Results | PROST

Summary

A7E2S9

Homolog: Q978J0.
Function: Putative ankyrin repeat protein TV1425.

Statistics

Total GO Annotation: 835
Unique PROST Go: 70
Unique BLAST Go: 637

Total Homologs: 823
Unique PROST Homologs: 41
Unique BLAST Homologs: 689

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q978J0 (Putative ankyrin repeat protein TV1425) with a FATCAT P-Value: 0.0 and RMSD of 1.91 angstrom. The sequence alignment identity is 19.8%.
Structural alignment shown in left. Query protein A7E2S9 colored as red in alignment, homolog Q978J0 colored as blue. Query protein A7E2S9 is also shown in right top, homolog Q978J0 showed in right bottom. They are colored based on secondary structures.

  A7E2S9 MERLSAAPVKGQTGPERPSPFSQLVYTNNDSYVIHHGDLRKIHKAASRGQAWKLERMMKKTTMDLNIRDAKKRTALYWACANGHAEVVTLLVDRKC---Q 97
  Q978J0 --------------------------------------------------------------MD------K----------NG--EIVEKIKDEKSINQN 20

  A7E2S9 LDVL----DGENRTILMKALQCQ--REACANILI---DSGADPNIVDVYGNTAVHYAVNSENLSVVAKLLSCGADIEVKNKAGHTPLLLAIRKRSEEIVE 188
  Q978J0 LDFLRNYRDSYNRTPLM--VACMLGMENAIDKLVENFDKLEDK---DIEGSTALIWAVKNNRLGIAEKLLSKGSNVNTKDFSGKTPLMWSIIFGYSEMSY 115

  A7E2S9 FLLTKNANANAVDKFKCVHQQLLEYKQKISKNSQNSNP--EGTSEGTPDEAAPLAERTPD-TAESLVERTPDE-------------------- 258
  Q978J0 FLLEHGANVN--D-----------------RNLEGETPLIVASKYGRSEIVKKLLELGADISARDLTGLTAEASARIFGRQEVIKIFTEVRRA 189

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
1. PB	GO:0045581	negative regulation of T cell differentiation
1. PB	GO:0036336	dendritic cell migration
1. PB	GO:0042994	cytoplasmic sequestering of transcription factor
1. PB	GO:0032496	response to lipopolysaccharide
1. PB	GO:0000122	negative regulation of transcription by RNA polymerase II
1. PB	GO:0050729	positive regulation of inflammatory response
1. PB	GO:0048709	oligodendrocyte differentiation
1. PB	GO:0043619	regulation of transcription from RNA polymerase II promoter in response to oxidative stress
1. PB	GO:0031670	cellular response to nutrient
1. PB	GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process
1. PB	GO:0071345	cellular response to cytokine stimulus
1. PB	GO:0090263	positive regulation of canonical Wnt signaling pathway
1. PB	GO:0042088	T-helper 1 type immune response
1. PB	GO:0051059	NF-kappaB binding
1. PB	GO:0016567	protein ubiquitination
1. PB	GO:0007605	sensory perception of sound
1. PB	GO:0010888	negative regulation of lipid storage
1. PB	GO:0044877	protein-containing complex binding
1. PB	GO:0070198	protein localization to chromosome, telomeric region
1. PB	GO:0019887	protein kinase regulator activity
1. PB	GO:0010468	regulation of gene expression
1. PB	GO:0085020	protein K6-linked ubiquitination
1. PB	GO:0036371	protein localization to T-tubule
1. PB	GO:0033309	SBF transcription complex
1. PB	GO:0002467	germinal center formation
1. PB	GO:0001569	branching involved in blood vessel morphogenesis
1. PB	GO:0043066	negative regulation of apoptotic process
1. PB	GO:0007165	signal transduction
1. PB	GO:2000812	regulation of barbed-end actin filament capping
1. PB	GO:0010745	negative regulation of macrophage derived foam cell differentiation
1. PB	GO:1904355	positive regulation of telomere capping
1. PB	GO:0051101	regulation of DNA binding
1. PB	GO:0055013	cardiac muscle cell development
1. PB	GO:0045737	positive regulation of cyclin-dependent protein serine/threonine kinase activity
1. PB	GO:0061630	ubiquitin protein ligase activity
1. PB	GO:0033257	Bcl3/NF-kappaB2 complex
1. PB	GO:0031466	Cul5-RING ubiquitin ligase complex
1. PB	GO:0046822	regulation of nucleocytoplasmic transport
1. PB	GO:2000321	positive regulation of T-helper 17 cell differentiation
1. PB	GO:0019901	protein kinase binding
1. PB	GO:1902367	negative regulation of Notch signaling pathway involved in somitogenesis
1. PB	GO:0010225	response to UV-C
1. PB	GO:0030907	MBF transcription complex
1. PB	GO:0007219	Notch signaling pathway
1. PB	GO:2001214	positive regulation of vasculogenesis
1. PB	GO:0048536	spleen development
1. PB	GO:0035994	response to muscle stretch
1. PB	GO:0042826	histone deacetylase binding
1. PB	GO:1902230	negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage
1. PB	GO:0070427	nucleotide-binding oligomerization domain containing 1 signaling pathway
1. PB	GO:0050931	pigment cell differentiation
1. PB	GO:1902807	negative regulation of cell cycle G1/S phase transition
1. PB	GO:0033280	response to vitamin D
1. PB	GO:0006913	nucleocytoplasmic transport
1. PB	GO:0002040	sprouting angiogenesis
1. PB	GO:0045064	T-helper 2 cell differentiation
1. PB	GO:0080173	male-female gamete recognition during double fertilization forming a zygote and endosperm
1. PB	GO:0071222	cellular response to lipopolysaccharide
1. PB	GO:0000731	DNA synthesis involved in DNA repair
1. PB	GO:0035914	skeletal muscle cell differentiation
1. PB	GO:0032996	Bcl3-Bcl10 complex
1. PB	GO:0071800	podosome assembly
1. PB	GO:0043517	positive regulation of DNA damage response, signal transduction by p53 class mediator
1. PB	GO:0034142	toll-like receptor 4 signaling pathway
1. PB	GO:0000082	G1/S transition of mitotic cell cycle
1. PB	GO:0002455	humoral immune response mediated by circulating immunoglobulin
1. PB	GO:1901222	regulation of NIK/NF-kappaB signaling
1. PB	GO:0000151	ubiquitin ligase complex
1. PB	GO:0043409	negative regulation of MAPK cascade
1. PB	GO:0045859	regulation of protein kinase activity
1. PB	GO:0055007	cardiac muscle cell differentiation
1. PB	GO:0031625	ubiquitin protein ligase binding
1. PB	GO:0003713	transcription coactivator activity
1. PB	GO:0007249	I-kappaB kinase/NF-kappaB signaling
1. PB	GO:0008285	negative regulation of cell population proliferation
1. PB	GO:0010313	phytochrome binding
1. PB	GO:0045638	negative regulation of myeloid cell differentiation
1. PB	GO:0071931	positive regulation of transcription involved in G1/S transition of mitotic cell cycle
1. PB	GO:0033209	tumor necrosis factor-mediated signaling pathway
1. PB	GO:0008139	nuclear localization sequence binding
1. PB	GO:0090201	negative regulation of release of cytochrome c from mitochondria
1. PB	GO:0001947	heart looping
1. PB	GO:0048102	autophagic cell death
1. PB	GO:0030496	midbody
1. PB	GO:0005634	nucleus
1. PB	GO:0045732	positive regulation of protein catabolic process
1. PB	GO:0097129	cyclin D2-CDK4 complex
1. PB	GO:0007253	cytoplasmic sequestering of NF-kappaB
1. PB	GO:1990756	ubiquitin ligase-substrate adaptor activity
1. PB	GO:0014732	skeletal muscle atrophy
1. PB	GO:0031432	titin binding
1. PB	GO:0010875	positive regulation of cholesterol efflux
1. PB	GO:0022407	regulation of cell-cell adhesion
1. PB	GO:0045746	negative regulation of Notch signaling pathway
1. PB	GO:0043518	negative regulation of DNA damage response, signal transduction by p53 class mediator
1. PB	GO:0043330	response to exogenous dsRNA
