 3. B | Q9NXR5 | Ankyrin repeat domain-containing protein 10 | 1.20e-06 | NA | 3.59e-05 |
| 3. B | Q00420 | GA-binding protein subunit beta-1 | 2.40e-09 | NA | 6.40e-05 |
| 3. B | Q6NLQ8 | E3 ubiquitin-protein ligase XBAT32 | 2.74e-06 | NA | 0.004 |
| 3. B | Q9J508 | Putative ankyrin repeat protein FPV227 | NA | NA | 1.11e-05 |
| 3. B | Q1RI12 | Putative ankyrin repeat protein RBE_0921 | 4.52e-05 | NA | 5.29e-06 |
| 3. B | Q9Y6H5 | Synphilin-1 | 4.98e-04 | NA | 3.70e-04 |
| 3. B | A4D7T3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.58e-07 | NA | 2.31e-04 |
| 3. B | Q5ZXN6 | Phosphocholine transferase AnkX | 1.51e-03 | NA | 5.77e-06 |
| 3. B | Q8R516 | E3 ubiquitin-protein ligase MIB2 | 1.76e-05 | NA | 1.40e-05 |
| 3. B | P83757 | NF-kappa-B inhibitor cactus | NA | NA | 7.28e-04 |
| 3. B | Q13418 | Integrin-linked protein kinase | 2.67e-06 | NA | 4.56e-09 |
| 3. B | Q8BG95 | Protein phosphatase 1 regulatory subunit 12B | 1.39e-04 | NA | 0.002 |
| 3. B | Q9FDY4 | BTB/POZ domain and ankyrin repeat-containing protein NPR1 | 9.45e-04 | NA | 0.007 |
| 3. B | Q6ZVH7 | Espin-like protein | 3.72e-04 | NA | 0.023 |
| 3. B | Q9C0D5 | Protein TANC1 | 3.65e-03 | NA | 2.67e-10 |
| 3. B | Q9GKS9 | Double zinc ribbon and ankyrin repeat-containing protein 1 | 2.45e-03 | NA | 0.009 |
| 3. B | Q5BKI6 | Ankyrin repeat domain-containing protein 1 | 8.98e-10 | NA | 5.73e-13 |
| 3. B | Q9Z1P7 | KN motif and ankyrin repeat domain-containing protein 3 | 8.47e-05 | NA | 3.41e-05 |
| 3. B | Q9J516 | Putative ankyrin repeat protein FPV219 | NA | NA | 6.58e-05 |
| 3. B | Q07DZ5 | Cortactin-binding protein 2 | 1.01e-02 | NA | 2.36e-10 |
| 3. B | Q09YN0 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.23e-07 | NA | 4.42e-07 |
| 3. B | Q2TXF6 | Ankyrin repeat domain-containing protein oryK | 4.12e-04 | NA | 0.005 |
| 3. B | D3YZU1 | SH3 and multiple ankyrin repeat domains protein 1 | 6.16e-02 | NA | 0.002 |
| 3. B | Q02989 | Alpha-latroinsectotoxin-Lt1a (Fragment) | 8.53e-04 | NA | 2.68e-09 |
| 3. B | Q60J38 | Ankyrin repeat and KH domain-containing protein CBG24701 | 8.78e-02 | NA | 7.41e-07 |
| 3. B | D3ZD05 | KN motif and ankyrin repeat domain-containing protein 2 | 6.68e-04 | NA | 8.32e-05 |
| 3. B | Q8T2Q0 | Putative ZDHHC-type palmitoyltransferase 6 | 2.64e-05 | NA | 0.001 |
| 3. B | B2RXR6 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B | 4.14e-05 | NA | 2.76e-13 |
| 3. B | Q502K3 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 1.58e-04 | NA | 1.99e-10 |