1. PB	GO:0010923	negative regulation of phosphatase activity
1. PB	GO:0002043	blood vessel endothelial cell proliferation involved in sprouting angiogenesis
1. PB	GO:0009411	response to UV
1. PB	GO:0031663	lipopolysaccharide-mediated signaling pathway
1. PB	GO:0002315	marginal zone B cell differentiation
1. PB	GO:0010832	negative regulation of myotube differentiation
1. PB	GO:0070682	proteasome regulatory particle assembly
1. PB	GO:0045648	positive regulation of erythrocyte differentiation
1. PB	GO:0033256	I-kappaB/NF-kappaB complex
1. PB	GO:0032991	protein-containing complex
1. PB	GO:0032495	response to muramyl dipeptide
1. PB	GO:0005829	cytosol
1. PB	GO:0004861	cyclin-dependent protein serine/threonine kinase inhibitor activity
1. PB	GO:0009644	response to high light intensity
1. PB	GO:0070431	nucleotide-binding oligomerization domain containing 2 signaling pathway
1. PB	GO:0051726	regulation of cell cycle
1. PB	GO:0002268	follicular dendritic cell differentiation
1. PB	GO:1902531	regulation of intracellular signal transduction
1. PB	GO:0031436	BRCA1-BARD1 complex
1. PB	GO:0032525	somite rostral/caudal axis specification
1. PB	GO:0035556	intracellular signal transduction
1. PB	GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process
1. PB	GO:0045944	positive regulation of transcription by RNA polymerase II
1. PB	GO:0071407	cellular response to organic cyclic compound
1. PB	GO:0042326	negative regulation of phosphorylation
1. PB	GO:0030307	positive regulation of cell growth
1. PB	GO:0045893	positive regulation of transcription, DNA-templated
1. PB	GO:0014070	response to organic cyclic compound
1. PB	GO:0019730	antimicrobial humoral response
1. PB	GO:0032270	positive regulation of cellular protein metabolic process
1. PB	GO:0032088	negative regulation of NF-kappaB transcription factor activity
1. PB	GO:0005654	nucleoplasm
2. P	GO:1902510	regulation of apoptotic DNA fragmentation
2. P	GO:0002523	leukocyte migration involved in inflammatory response
2. P	GO:0001938	positive regulation of endothelial cell proliferation
2. P	GO:2000346	negative regulation of hepatocyte proliferation
2. P	GO:0090398	cellular senescence
2. P	GO:0031542	positive regulation of anthocyanin biosynthetic process
2. P	GO:0008134	transcription factor binding
2. P	GO:0090399	replicative senescence
2. P	GO:0042771	intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
2. P	GO:0031398	positive regulation of protein ubiquitination
2. P	GO:0032717	negative regulation of interleukin-8 production
2. P	GO:0035986	obsolete senescence-associated heterochromatin focus assembly
2. P	GO:0060058	positive regulation of apoptotic process involved in mammary gland involution
2. P	GO:0045111	intermediate filament cytoskeleton
2. P	GO:2000291	regulation of myoblast proliferation
2. P	GO:0032720	negative regulation of tumor necrosis factor production
2. P	GO:0030430	host cell cytoplasm
2. P	GO:2000813	negative regulation of barbed-end actin filament capping
2. P	GO:0030308	negative regulation of cell growth
2. P	GO:1903214	regulation of protein targeting to mitochondrion
2. P	GO:0051882	mitochondrial depolarization
2. P	GO:0031532	actin cytoskeleton reorganization
2. P	GO:1902253	regulation of intrinsic apoptotic signaling pathway by p53 class mediator
2. P	GO:0039517	modulation by virus of host protein serine/threonine phosphatase activity
2. P	GO:0061408	positive regulation of transcription from RNA polymerase II promoter in response to heat stress
2. P	GO:1904667	negative regulation of ubiquitin protein ligase activity
2. P	GO:1990948	ubiquitin ligase inhibitor activity
2. P	GO:2000111	positive regulation of macrophage apoptotic process
2. P	GO:0070316	regulation of G0 to G1 transition
2. P	GO:0033600	negative regulation of mammary gland epithelial cell proliferation
2. P	GO:0097371	MDM2/MDM4 family protein binding
2. P	GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity
2. P	GO:0030539	male genitalia development
2. P	GO:0034393	positive regulation of smooth muscle cell apoptotic process
2. P	GO:0035985	senescence-associated heterochromatin focus
2. P	GO:1903051	negative regulation of proteolysis involved in cellular protein catabolic process
2. P	GO:0010218	response to far red light
2. P	GO:0032733	positive regulation of interleukin-10 production
2. P	GO:0000502	proteasome complex
2. P	GO:0019902	phosphatase binding
2. P	GO:0033235	positive regulation of protein sumoylation
2. P	GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
2. P	GO:0050852	T cell receptor signaling pathway
2. P	GO:0009567	double fertilization forming a zygote and endosperm
2. P	GO:0033085	negative regulation of T cell differentiation in thymus
2. P	GO:0032729	positive regulation of interferon-gamma production
2. P	GO:0006606	protein import into nucleus
2. P	GO:0030330	DNA damage response, signal transduction by p53 class mediator
2. P	GO:0039513	suppression by virus of host catalytic activity
2. P	GO:0070245	positive regulation of thymocyte apoptotic process
2. P	GO:0004864	protein phosphatase inhibitor activity
2. P	GO:0009615	response to virus
2. P	GO:0045736	negative regulation of cyclin-dependent protein serine/threonine kinase activity
2. P	GO:0042832	defense response to protozoan
2. P	GO:0046825	regulation of protein export from nucleus
2. P	GO:0042127	regulation of cell population proliferation
2. P	GO:0030219	megakaryocyte differentiation
2. P	GO:0001953	negative regulation of cell-matrix adhesion
2. P	GO:1901798	positive regulation of signal transduction by p53 class mediator
2. P	GO:0140297	DNA-binding transcription factor binding
2. P	GO:0097602	cullin family protein binding
2. P	GO:0043422	protein kinase B binding
2. P	GO:2000435	negative regulation of protein neddylation
2. P	GO:0039644	suppression by virus of host NF-kappaB cascade
2. P	GO:0046426	negative regulation of receptor signaling pathway via JAK-STAT
2. P	GO:0010845	positive regulation of reciprocal meiotic recombination
2. P	GO:0048145	regulation of fibroblast proliferation
2. P	GO:0032526	response to retinoic acid
2. P	GO:2000774	positive regulation of cellular senescence
2. P	GO:0006878	cellular copper ion homeostasis
3. B	GO:0005770	late endosome
3. B	GO:0034765	regulation of ion transmembrane transport
3. B	GO:0007094	mitotic spindle assembly checkpoint signaling
3. B	GO:0071625	vocalization behavior
3. B	GO:0048337	positive regulation of mesodermal cell fate specification
3. B	GO:0090037	positive regulation of protein kinase C signaling
3. B	GO:0051835	positive regulation of synapse structural plasticity
3. B	GO:0006511	ubiquitin-dependent protein catabolic process
3. B	GO:0043011	myeloid dendritic cell differentiation
3. B	GO:0035148	tube formation
3. B	GO:0007507	heart development
3. B	GO:0001701	in utero embryonic development