| 3. B | Q66H07 | Fibronectin type 3 and ankyrin repeat domains 1 protein | 1.33e-08 | NA | 1.03e-11 |
| 3. B | Q69YU3 | Ankyrin repeat domain-containing protein 34A | 7.00e-05 | NA | 1.83e-06 |
| 3. B | Q9C104 | Glycerophosphocholine phosphodiesterase gde1 | 2.93e-03 | NA | 0.001 |
| 3. B | Q7M6U3 | Inactive serine/threonine-protein kinase TEX14 | 4.17e-02 | NA | 2.24e-08 |
| 3. B | Q20500 | Intracellular phospholipase A2 | 8.42e-03 | NA | 9.38e-07 |
| 3. B | Q9EP71 | Ankycorbin | 8.50e-05 | NA | 2.29e-10 |
| 3. B | Q9FIT8 | ADP-ribosylation factor GTPase-activating protein AGD1 | 2.38e-02 | NA | 0.001 |
| 3. B | Q5PQ89 | Ankyrin repeat domain-containing protein 34B | 1.80e-04 | NA | 2.41e-04 |
| 3. B | Q2QLB3 | Cortactin-binding protein 2 | 1.17e-02 | NA | 1.03e-08 |
| 3. B | Q05753 | Ankyrin repeat domain-containing protein, chloroplastic | 3.19e-06 | NA | 4.70e-14 |
| 3. B | Q8HYY4 | Uveal autoantigen with coiled-coil domains and ankyrin repeats protein | 1.77e-03 | NA | 5.14e-07 |
| 3. B | Q6UB99 | Ankyrin repeat domain-containing protein 11 | 4.10e-01 | NA | 4.96e-06 |
| 3. B | O22265 | Signal recognition particle 43 kDa protein, chloroplastic | 8.81e-05 | NA | 1.44e-05 |
| 3. B | O55222 | Integrin-linked protein kinase | 1.98e-06 | NA | 5.24e-09 |
| 3. B | Q9J569 | Putative ankyrin repeat protein FPV162 | NA | NA | 1.22e-06 |
| 3. B | Q969K4 | Ankyrin repeat and BTB/POZ domain-containing protein 1 | 6.21e-03 | NA | 0.002 |
| 3. B | Q8MJ49 | Osteoclast-stimulating factor 1 | 5.45e-07 | NA | 0.038 |
| 3. B | Q08DV6 | Ankyrin repeat and SOCS box protein 3 | 9.55e-11 | NA | 9.71e-08 |
| 3. B | Q9SAR5 | Ankyrin repeat domain-containing protein 2A | 2.97e-07 | NA | 1.97e-06 |
| 3. B | Q76K24 | Ankyrin repeat domain-containing protein 46 | 1.62e-08 | NA | 5.49e-06 |
| 3. B | Q09103 | Eye-specific diacylglycerol kinase | 3.50e-02 | NA | 0.008 |
| 3. B | Q4V8X4 | Acyl-CoA-binding domain-containing protein 6 | 2.40e-07 | NA | 1.27e-10 |
| 3. B | Q04721 | Neurogenic locus notch homolog protein 2 | 7.83e-02 | NA | 4.47e-10 |
| 3. B | Q9DCN1 | NAD-capped RNA hydrolase NUDT12 | 7.18e-03 | NA | 0.015 |
| 3. B | Q09YI1 | Cortactin-binding protein 2 | 1.59e-02 | NA | 3.39e-10 |
| 3. B | Q9C7A2 | Ankyrin repeat-containing protein ITN1 | 1.38e-06 | NA | 4.48e-06 |
| 3. B | Q8N6D5 | Ankyrin repeat domain-containing protein 29 | 4.66e-10 | NA | 2.76e-07 |
| 3. B | O15084 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A | 3.41e-04 | NA | 5.41e-15 |