3. B	GO:0072104	glomerular capillary formation
3. B	GO:1903779	regulation of cardiac conduction
3. B	GO:0070563	negative regulation of vitamin D receptor signaling pathway
3. B	GO:0030334	regulation of cell migration
3. B	GO:0032421	stereocilium bundle
3. B	GO:0003270	Notch signaling pathway involved in regulation of secondary heart field cardioblast proliferation
3. B	GO:0010812	negative regulation of cell-substrate adhesion
3. B	GO:0001756	somitogenesis
3. B	GO:2001259	positive regulation of cation channel activity
3. B	GO:0051247	positive regulation of protein metabolic process
3. B	GO:0021514	ventral spinal cord interneuron differentiation
3. B	GO:1903522	regulation of blood circulation
3. B	GO:0070372	regulation of ERK1 and ERK2 cascade
3. B	GO:0060412	ventricular septum morphogenesis
3. B	GO:0014044	Schwann cell development
3. B	GO:0006306	DNA methylation
3. B	GO:0097190	apoptotic signaling pathway
3. B	GO:0106310	protein serine kinase activity
3. B	GO:0003252	negative regulation of cell proliferation involved in heart valve morphogenesis
3. B	GO:0006959	humoral immune response
3. B	GO:0004842	ubiquitin-protein transferase activity
3. B	GO:0047499	calcium-independent phospholipase A2 activity
3. B	GO:0043403	skeletal muscle tissue regeneration
3. B	GO:0007140	male meiotic nuclear division
3. B	GO:0001837	epithelial to mesenchymal transition
3. B	GO:0051494	negative regulation of cytoskeleton organization
3. B	GO:0048259	regulation of receptor-mediated endocytosis
3. B	GO:0045070	positive regulation of viral genome replication
3. B	GO:0003950	NAD+ ADP-ribosyltransferase activity
3. B	GO:0050885	neuromuscular process controlling balance
3. B	GO:0021519	spinal cord association neuron specification
3. B	GO:0035264	multicellular organism growth
3. B	GO:0015095	magnesium ion transmembrane transporter activity
3. B	GO:0045611	negative regulation of hemocyte differentiation
3. B	GO:0035622	intrahepatic bile duct development
3. B	GO:2000822	regulation of behavioral fear response
3. B	GO:0045036	protein targeting to chloroplast
3. B	GO:0016571	histone methylation
3. B	GO:0043254	regulation of protein-containing complex assembly
3. B	GO:0010765	positive regulation of sodium ion transport
3. B	GO:0035304	regulation of protein dephosphorylation
3. B	GO:0071546	pi-body
3. B	GO:0010557	positive regulation of macromolecule biosynthetic process
3. B	GO:0003162	atrioventricular node development
3. B	GO:0035690
3. B	GO:0007283	spermatogenesis
3. B	GO:0007492	endoderm development
3. B	GO:0048549	positive regulation of pinocytosis
3. B	GO:0010956	negative regulation of calcidiol 1-monooxygenase activity
3. B	GO:0030534	adult behavior
3. B	GO:0031069	hair follicle morphogenesis
3. B	GO:0086015	SA node cell action potential
3. B	GO:0032466	negative regulation of cytokinesis
3. B	GO:0110156	methylguanosine-cap decapping
3. B	GO:1990404	protein ADP-ribosylase activity
3. B	GO:0005903	brush border
3. B	GO:0097107	postsynaptic density assembly
3. B	GO:0061073	ciliary body morphogenesis
3. B	GO:0051092	positive regulation of NF-kappaB transcription factor activity
3. B	GO:0036464	cytoplasmic ribonucleoprotein granule
3. B	GO:0003151	outflow tract morphogenesis
3. B	GO:0007520	myoblast fusion
3. B	GO:0072014	proximal tubule development
3. B	GO:0002437	inflammatory response to antigenic stimulus
3. B	GO:0002039	p53 binding
3. B	GO:0002052	positive regulation of neuroblast proliferation
3. B	GO:0071354	cellular response to interleukin-6
3. B	GO:0042734	presynaptic membrane
3. B	GO:0031462	Cul2-RING ubiquitin ligase complex
3. B	GO:0048715	negative regulation of oligodendrocyte differentiation
3. B	GO:0006742	NADP catabolic process
3. B	GO:1990433	CSL-Notch-Mastermind transcription factor complex
3. B	GO:0005123	death receptor binding
3. B	GO:0032426	stereocilium tip
3. B	GO:0008608	attachment of spindle microtubules to kinetochore
3. B	GO:1900273	positive regulation of long-term synaptic potentiation
3. B	GO:0043008	ATP-dependent protein binding
3. B	GO:0048056	R3/R4 cell differentiation
3. B	GO:0003160	endocardium morphogenesis
3. B	GO:0043086	negative regulation of catalytic activity
3. B	GO:0022011	myelination in peripheral nervous system
3. B	GO:0050894	determination of affect
3. B	GO:0001709	cell fate determination
3. B	GO:0099562	maintenance of postsynaptic density structure
3. B	GO:0000209	protein polyubiquitination
3. B	GO:0097546	ciliary base
3. B	GO:0002027	regulation of heart rate
3. B	GO:0035116	embryonic hindlimb morphogenesis
3. B	GO:2000178	negative regulation of neural precursor cell proliferation
3. B	GO:1904970	brush border assembly
3. B	GO:0044325	transmembrane transporter binding
3. B	GO:0008593	regulation of Notch signaling pathway
3. B	GO:0072116	pronephros formation
3. B	GO:0072574	hepatocyte proliferation
3. B	GO:1990760	osmolarity-sensing cation channel activity
3. B	GO:0010629	negative regulation of gene expression
3. B	GO:0046875	ephrin receptor binding
3. B	GO:0010366	negative regulation of ethylene biosynthetic process
3. B	GO:0001763	morphogenesis of a branching structure
3. B	GO:0030660	Golgi-associated vesicle membrane
3. B	GO:0002789	negative regulation of antifungal peptide production
3. B	GO:0072044	collecting duct development
3. B	GO:0046826	negative regulation of protein export from nucleus
3. B	GO:1900246	positive regulation of RIG-I signaling pathway
3. B	GO:1904901	positive regulation of myosin II filament organization
3. B	GO:0070528	protein kinase C signaling
3. B	GO:0060999	positive regulation of dendritic spine development
3. B	GO:0005516	calmodulin binding
3. B	GO:0045603	positive regulation of endothelial cell differentiation
3. B	GO:0110153	RNA NAD-cap (NMN-forming) hydrolase activity
3. B	GO:0035774	positive regulation of insulin secretion involved in cellular response to glucose stimulus
3. B	GO:0097604	temperature-gated cation channel activity
3. B	GO:0070213	protein auto-ADP-ribosylation
3. B	GO:0004672	protein kinase activity
3. B	GO:0046427	positive regulation of receptor signaling pathway via JAK-STAT
3. B	GO:0055016	hypochord development
3. B	GO:0031877	somatostatin receptor binding
3. B	GO:0048812	neuron projection morphogenesis
3. B	GO:0033292	T-tubule organization
3. B	GO:0006967	positive regulation of antifungal peptide biosynthetic process
3. B	GO:0005769	early endosome
3. B	GO:0071356	cellular response to tumor necrosis factor
3. B	GO:0045665	negative regulation of neuron differentiation
3. B	GO:0071372	cellular response to follicle-stimulating hormone stimulus
3. B	GO:0061629	RNA polymerase II-specific DNA-binding transcription factor binding
3. B	GO:1904108	protein localization to ciliary inversin compartment
3. B	GO:0009950	dorsal/ventral axis specification
3. B	GO:0005525	GTP binding
3. B	GO:1900245	positive regulation of MDA-5 signaling pathway