| 3. B | Q5NVB9 | Palmitoyltransferase ZDHHC13 | 4.03e-05 | NA | 1.69e-12 |
| 3. B | Q7T2B9 | Myotrophin | 4.19e-12 | NA | 0.004 |
| 3. B | Q9J4Z5 | Putative ankyrin repeat protein FPV245 | NA | NA | 1.61e-10 |
| 3. B | Q6P9Z4 | Protein fem-1 homolog A | 7.91e-08 | NA | 5.19e-13 |
| 3. B | Q8BTI7 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 6.95e-04 | NA | 3.44e-11 |
| 3. B | Q9GZV1 | Ankyrin repeat domain-containing protein 2 | 1.58e-08 | NA | 5.30e-11 |
| 3. B | Q9QW30 | Neurogenic locus notch homolog protein 2 | 7.28e-02 | NA | 5.18e-10 |
| 3. B | Q6GQX6 | Ankyrin repeat and SAM domain-containing protein 6 | 4.33e-04 | NA | 7.77e-09 |
| 3. B | Q108U1 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.79e-07 | NA | 5.17e-06 |
| 3. B | Q86U10 | 60 kDa lysophospholipase | 4.61e-07 | NA | 4.77e-06 |
| 3. B | Q60649 | Caseinolytic peptidase B protein homolog | 5.49e-04 | NA | 5.87e-05 |
| 3. B | Q2IBB1 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.83e-06 | NA | 8.02e-07 |
| 3. B | Q3SX00 | Ankyrin repeat domain-containing protein 46 | 3.17e-08 | NA | 1.93e-04 |
| 3. B | Q9SM23 | Acyl-CoA-binding domain-containing protein 1 | 5.64e-06 | NA | 8.70e-12 |
| 3. B | Q59H18 | Serine/threonine-protein kinase TNNI3K | 1.01e-05 | NA | 4.78e-05 |
| 3. B | Q99PE2 | Ankyrin repeat family A protein 2 | 3.15e-07 | NA | 1.34e-07 |
| 3. B | Q7ZYG4 | Osteoclast-stimulating factor 1 | 6.33e-07 | NA | 0.042 |
| 3. B | Q0VC93 | Ankyrin repeat domain-containing protein 37 | 7.11e-06 | NA | 0.038 |
| 3. B | Q9BSK4 | Protein fem-1 homolog A | 5.94e-06 | NA | 8.09e-10 |
| 3. B | Q9H9B1 | Histone-lysine N-methyltransferase EHMT1 | 1.90e-03 | NA | 1.52e-11 |
| 3. B | Q99ME3 | Synphilin-1 | 9.95e-04 | NA | 6.75e-04 |
| 3. B | Q9BQG2 | NAD-capped RNA hydrolase NUDT12 | 3.84e-03 | NA | 0.009 |
| 3. B | A0JNU3 | 60 kDa lysophospholipase | 3.78e-07 | NA | 1.42e-06 |
| 3. B | Q28BK1 | E3 ubiquitin-protein ligase HACE1 | 4.88e-05 | NA | 4.72e-07 |
| 3. B | D4A615 | Tonsoku-like protein | 4.42e-02 | NA | 9.02e-05 |
| 3. B | Q9J5I7 | Putative ankyrin repeat protein FPV014 | NA | NA | 9.95e-06 |
| 3. B | H3BUK9 | POTE ankyrin domain family member B2 | 1.27e-05 | NA | 8.36e-50 |
| 3. B | Q9BZF9 | Uveal autoantigen with coiled-coil domains and ankyrin repeats | 1.96e-03 | NA | 1.51e-06 |
| 3. B | Q9DAM9 | Fibronectin type 3 and ankyrin repeat domains 1 protein | 2.16e-08 | NA | 1.40e-11 |
| 3. B | Q8N283 | Ankyrin repeat domain-containing protein 35 | 2.55e-04 | NA | 3.89e-10 |