3. B	GO:0045747	positive regulation of Notch signaling pathway
3. B	GO:0006915	apoptotic process
3. B	GO:0035924	cellular response to vascular endothelial growth factor stimulus
3. B	GO:0097114	NMDA glutamate receptor clustering
3. B	GO:0106311
3. B	GO:0014832	urinary bladder smooth muscle contraction
3. B	GO:0071889	14-3-3 protein binding
3. B	GO:0090521	glomerular visceral epithelial cell migration
3. B	GO:0050768	negative regulation of neurogenesis
3. B	GO:0099092	postsynaptic density, intracellular component
3. B	GO:0005249	voltage-gated potassium channel activity
3. B	GO:0045211	postsynaptic membrane
3. B	GO:0010838	positive regulation of keratinocyte proliferation
3. B	GO:0046834	lipid phosphorylation
3. B	GO:0090083	regulation of inclusion body assembly
3. B	GO:0010976	positive regulation of neuron projection development
3. B	GO:0030017	sarcomere
3. B	GO:0043491	protein kinase B signaling
3. B	GO:0005902	microvillus
3. B	GO:0016055	Wnt signaling pathway
3. B	GO:0048873	homeostasis of number of cells within a tissue
3. B	GO:0051967	negative regulation of synaptic transmission, glutamatergic
3. B	GO:0061195	taste bud formation
3. B	GO:0018345	protein palmitoylation
3. B	GO:1904106	protein localization to microvillus
3. B	GO:0032288	myelin assembly
3. B	GO:0021515	cell differentiation in spinal cord
3. B	GO:1900127	positive regulation of hyaluronan biosynthetic process
3. B	GO:0002011	morphogenesis of an epithelial sheet
3. B	GO:0071212	subsynaptic reticulum
3. B	GO:0014807	regulation of somitogenesis
3. B	GO:0090090	negative regulation of canonical Wnt signaling pathway
3. B	GO:0030279	negative regulation of ossification
3. B	GO:0048663	neuron fate commitment
3. B	GO:0030016	myofibril
3. B	GO:0006584	catecholamine metabolic process
3. B	GO:0060743	epithelial cell maturation involved in prostate gland development
3. B	GO:0003182	coronary sinus valve morphogenesis
3. B	GO:0055117	regulation of cardiac muscle contraction
3. B	GO:1902339	positive regulation of apoptotic process involved in morphogenesis
3. B	GO:0044605	phosphocholine transferase activity
3. B	GO:0006929	substrate-dependent cell migration
3. B	GO:0030424	axon
3. B	GO:0007409	axonogenesis
3. B	GO:0051146	striated muscle cell differentiation
3. B	GO:0045171	intercellular bridge
3. B	GO:0110155	NAD-cap decapping
3. B	GO:0035255	ionotropic glutamate receptor binding
3. B	GO:0003714	transcription corepressor activity
3. B	GO:0043069	negative regulation of programmed cell death
3. B	GO:1902260	negative regulation of delayed rectifier potassium channel activity
3. B	GO:0031013	troponin I binding
3. B	GO:0031430	M band
3. B	GO:0043046	DNA methylation involved in gamete generation
3. B	GO:0090238	positive regulation of arachidonic acid secretion
3. B	GO:0045751	negative regulation of Toll signaling pathway
3. B	GO:0072576	liver morphogenesis
3. B	GO:0007030	Golgi organization
3. B	GO:0045838	positive regulation of membrane potential
3. B	GO:0005929	cilium
3. B	GO:1902263	apoptotic process involved in embryonic digit morphogenesis
3. B	GO:0035172	hemocyte proliferation
3. B	GO:0003344	pericardium morphogenesis
3. B	GO:0044030	regulation of DNA methylation
3. B	GO:0060076	excitatory synapse
3. B	GO:0070742	C2H2 zinc finger domain binding
3. B	GO:0140627	ubiquitin-dependent protein catabolic process via the C-end degron rule pathway
3. B	GO:0003208	cardiac ventricle morphogenesis
3. B	GO:0003214	cardiac left ventricle morphogenesis
3. B	GO:0007613	memory
3. B	GO:0010424	DNA methylation on cytosine within a CG sequence
3. B	GO:0014731	spectrin-associated cytoskeleton
3. B	GO:0044309	neuron spine
3. B	GO:0005737	cytoplasm
3. B	GO:0098978	glutamatergic synapse
3. B	GO:2000001	regulation of DNA damage checkpoint
3. B	GO:0072114	pronephros morphogenesis
3. B	GO:0010882	regulation of cardiac muscle contraction by calcium ion signaling
3. B	GO:0043005	neuron projection
3. B	GO:0098871	postsynaptic actin cytoskeleton
3. B	GO:0097435	supramolecular fiber organization
3. B	GO:1904385	cellular response to angiotensin
3. B	GO:0035153	epithelial cell type specification, open tracheal system
3. B	GO:0046331	lateral inhibition
3. B	GO:0014704	intercalated disc
3. B	GO:0097113	AMPA glutamate receptor clustering
3. B	GO:0046959	habituation
3. B	GO:0001955	blood vessel maturation
3. B	GO:0099519	dense core granule cytoskeletal transport
3. B	GO:0038023	signaling receptor activity
3. B	GO:0060354	negative regulation of cell adhesion molecule production
3. B	GO:0031441	negative regulation of mRNA 3'-end processing
3. B	GO:0032232	negative regulation of actin filament bundle assembly
3. B	GO:0034638	phosphatidylcholine catabolic process
3. B	GO:0021546	rhombomere development
3. B	GO:0003332	negative regulation of extracellular matrix constituent secretion
3. B	GO:0046976	histone methyltransferase activity (H3-K27 specific)
3. B	GO:1905274	regulation of modification of postsynaptic actin cytoskeleton
3. B	GO:0045794	negative regulation of cell volume
3. B	GO:0005856	cytoskeleton
3. B	GO:0009862	systemic acquired resistance, salicylic acid mediated signaling pathway
3. B	GO:1904717	regulation of AMPA glutamate receptor clustering
3. B	GO:0031047	gene silencing by RNA
3. B	GO:0042048	olfactory behavior
3. B	GO:0071447	cellular response to hydroperoxide
3. B	GO:0032580	Golgi cisterna membrane
3. B	GO:0016529	sarcoplasmic reticulum
3. B	GO:0060288	formation of a compartment boundary
3. B	GO:0051497	negative regulation of stress fiber assembly
3. B	GO:0140374	antiviral innate immune response
3. B	GO:0030034	microvillar actin bundle assembly
3. B	GO:1904743	negative regulation of telomeric DNA binding
3. B	GO:0071347	cellular response to interleukin-1
3. B	GO:1900383	regulation of synaptic plasticity by receptor localization to synapse
3. B	GO:0003241	growth involved in heart morphogenesis
3. B	GO:0072660	maintenance of protein location in plasma membrane
3. B	GO:0015629	actin cytoskeleton
3. B	GO:0009967	positive regulation of signal transduction
3. B	GO:0071359	cellular response to dsRNA
3. B	GO:0060289	compartment boundary maintenance
3. B	GO:0031674	I band
3. B	GO:2000134	negative regulation of G1/S transition of mitotic cell cycle
3. B	GO:0043197	dendritic spine
3. B	GO:0005112	Notch binding
3. B	GO:0003198	epithelial to mesenchymal transition involved in endocardial cushion formation
3. B	GO:0102991	myristoyl-CoA hydrolase activity
3. B	GO:1901187	regulation of ephrin receptor signaling pathway
3. B	GO:0001889	liver development
3. B	GO:0045197	establishment or maintenance of epithelial cell apical/basal polarity
3. B	GO:0060674	placenta blood vessel development
3. B	GO:0039529	RIG-I signaling pathway
3. B	GO:0036309	protein localization to M-band
3. B	GO:0065001	specification of axis polarity
3. B	GO:0000287	magnesium ion binding