| 3. B | Q1RJR4 | Putative ankyrin repeat protein RBE_0319 | 6.95e-06 | NA | 0.001 |
| 3. B | O60733 | 85/88 kDa calcium-independent phospholipase A2 | 6.87e-05 | NA | 6.40e-10 |
| 3. B | Q8BLB8 | Ankyrin repeat domain-containing protein 34C | 1.09e-04 | NA | 3.66e-05 |
| 3. B | Q9ERK0 | Receptor-interacting serine/threonine-protein kinase 4 | 1.67e-06 | NA | 1.95e-08 |
| 3. B | Q810B6 | Rabankyrin-5 | 9.01e-04 | NA | 1.38e-07 |
| 3. B | Q9J517 | Putative ankyrin repeat protein FPV218 | NA | NA | 4.33e-05 |
| 3. B | Q09YJ3 | Cortactin-binding protein 2 | 8.47e-03 | NA | 3.75e-10 |
| 3. B | Q12955 | Ankyrin-3 | NA | NA | 8.80e-13 |
| 3. B | Q6TNT2 | Ankyrin repeat domain-containing protein 46 | 6.36e-08 | NA | 6.62e-04 |
| 3. B | Q8C0T1 | Protein fem-1 homolog A-B | 3.99e-05 | NA | 4.36e-11 |
| 3. B | A2RUV0 | Neurogenic locus notch homolog protein 1 | 1.54e-01 | NA | 1.59e-09 |
| 3. B | P04297 | Interferon antagonist K1L | NA | NA | 1.28e-04 |
| 3. B | Q38998 | Potassium channel AKT1 | 4.47e-04 | NA | 6.43e-06 |
| 3. B | Q80TN5 | Palmitoyltransferase ZDHHC17 | 9.75e-06 | NA | 1.45e-11 |
| 3. B | C9JTQ0 | Ankyrin repeat domain-containing protein 63 | 3.53e-07 | NA | 7.87e-04 |
| 3. B | Q7S3M5 | Palmitoyltransferase akr1 | 7.02e-05 | NA | 3.18e-12 |
| 3. B | Q7Z6G8 | Ankyrin repeat and sterile alpha motif domain-containing protein 1B | 2.83e-04 | NA | 7.52e-04 |
| 3. B | Q99LJ2 | Ankyrin repeat and BTB/POZ domain-containing protein 1 | 9.19e-03 | NA | 0.002 |
| 3. B | A5PLL1 | Ankyrin repeat domain-containing protein 34B | 1.23e-04 | NA | 0.008 |
| 3. B | Q5R5V4 | Integrin-linked protein kinase | 2.36e-06 | NA | 5.05e-09 |
| 3. B | Q4UKX2 | Putative ankyrin repeat protein RF_0950 | 9.90e-09 | NA | 1.27e-09 |
| 3. B | F1M5M3 | Inactive serine/threonine-protein kinase TEX14 | NA | NA | 2.45e-06 |
| 3. B | P62775 | Myotrophin | 2.01e-12 | NA | 0.006 |
| 3. B | Q6ZW76 | Ankyrin repeat and SAM domain-containing protein 3 | 4.61e-05 | NA | 3.76e-15 |
| 3. B | Q2IBB4 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.97e-07 | NA | 2.05e-06 |
| 3. B | Q9BYB0 | SH3 and multiple ankyrin repeat domains protein 3 | 1.67e-02 | NA | 7.56e-04 |
| 3. B | Q9TZM3 | Leucine-rich repeat serine/threonine-protein kinase 1 | 1.98e-01 | NA | 9.96e-10 |
| 3. B | P31695 | Neurogenic locus notch homolog protein 4 | 1.87e-02 | NA | 4.20e-07 |
| 3. B | Q8GXE6 | Potassium channel AKT6 | 5.63e-05 | NA | 1.75e-08 |