3. B	GO:0060317	cardiac epithelial to mesenchymal transition
3. B	GO:0097117	guanylate kinase-associated protein clustering
3. B	GO:0086069	bundle of His cell to Purkinje myocyte communication
3. B	GO:0060948	cardiac vascular smooth muscle cell development
3. B	GO:0098919	structural constituent of postsynaptic density
3. B	GO:0034446	substrate adhesion-dependent cell spreading
3. B	GO:0002357	defense response to tumor cell
3. B	GO:0002070	epithelial cell maturation
3. B	GO:0051968	positive regulation of synaptic transmission, glutamatergic
3. B	GO:0034112	positive regulation of homotypic cell-cell adhesion
3. B	GO:0060442	branching involved in prostate gland morphogenesis
3. B	GO:0006471	protein ADP-ribosylation
3. B	GO:0070531	BRCA1-A complex
3. B	GO:0030154	cell differentiation
3. B	GO:0060842	arterial endothelial cell differentiation
3. B	GO:0086070	SA node cell to atrial cardiac muscle cell communication
3. B	GO:1900452	regulation of long-term synaptic depression
3. B	GO:0045955	negative regulation of calcium ion-dependent exocytosis
3. B	GO:0070972	protein localization to endoplasmic reticulum
3. B	GO:0090160	Golgi to lysosome transport
3. B	GO:2001027	negative regulation of endothelial cell chemotaxis
3. B	GO:0043268	positive regulation of potassium ion transport
3. B	GO:0016021	integral component of membrane
3. B	GO:0031267	small GTPase binding
3. B	GO:0060035	notochord cell development
3. B	GO:0002193	MAML1-RBP-Jkappa- ICN1 complex
3. B	GO:0046579	positive regulation of Ras protein signal transduction
3. B	GO:0045685	regulation of glial cell differentiation
3. B	GO:0030513	positive regulation of BMP signaling pathway
3. B	GO:2000737	negative regulation of stem cell differentiation
3. B	GO:0048754	branching morphogenesis of an epithelial tube
3. B	GO:2001279	regulation of unsaturated fatty acid biosynthetic process
3. B	GO:0010001	glial cell differentiation
3. B	GO:0000062	fatty-acyl-CoA binding
3. B	GO:1900827	positive regulation of membrane depolarization during cardiac muscle cell action potential
3. B	GO:0031960	response to corticosteroid
3. B	GO:0060074	synapse maturation
3. B	GO:0003256	regulation of transcription from RNA polymerase II promoter involved in myocardial precursor cell differentiation
3. B	GO:1901201	regulation of extracellular matrix assembly
3. B	GO:0048892	lateral line nerve development
3. B	GO:0032049	cardiolipin biosynthetic process
3. B	GO:0008093	cytoskeletal anchor activity
3. B	GO:0010667	negative regulation of cardiac muscle cell apoptotic process
3. B	GO:0038061	NIK/NF-kappaB signaling
3. B	GO:0003170	heart valve development
3. B	GO:0005938	cell cortex
3. B	GO:0042802	identical protein binding
3. B	GO:0048708	astrocyte differentiation
3. B	GO:0030674	protein-macromolecule adaptor activity
3. B	GO:0001708	cell fate specification
3. B	GO:0046486	glycerolipid metabolic process
3. B	GO:0034058	endosomal vesicle fusion
3. B	GO:0003222	ventricular trabecula myocardium morphogenesis
3. B	GO:0030326	embryonic limb morphogenesis
3. B	GO:0060740	prostate gland epithelium morphogenesis
3. B	GO:0030837	negative regulation of actin filament polymerization
3. B	GO:0071286	cellular response to magnesium ion
3. B	GO:0090309	positive regulation of DNA methylation-dependent heterochromatin assembly
3. B	GO:0060411	cardiac septum morphogenesis
3. B	GO:0097237	cellular response to toxic substance
3. B	GO:1905938	positive regulation of germ cell proliferation
3. B	GO:0050775	positive regulation of dendrite morphogenesis
3. B	GO:0060113	inner ear receptor cell differentiation
3. B	GO:0045967	negative regulation of growth rate
3. B	GO:0043034	costamere
3. B	GO:0021986	habenula development
3. B	GO:0018230	peptidyl-L-cysteine S-palmitoylation
3. B	GO:0032791	lead ion binding
3. B	GO:0031297	replication fork processing
3. B	GO:0030046	parallel actin filament bundle assembly
3. B	GO:0046843	dorsal appendage formation
3. B	GO:0036166	phenotypic switching
3. B	GO:0046469	platelet activating factor metabolic process
3. B	GO:0070986	left/right axis specification
3. B	GO:1990416	cellular response to brain-derived neurotrophic factor stimulus
3. B	GO:0005576	extracellular region
3. B	GO:0046974	histone methyltransferase activity (H3-K9 specific)
3. B	GO:0098908	regulation of neuronal action potential
3. B	GO:0018024	histone-lysine N-methyltransferase activity
3. B	GO:0045814	negative regulation of gene expression, epigenetic
3. B	GO:0021915	neural tube development
3. B	GO:0030018	Z disc
3. B	GO:0042805	actinin binding
3. B	GO:0036377	arbuscular mycorrhizal association
3. B	GO:0043063	intercellular bridge organization
3. B	GO:0046473	phosphatidic acid metabolic process
3. B	GO:0007221	positive regulation of transcription of Notch receptor target
3. B	GO:0099612	protein localization to axon
3. B	GO:0061419	positive regulation of transcription from RNA polymerase II promoter in response to hypoxia
3. B	GO:0005524	ATP binding
3. B	GO:1902041	regulation of extrinsic apoptotic signaling pathway via death domain receptors
3. B	GO:1905456	regulation of lymphoid progenitor cell differentiation
3. B	GO:0045669	positive regulation of osteoblast differentiation
3. B	GO:0042686	regulation of cardioblast cell fate specification
3. B	GO:0046338	phosphatidylethanolamine catabolic process
3. B	GO:0071260	cellular response to mechanical stimulus
3. B	GO:0090216	positive regulation of 1-phosphatidylinositol-4-phosphate 5-kinase activity
3. B	GO:0097422	tubular endosome
3. B	GO:0071316	cellular response to nicotine
3. B	GO:0018027	peptidyl-lysine dimethylation
3. B	GO:0035176	social behavior
3. B	GO:0010960	magnesium ion homeostasis
3. B	GO:0080085	signal recognition particle, chloroplast targeting
3. B	GO:2001204	regulation of osteoclast development
3. B	GO:0001650	fibrillar center
3. B	GO:0140261	BCOR complex
3. B	GO:0035418	protein localization to synapse
3. B	GO:0005886	plasma membrane
3. B	GO:0042325	regulation of phosphorylation
3. B	GO:0010614	negative regulation of cardiac muscle hypertrophy
3. B	GO:0021675	nerve development
3. B	GO:2000022	regulation of jasmonic acid mediated signaling pathway
3. B	GO:0035646	endosome to melanosome transport
3. B	GO:0044232	organelle membrane contact site
3. B	GO:0048899	anterior lateral line development
3. B	GO:0033147	negative regulation of intracellular estrogen receptor signaling pathway
3. B	GO:0062043	positive regulation of cardiac epithelial to mesenchymal transition
3. B	GO:0070208	protein heterotrimerization
3. B	GO:0001222	transcription corepressor binding
3. B	GO:0045316	negative regulation of compound eye photoreceptor development
3. B	GO:0007009	plasma membrane organization
3. B	GO:0045607	regulation of inner ear auditory receptor cell differentiation
3. B	GO:0043292	contractile fiber
3. B	GO:0019843	rRNA binding