| 3. B | A0A140LI88 | Ankyrin repeat domain-containing protein 31 | 1.41e-01 | NA | 0.010 |
| 3. B | Q5E9N5 | Caseinolytic peptidase B protein homolog | 2.97e-04 | NA | 1.23e-04 |
| 3. B | Q09YK4 | Cortactin-binding protein 2 | 1.18e-02 | NA | 6.17e-08 |
| 3. B | Q8C8R3 | Ankyrin-2 | NA | NA | 2.58e-10 |
| 3. B | E1C656 | E3 ubiquitin-protein ligase HACE1 | 3.34e-06 | NA | 5.65e-07 |
| 3. B | Q6F6B3 | Protein TANC1 | 3.35e-03 | NA | 9.12e-11 |
| 3. B | P17369 | Ankyrin repeat protein 14 | NA | NA | 1.23e-04 |
| 3. B | Q86W74 | Ankyrin repeat domain-containing protein 46 | 1.01e-08 | NA | 1.93e-04 |
| 3. B | Q07DY6 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 2.50e-07 | NA | 6.44e-06 |
| 3. B | Q8N8V4 | Ankyrin repeat and SAM domain-containing protein 4B | 2.41e-05 | NA | 2.51e-05 |
| 3. B | Q7SIG6 | Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 | 2.02e-02 | NA | 0.009 |
| 3. B | Q4R7L8 | NAD-capped RNA hydrolase NUDT12 | 4.22e-03 | NA | 0.008 |
| 3. B | P40480 | Protein HOS4 | 3.13e-03 | NA | 7.61e-06 |
| 3. B | Q9UU77 | Ankyrin repeat-containing protein P1E11.10 | 5.04e-07 | NA | 0.003 |
| 3. B | Q9H9E1 | Ankyrin repeat family A protein 2 | 2.47e-08 | NA | 1.55e-08 |
| 3. B | Q6NXT1 | Ankyrin repeat domain-containing protein 54 | 1.05e-06 | NA | 1.23e-08 |
| 3. B | Q8BIZ1 | Ankyrin repeat and sterile alpha motif domain-containing protein 1B | 1.19e-03 | NA | 7.13e-04 |
| 3. B | Q6AWW5 | Ankyrin repeat-containing protein At5g02620 | 6.04e-07 | NA | 7.16e-10 |
| 3. B | Q9QZH2 | BRCA1-associated RING domain protein 1 | 5.64e-04 | NA | 8.76e-05 |
| 3. B | Q92HB1 | Putative ankyrin repeat protein RC0860 | 3.55e-05 | NA | 0.002 |
| 3. B | Q5T7N3 | KN motif and ankyrin repeat domain-containing protein 4 | 1.19e-03 | NA | 0.005 |
| 3. B | Q7ZT11 | Ankyrin repeat domain-containing protein 1 | 4.51e-10 | NA | 1.29e-14 |
| 3. B | Q07E43 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.58e-07 | NA | 2.99e-06 |
| 3. B | Q8TC84 | Fibronectin type 3 and ankyrin repeat domains protein 1 | 2.04e-08 | NA | 8.67e-12 |
| 3. B | Q9J503 | Putative ankyrin repeat protein FPV232 | NA | NA | 0.010 |
| 3. B | Q99728 | BRCA1-associated RING domain protein 1 | 4.96e-03 | NA | 6.12e-05 |
| 3. B | P97570 | 85/88 kDa calcium-independent phospholipase A2 | 7.62e-04 | NA | 9.36e-10 |
| 3. B | Q6S8J7 | POTE ankyrin domain family member A | 3.80e-07 | NA | 6.86e-52 |
| 3. B | Q07008 | Neurogenic locus notch homolog protein 1 | 1.12e-01 | NA | 1.15e-10 |
| 3. B | A3AYR1 | Acyl-CoA-binding domain-containing protein 4 | 1.29e-06 | NA | 1.21e-12 |
| 3. B | Q3UMR0 | Ankyrin repeat domain-containing protein 27 | 5.28e-04 | NA | 1.62e-07 |
| 3. B | Q9H078 | Caseinolytic peptidase B protein homolog | 2.03e-03 | NA | 1.00e-04 |
| 3. B | Q3T0F7 | Myotrophin | 2.10e-12 | NA | 0.006 |
| 3. B | Q811D2 | Ankyrin repeat domain-containing protein 26 | 4.30e-03 | NA | 1.34e-59 |
| 3. B | Q07DY4 | Cortactin-binding protein 2 | 1.40e-02 | NA | 1.93e-09 |
| 3. B | Q9VL06 | E3 ubiquitin-protein ligase Ufd4 | NA | NA | 0.011 |
| 3. B | Q9HCD6 | Protein TANC2 | 9.59e-03 | NA | 2.19e-10 |
| 3. B | A1X157 | Cortactin-binding protein 2 | 1.33e-02 | NA | 2.37e-10 |
| 3. B | Q9D3J5 | Ankyrin repeat domain-containing protein 22 | 6.66e-16 | NA | 4.08e-08 |
| 3. B | Q9Z148 | Histone-lysine N-methyltransferase EHMT2 | 2.23e-04 | NA | 1.02e-10 |
| 3. B | Q9GL21 | Uveal autoantigen with coiled-coil domains and ankyrin repeats | 1.63e-03 | NA | 1.65e-06 |
| 3. B | Q1RK13 | Putative ankyrin repeat protein RBE_0220 | 2.36e-05 | NA | 3.62e-08 |
| 3. B | Q54XX5 | Probable serine/threonine-protein kinase DDB_G0278535 | 1.87e-04 | NA | 2.41e-07 |
| 3. B | Q9CZK6 | Ankyrin repeat and SAM domain-containing protein 3 | 1.60e-06 | NA | 1.07e-16 |
| 3. B | Q5UPF8 | Putative ankyrin repeat protein L88 | NA | NA | 2.81e-07 |
| 3. B | Q99J82 | Integrin-linked protein kinase | 2.37e-06 | NA | 5.24e-09 |
| 3. B | Q2QLF8 | Cortactin-binding protein 2 | 1.67e-02 | NA | 6.21e-09 |
| 3. B | Q2IBF7 | Cortactin-binding protein 2 | 1.21e-02 | NA | 1.24e-08 |
| 3. B | Q71S22 | Inversin-A | 4.78e-04 | NA | 1.65e-12 |
| 3. B | Q8TAK5 | GA-binding protein subunit beta-2 | 1.13e-07 | NA | 1.95e-04 |
| 3. B | Q5XIU1 | Ankyrin repeat and BTB/POZ domain-containing protein 1 | 9.14e-03 | NA | 0.001 |
| 3. B | A0M8T3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 5.01e-07 | NA | 1.07e-06 |
| 3. B | Q5BJT1 | Ankyrin repeat domain-containing protein 34A | 1.02e-04 | NA | 1.65e-06 |
| 3. B | Q4UMH6 | Putative ankyrin repeat protein RF_0381 | 9.53e-05 | NA | 3.98e-15 |
| 3. B | P53355 | Death-associated protein kinase 1 | 5.26e-04 | NA | 7.81e-17 |
| 3. B | Q804S5 | E3 ubiquitin-protein ligase mib1 | 1.54e-04 | NA | 5.85e-11 |
| 3. B | Q8IYU2 | E3 ubiquitin-protein ligase HACE1 | 1.97e-06 | NA | 8.92e-08 |
| 3. B | Q875S9 | Palmitoyltransferase AKR1 | 1.37e-05 | NA | 1.67e-11 |
| 3. B | P0CS66 | Palmitoyltransferase AKR1 | 1.04e-05 | NA | 1.49e-14 |
| 3. B | Q6B858 | Fibronectin type 3 and ankyrin repeat domains protein 1 | 5.18e-11 | NA | 9.26e-12 |