3. B	GO:0070212	protein poly-ADP-ribosylation
3. B	GO:1900271	regulation of long-term synaptic potentiation
3. B	GO:2000048	negative regulation of cell-cell adhesion mediated by cadherin
3. B	GO:1904058	positive regulation of sensory perception of pain
3. B	GO:0060979	vasculogenesis involved in coronary vascular morphogenesis
3. B	GO:0007160	cell-matrix adhesion
3. B	GO:0009066	aspartate family amino acid metabolic process
3. B	GO:0030160	synaptic receptor adaptor activity
3. B	GO:0045662	negative regulation of myoblast differentiation
3. B	GO:0019228	neuronal action potential
3. B	GO:0072017	distal tubule development
3. B	GO:0046339	diacylglycerol metabolic process
3. B	GO:0007440	foregut morphogenesis
3. B	GO:0048711	positive regulation of astrocyte differentiation
3. B	GO:0072073	kidney epithelium development
3. B	GO:0004622	lysophospholipase activity
3. B	GO:0035023	regulation of Rho protein signal transduction
3. B	GO:0072357	PTW/PP1 phosphatase complex
3. B	GO:0007386	compartment pattern specification
3. B	GO:0008022	protein C-terminus binding
3. B	GO:0010650	positive regulation of cell communication by electrical coupling
3. B	GO:0003181	atrioventricular valve morphogenesis
3. B	GO:0090051	negative regulation of cell migration involved in sprouting angiogenesis
3. B	GO:0021773	striatal medium spiny neuron differentiation
3. B	GO:0010638	positive regulation of organelle organization
3. B	GO:0060768	regulation of epithelial cell proliferation involved in prostate gland development
3. B	GO:0060998	regulation of dendritic spine development
3. B	GO:2000811	negative regulation of anoikis
3. B	GO:0045608	negative regulation of inner ear auditory receptor cell differentiation
3. B	GO:0055008	cardiac muscle tissue morphogenesis
3. B	GO:1901339	regulation of store-operated calcium channel activity
3. B	GO:2000630	positive regulation of miRNA metabolic process
3. B	GO:0006887	exocytosis
3. B	GO:0071314	cellular response to cocaine
3. B	GO:0000242	pericentriolar material
3. B	GO:2000096	positive regulation of Wnt signaling pathway, planar cell polarity pathway
3. B	GO:0003197	endocardial cushion development
3. B	GO:0016604	nuclear body
3. B	GO:0003723	RNA binding
3. B	GO:0098685	Schaffer collateral - CA1 synapse
3. B	GO:0042665	regulation of ectodermal cell fate specification
3. B	GO:0098907	regulation of SA node cell action potential
3. B	GO:0003203	endocardial cushion morphogenesis
3. B	GO:1900026	positive regulation of substrate adhesion-dependent cell spreading
3. B	GO:0035965	cardiolipin acyl-chain remodeling
3. B	GO:0003677	DNA binding
3. B	GO:0048471	perinuclear region of cytoplasm
3. B	GO:0030155	regulation of cell adhesion
3. B	GO:0086014	atrial cardiac muscle cell action potential
3. B	GO:0016409	palmitoyltransferase activity
3. B	GO:0008270	zinc ion binding
3. B	GO:0003184	pulmonary valve morphogenesis
3. B	GO:0030507	spectrin binding
3. B	GO:0032695	negative regulation of interleukin-12 production
3. B	GO:0003169	coronary vein morphogenesis
3. B	GO:1904908	negative regulation of maintenance of mitotic sister chromatid cohesion, telomeric
3. B	GO:0060528	secretory columnal luminar epithelial cell differentiation involved in prostate glandular acinus development
3. B	GO:0071532	ankyrin repeat binding
3. B	GO:0070936	protein K48-linked ubiquitination
3. B	GO:0070412	R-SMAD binding
3. B	GO:0140439	protein-cysteine S-stearoyltransferase activity
3. B	GO:0051438	regulation of ubiquitin-protein transferase activity
3. B	GO:0000210	NAD+ diphosphatase activity
3. B	GO:0031143	pseudopodium
3. B	GO:0051017	actin filament bundle assembly
3. B	GO:0007368	determination of left/right symmetry
3. B	GO:0071244	cellular response to carbon dioxide
3. B	GO:0060982	coronary artery morphogenesis
3. B	GO:0014069	postsynaptic density
3. B	GO:0007616	long-term memory
3. B	GO:0045687	positive regulation of glial cell differentiation
3. B	GO:0001954	positive regulation of cell-matrix adhesion
3. B	GO:0014912	negative regulation of smooth muscle cell migration
3. B	GO:0031359	integral component of chloroplast outer membrane
3. B	GO:0010780	meiotic DNA double-strand break formation involved in reciprocal meiotic recombination
3. B	GO:0031867	EP4 subtype prostaglandin E2 receptor binding
3. B	GO:0015248	sterol transporter activity
3. B	GO:0048103	somatic stem cell division
3. B	GO:0043266	regulation of potassium ion transport
3. B	GO:1902412	regulation of mitotic cytokinesis
3. B	GO:0050955	thermoception
3. B	GO:0060843	venous endothelial cell differentiation
3. B	GO:0001838	embryonic epithelial tube formation
3. B	GO:0060153	modulation by virus of host cell cycle
3. B	GO:2000651	positive regulation of sodium ion transmembrane transporter activity
3. B	GO:0006528	asparagine metabolic process
3. B	GO:0140031	phosphorylation-dependent protein binding
3. B	GO:0051306	mitotic sister chromatid separation
3. B	GO:0050957	equilibrioception
3. B	GO:0003207	cardiac chamber formation
3. B	GO:0061384	heart trabecula morphogenesis
3. B	GO:0048060	negative gravitaxis
3. B	GO:0072015	glomerular visceral epithelial cell development
3. B	GO:2000304	positive regulation of ceramide biosynthetic process
3. B	GO:0070171	negative regulation of tooth mineralization
3. B	GO:0019208	phosphatase regulator activity
3. B	GO:0030315	T-tubule
3. B	GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
3. B	GO:0003209	cardiac atrium morphogenesis
3. B	GO:1905936	regulation of germ cell proliferation
3. B	GO:0048052	R1/R6 cell differentiation
3. B	GO:0021531	spinal cord radial glial cell differentiation
3. B	GO:0010761	fibroblast migration
3. B	GO:2000969	positive regulation of AMPA receptor activity
3. B	GO:0005262	calcium channel activity
3. B	GO:0008290	F-actin capping protein complex
3. B	GO:0102545	phosphatidyl phospholipase B activity
3. B	GO:0097062	dendritic spine maintenance
3. B	GO:0031901	early endosome membrane
3. B	GO:0031672	A band
3. B	GO:0003213	cardiac right atrium morphogenesis
3. B	GO:0045869	negative regulation of single stranded viral RNA replication via double stranded DNA intermediate
3. B	GO:0045602	negative regulation of endothelial cell differentiation
3. B	GO:0050793	regulation of developmental process
3. B	GO:0098910	regulation of atrial cardiac muscle cell action potential
3. B	GO:0043194	axon initial segment
3. B	GO:0090575	RNA polymerase II transcription regulator complex
3. B	GO:0009912	auditory receptor cell fate commitment
3. B	GO:0030941	chloroplast targeting sequence binding
3. B	GO:0099527	postsynapse to nucleus signaling pathway
3. B	GO:0046849	bone remodeling
3. B	GO:2000249	regulation of actin cytoskeleton reorganization
3. B	GO:0048265	response to pain
3. B	GO:0016279	protein-lysine N-methyltransferase activity
3. B	GO:0001895	retina homeostasis
3. B	GO:1901223	negative regulation of NIK/NF-kappaB signaling
3. B	GO:0097543	ciliary inversin compartment
3. B	GO:0017124	SH3 domain binding
3. B	GO:0003847	1-alkyl-2-acetylglycerophosphocholine esterase activity
3. B	GO:0048170	positive regulation of long-term neuronal synaptic plasticity
3. B	GO:0048854	brain morphogenesis
3. B	GO:0003219	cardiac right ventricle formation
3. B	GO:0043235	receptor complex
3. B	GO:0001658	branching involved in ureteric bud morphogenesis
3. B	GO:0017171	serine hydrolase activity
3. B	GO:0072144	glomerular mesangial cell development
3. B	GO:2000031	regulation of salicylic acid mediated signaling pathway
3. B	GO:0016235	aggresome
3. B	GO:0060956	endocardial cell differentiation
3. B	GO:1904632	cellular response to glucoside
3. B	GO:0042383	sarcolemma
3. B	GO:0071322	cellular response to carbohydrate stimulus
3. B	GO:1901189	positive regulation of ephrin receptor signaling pathway
3. B	GO:0060038	cardiac muscle cell proliferation
3. B	GO:0032212	positive regulation of telomere maintenance via telomerase
3. B	GO:0042297	vocal learning
3. B	GO:0061001	regulation of dendritic spine morphogenesis
3. B	GO:2000279	negative regulation of DNA biosynthetic process
3. B	GO:0045596	negative regulation of cell differentiation
3. B	GO:0061025	membrane fusion
3. B	GO:0051386	regulation of neurotrophin TRK receptor signaling pathway
3. B	GO:0097110	scaffold protein binding
3. B	GO:1990393	3M complex
3. B	GO:0060803	BMP signaling pathway involved in mesodermal cell fate specification
3. B	GO:0045618	positive regulation of keratinocyte differentiation
3. B	GO:0003180	aortic valve morphogenesis
3. B	GO:1990705	cholangiocyte proliferation
3. B	GO:0060013	righting reflex
3. B	GO:0007411	axon guidance
3. B	GO:0050968	detection of chemical stimulus involved in sensory perception of pain
3. B	GO:0042246	tissue regeneration
3. B	GO:0003157	endocardium development
3. B	GO:0007229	integrin-mediated signaling pathway
3. B	GO:1900451	positive regulation of glutamate receptor signaling pathway
3. B	GO:1903343	positive regulation of meiotic DNA double-strand break formation
3. B	GO:0090029	negative regulation of pheromone-dependent signal transduction involved in conjugation with cellular fusion
3. B	GO:0046533	negative regulation of photoreceptor cell differentiation
3. B	GO:0097150	neuronal stem cell population maintenance
3. B	GO:0060045	positive regulation of cardiac muscle cell proliferation
3. B	GO:0048013	ephrin receptor signaling pathway
3. B	GO:1901019	regulation of calcium ion transmembrane transporter activity
3. B	GO:0035171	lamellocyte differentiation
3. B	GO:0004067	asparaginase activity
3. B	GO:1903849	positive regulation of aorta morphogenesis
3. B	GO:0045162	clustering of voltage-gated sodium channels
3. B	GO:0060413	atrial septum morphogenesis
3. B	GO:0051865	protein autoubiquitination
3. B	GO:0050728	negative regulation of inflammatory response
3. B	GO:0003192	mitral valve formation
3. B	GO:0043065	positive regulation of apoptotic process
3. B	GO:0030027	lamellipodium
3. B	GO:0000415	negative regulation of histone H3-K36 methylation
3. B	GO:0033268	node of Ranvier
3. B	GO:0048665	neuron fate specification
3. B	GO:0090200	positive regulation of release of cytochrome c from mitochondria
3. B	GO:1904630	cellular response to diterpene
3. B	GO:0003264	regulation of cardioblast proliferation
3. B	GO:0019705	protein-cysteine S-myristoyltransferase activity
3. B	GO:0010613	positive regulation of cardiac muscle hypertrophy
3. B	GO:0043596	nuclear replication fork
3. B	GO:0001835	blastocyst hatching
3. B	GO:0050807	regulation of synapse organization
3. B	GO:0061314	Notch signaling involved in heart development
3. B	GO:0008361	regulation of cell size
3. B	GO:0071709	membrane assembly
3. B	GO:0015278	calcium-release channel activity
3. B	GO:0060992	response to fungicide
3. B	GO:2000463	positive regulation of excitatory postsynaptic potential
3. B	GO:0016290	palmitoyl-CoA hydrolase activity
3. B	GO:0019899	enzyme binding
3. B	GO:0099173	postsynapse organization
3. B	GO:0051570	regulation of histone H3-K9 methylation
3. B	GO:0034587	piRNA metabolic process
3. B	GO:0004857	enzyme inhibitor activity
3. B	GO:2000974	negative regulation of pro-B cell differentiation
3. B	GO:0060997	dendritic spine morphogenesis
3. B	GO:0048845	venous blood vessel morphogenesis
3. B	GO:1901018	positive regulation of potassium ion transmembrane transporter activity
3. B	GO:0050714	positive regulation of protein secretion
3. B	GO:0004143	diacylglycerol kinase activity
3. B	GO:0060135	maternal process involved in female pregnancy
3. B	GO:2000311	regulation of AMPA receptor activity
3. B	GO:0043055	maintenance of dauer
3. B	GO:0086066	atrial cardiac muscle cell to AV node cell communication
3. B	GO:1901021	positive regulation of calcium ion transmembrane transporter activity
3. B	GO:1901224	positive regulation of NIK/NF-kappaB signaling
3. B	GO:0060253	negative regulation of glial cell proliferation
3. B	GO:0050966	detection of mechanical stimulus involved in sensory perception of pain
3. B	GO:0021707	cerebellar granule cell differentiation
3. B	GO:0014031	mesenchymal cell development
3. B	GO:0051151	negative regulation of smooth muscle cell differentiation
3. B	GO:0046872	metal ion binding
3. B	GO:0035544	negative regulation of SNARE complex assembly
3. B	GO:0035508	positive regulation of myosin-light-chain-phosphatase activity
3. B	GO:0097553	calcium ion transmembrane import into cytosol
3. B	GO:2000821	regulation of grooming behavior
3. B	GO:0000139	Golgi membrane
3. B	GO:0060708	spongiotrophoblast differentiation
3. B	GO:0019706	protein-cysteine S-palmitoyltransferase activity
3. B	GO:0003273	cell migration involved in endocardial cushion formation
3. B	GO:0051572	negative regulation of histone H3-K4 methylation
3. B	GO:0030900	forebrain development
3. B	GO:1903793	positive regulation of anion transport
3. B	GO:0070168	negative regulation of biomineral tissue development
3. B	GO:0044354	macropinosome
3. B	GO:0035507	regulation of myosin-light-chain-phosphatase activity
3. B	GO:1904357	negative regulation of telomere maintenance via telomere lengthening
3. B	GO:0061344	regulation of cell adhesion involved in heart morphogenesis

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	Q9H560	Putative ankyrin repeat domain-containing protein 19	2.27e-10	4.75e-14	1.03e-55
1. PB	Q9D738	Ankyrin repeat and SOCS box protein 12	3.12e-10	8.27e-06	0.034
1. PB	Q91WK7	Ankyrin repeat domain-containing protein 54	6.70e-07	1.87e-02	7.32e-09
1. PB	Q92527	Ankyrin repeat domain-containing protein 7	4.44e-16	3.98e-19	1.21e-51
1. PB	Q5U2S6	Ankyrin repeat and SOCS box protein 2	1.20e-05	5.28e-05	1.02e-10
1. PB	Q5EA33	Ankyrin repeat domain-containing protein 49	2.13e-10	4.15e-02	9.61e-06