| 3. B | Q8NB46 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 5.51e-04 | NA | 1.51e-11 |
| 3. B | Q9J4Z7 | Putative ankyrin repeat protein FPV243 | NA | NA | 0.020 |
| 3. B | Q5REW9 | Ankyrin repeat domain-containing protein 27 | 9.41e-05 | NA | 1.43e-09 |
| 3. B | Q863Z4 | Myotrophin | 2.16e-12 | NA | 0.006 |
| 3. B | Q6JAN1 | Inversin | 6.06e-04 | NA | 3.94e-12 |
| 3. B | G3V8T1 | M-phase phosphoprotein 8 | 2.64e-04 | NA | 1.51e-04 |
| 3. B | F4IS56 | Integrin-linked protein kinase 1 | 1.38e-03 | NA | 0.007 |
| 3. B | Q5RJK8 | Acyl-CoA-binding domain-containing protein 6 | 2.22e-06 | NA | 5.44e-10 |
| 3. B | D3ZBM7 | E3 ubiquitin-protein ligase HACE1 | 1.19e-04 | NA | 6.30e-08 |
| 3. B | Q9J5G9 | Putative ankyrin repeat protein FPV034 | NA | NA | 1.54e-10 |
| 3. B | A2AS55 | Ankyrin repeat domain-containing protein 16 | 1.10e-06 | NA | 0.006 |
| 3. B | Q2QLA4 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 3.00e-07 | NA | 3.05e-06 |
| 3. B | P23631 | Alpha-latrotoxin-Lt1a | 4.61e-03 | NA | 1.46e-05 |
| 3. B | P39010 | Palmitoyltransferase AKR1 | 3.72e-05 | NA | 2.81e-06 |
| 3. B | Q8WXD9 | Caskin-1 | 5.11e-04 | NA | 6.25e-07 |
| 3. B | Q8R560 | Ankyrin repeat domain-containing protein 1 | 1.23e-09 | NA | 8.23e-15 |
| 3. B | Q9FY48 | E3 ubiquitin-protein ligase KEG | 6.51e-03 | NA | 1.06e-06 |
| 3. B | Q54XY6 | Probable serine/threonine-protein kinase DDB_G0278521 | 1.22e-03 | NA | 0.008 |
| 3. B | A0A084B9Z8 | Ankyrin repeat domain-containing protein SAT10 | 6.27e-02 | NA | 2.56e-07 |
| 3. B | Q8WZ74 | Cortactin-binding protein 2 | 1.51e-02 | NA | 1.22e-08 |
| 3. B | Q3EC11 | Probable protein S-acyltransferase 23 | 1.60e-05 | NA | 6.41e-07 |
| 3. B | Q5B0V6 | Palmitoyltransferase akr1 | 1.33e-05 | NA | 7.05e-12 |
| 3. B | Q8BLD6 | Ankyrin repeat domain-containing protein 55 | 4.46e-05 | NA | 8.25e-05 |
| 3. B | Q6DRG7 | Protein phosphatase 1 regulatory subunit 12A | 1.11e-04 | NA | 8.79e-04 |
| 3. B | Q9VBP3 | Poly [ADP-ribose] polymerase tankyrase | 1.20e-03 | NA | 8.99e-06 |
| 3. B | Q7Z3H0 | Photoreceptor ankyrin repeat protein | 2.57e-05 | NA | 0.003 |
| 3. B | Q6DCL5 | E3 ubiquitin-protein ligase HACE1 | 2.33e-05 | NA | 6.31e-07 |
| 3. B | Q9BR61 | Acyl-CoA-binding domain-containing protein 6 | 1.52e-06 | NA | 5.08e-11 |
| 3. B | Q2QL82 | Cortactin-binding protein 2 | 9.99e-03 | NA | 4.47e-10 |
| 3. B | Q96NW4 | Ankyrin repeat domain-containing protein 27 | 2.38e-04 | NA | 8.65e-09 |