1. PB	A4II29	Notch-regulated ankyrin repeat-containing protein	1.74e-08	9.82e-07	7.15e-04
1. PB	Q862Z2	Ankyrin repeat and SOCS box protein 5	1.52e-08	6.26e-06	4.09e-05
1. PB	Q53RE8	Ankyrin repeat domain-containing protein 39	3.69e-13	2.20e-11	1.20e-09
1. PB	Q8WWX0	Ankyrin repeat and SOCS box protein 5	3.30e-09	1.26e-05	5.45e-06
1. PB	Q9WV74	Ankyrin repeat and SOCS box protein 1	3.68e-08	2.43e-05	8.93e-06
1. PB	Q54HW1	26S proteasome non-ATPase regulatory subunit 10	3.16e-12	4.28e-03	6.56e-11
1. PB	Q0P5B9	Ankyrin repeat domain-containing protein 39	1.69e-14	5.47e-09	8.57e-11
1. PB	Q566C8	Ankyrin repeat domain-containing protein 54	6.02e-06	5.78e-03	7.18e-09
1. PB	Q9JIA3	NF-kappa-B inhibitor beta	1.86e-06	1.28e-04	0.003
1. PB	Q60773	Cyclin-dependent kinase 4 inhibitor D	0.00e+00	2.77e-05	6.32e-07
1. PB	Q3SX45	Ankyrin repeat and SOCS box protein 2	1.12e-05	5.53e-05	2.53e-13
1. PB	Q9D1A4	Ankyrin repeat and SOCS box protein 5	2.79e-08	1.77e-05	3.35e-05
1. PB	Q9Y576	Ankyrin repeat and SOCS box protein 1	1.24e-08	5.10e-05	4.15e-05
1. PB	Q9Z2X2	26S proteasome non-ATPase regulatory subunit 10	1.11e-15	3.55e-03	2.78e-10
1. PB	Q9WV06	Ankyrin repeat domain-containing protein 2	1.38e-10	1.37e-03	2.75e-12
1. PB	B2RU33	POTE ankyrin domain family member C	9.90e-08	6.21e-05	7.00e-49
1. PB	Q60772	Cyclin-dependent kinase 4 inhibitor C	1.11e-16	1.37e-03	1.43e-06
1. PB	Q6NSI1	Putative ankyrin repeat domain-containing protein 26-like protein	4.17e-09	2.00e-09	1.45e-65
1. PB	Q5RFS1	Ankyrin repeat and SOCS box protein 11	1.32e-08	1.14e-06	2.42e-04
1. PB	E5RJM6	Ankyrin repeat domain-containing protein 65	3.49e-08	3.52e-02	1.60e-08
1. PB	Q9D504	Ankyrin repeat domain-containing protein 7	3.61e-13	1.43e-13	2.09e-55
1. PB	Q15653	NF-kappa-B inhibitor beta	1.91e-06	1.75e-03	0.039
1. PB	Q6S5H5	POTE ankyrin domain family member G	3.70e-08	9.52e-05	9.20e-49
1. PB	B4E2M5	Ankyrin repeat domain-containing protein 66	1.90e-07	2.67e-13	1.53e-06
1. PB	P42773	Cyclin-dependent kinase 4 inhibitor C	0.00e+00	3.12e-04	1.68e-05
1. PB	Q08353	NF-kappa-B inhibitor alpha	2.90e-07	5.76e-12	4.56e-05
1. PB	Q14DN9	Ankyrin repeat and death domain-containing protein 1B	3.09e-07	7.22e-04	9.14e-07
1. PB	Q8K0L0	Ankyrin repeat and SOCS box protein 2	1.35e-05	4.87e-04	4.40e-11
1. PB	A0PJZ0	Putative ankyrin repeat domain-containing protein 20A5	1.38e-10	1.94e-09	1.76e-47
1. PB	Q8WXH4	Ankyrin repeat and SOCS box protein 11	5.04e-08	2.76e-07	1.85e-04
1. PB	Q8VHS5	Ankyrin repeat and SOCS box protein 16	7.23e-07	6.37e-09	0.001
1. PB	Q54KH3	Ankyrin repeat domain-containing protein 39 homolog	2.19e-11	7.22e-04	0.023
1. PB	Q9Z2X3	26S proteasome non-ATPase regulatory subunit 10	1.11e-15	1.56e-03	5.22e-11
1. PB	P20749	B-cell lymphoma 3 protein	1.36e-07	6.61e-12	1.37e-11
1. PB	Q63746	NF-kappa-B inhibitor alpha	2.05e-09	5.95e-10	2.06e-04
1. PB	Q9FNP4	Phytochrome-interacting ankyrin-repeat protein 2	1.98e-06	1.09e-04	0.008
1. PB	O75832	26S proteasome non-ATPase regulatory subunit 10	2.52e-12	2.62e-03	4.72e-10
1. PB	Q9CQM6	Ankyrin repeat domain-containing protein 61	3.46e-08	2.06e-04	0.027
1. PB	Q4R3S3	Ankyrin repeat domain-containing protein 7	6.48e-13	1.07e-13	1.28e-51
1. PB	Q9Z1E3	NF-kappa-B inhibitor alpha	2.63e-09	6.30e-10	7.15e-05
1. PB	Q17QS6	Ankyrin repeat and SOCS box protein 5	7.72e-09	3.19e-05	4.37e-06
1. PB	A6NI47	Putative POTE ankyrin domain family member M	1.32e-08	9.90e-04	2.17e-49
1. PB	Q7T3X9	Notch-regulated ankyrin repeat-containing protein B	5.11e-07	1.36e-06	0.010
1. PB	Q7T3Y0	Notch-regulated ankyrin repeat-containing protein A	2.69e-07	5.96e-06	7.82e-04
1. PB	Q9Y574	Ankyrin repeat and SOCS box protein 4	3.54e-09	2.67e-02	4.10e-05
1. PB	Q9D2X0	Ankyrin repeat domain-containing protein 39	2.95e-12	1.33e-11	4.05e-09
1. PB	Q9Z2F6	B-cell lymphoma 3 protein homolog	6.95e-08	6.85e-11	2.97e-10
1. PB	Q55FM5	Myotrophin homolog	2.79e-12	3.52e-02	0.021
1. PB	Q9HYV6	Putative ankyrin repeat protein PA3287	0.00e+00	1.80e-07	1.29e-08
1. PB	Q91ZA8	Notch-regulated ankyrin repeat-containing protein	1.64e-08	2.06e-05	8.12e-04
1. PB	Q9D119	Protein phosphatase 1 regulatory subunit 27	2.20e-08	6.37e-07	0.001
1. PB	Q2TB02	NF-kappa-B inhibitor delta	2.80e-07	1.47e-02	1.36e-04
1. PB	Q8VHA6	Ankyrin repeat and SOCS box protein 18	6.19e-07	1.69e-03	1.72e-07
1. PB	Q91ZT7	Ankyrin repeat and SOCS box protein 10	7.57e-08	5.87e-09	1.79e-09
1. PB	Q4UMP3	Putative ankyrin repeat protein RF_0314	3.67e-04	8.58e-05	1.12e-05
1. PB	Q6S545	POTE ankyrin domain family member H	2.69e-08	2.01e-03	1.09e-48
1. PB	P55273	Cyclin-dependent kinase 4 inhibitor D	0.00e+00	2.17e-06	2.13e-06
1. PB	P18954	Protein PhlB	2.62e-10	6.06e-04	7.33e-07
1. PB	Q1RK83	Putative ankyrin repeat protein RBE_0150	3.10e-11	8.45e-03	1.27e-04
1. PB	Q9HFE7	Ankyrin repeat-containing protein P16F5.05c	5.81e-10	1.64e-05	0.002
1. PB	Q7Z6K4	Notch-regulated ankyrin repeat-containing protein	2.09e-08	2.06e-05	8.12e-04
1. PB	Q978J0	Putative ankyrin repeat protein TV1425	0.00e+00	2.09e-04	1.71e-09
1. PB	Q6ZVZ8	Ankyrin repeat and SOCS box protein 18	7.44e-07	3.59e-03	0.007
1. PB	Q91ZT8	Ankyrin repeat and SOCS box protein 9	3.22e-08	3.23e-04	4.31e-06
1. PB	Q8NI38	NF-kappa-B inhibitor delta	2.81e-07	1.09e-03	2.06e-04
1. PB	Q8WXI3	Ankyrin repeat and SOCS box protein 10	2.39e-07	1.97e-09	1.20e-07
1. PB	Q29RV0	Cyclin-dependent kinase 4 inhibitor D	1.11e-16	1.51e-05	7.32e-07
1. PB	Q9HLN1	Putative ankyrin repeat protein Ta0196	3.28e-11	1.57e-12	7.82e-10
1. PB	B0G124	Ankyrin repeat-containing protein DDB_G0279043	1.93e-10	2.77e-05	7.88e-09
1. PB	Q91974	NF-kappa-B inhibitor alpha	1.37e-08	1.23e-06	1.39e-07
1. PB	P25963	NF-kappa-B inhibitor alpha	4.30e-07	7.04e-13	1.05e-06
1. PB	P0C927	Ankyrin repeat and SOCS box protein 14	1.82e-07	8.79e-04	2.91e-04
1. PB	Q9CQ31	Ankyrin repeat and SOCS box protein 11	8.43e-09	3.98e-06	2.85e-05
1. PB	Q1RK82	Putative ankyrin repeat protein RBE_0151	4.04e-07	1.62e-05	0.024
1. PB	Q5U5A6	Notch-regulated ankyrin repeat-containing protein	7.56e-09	7.62e-07	7.66e-04
1. PB	Q96NS5	Ankyrin repeat and SOCS box protein 16	9.12e-07	8.71e-08	0.021
1. PB	Q60778	NF-kappa-B inhibitor beta	9.90e-07	5.61e-03	0.007
1. PB	P46683	Ankyrin repeat-containing protein YAR1	1.08e-08	2.68e-06	0.004
1. PB	Q96Q27	Ankyrin repeat and SOCS box protein 2	3.06e-06	9.01e-06	1.69e-13
1. PB	Q86WC6	Protein phosphatase 1 regulatory subunit 27	5.73e-08	3.02e-07	3.23e-04
1. PB	Q3SZE4	Ankyrin repeat and SOCS box protein 11	7.62e-09	2.96e-09	7.75e-06
1. PB	Q96DX5	Ankyrin repeat and SOCS box protein 9	1.71e-08	7.60e-06	5.29e-07
1. PB	Q4UKI1	Putative ankyrin repeat protein RF_1099	9.72e-08	8.45e-03	0.030
1. PB	A7E2S9	Putative ankyrin repeat domain-containing protein 30B-like	0	1.80e-164	0.0
1. PB	Q8WVL7	Ankyrin repeat domain-containing protein 49	1.10e-08	1.15e-02	1.26e-04
1. PB	Q9FF09	Phytochrome-interacting ankyrin-repeat protein 1	1.98e-06	1.77e-03	0.002
1. PB	Q8VE42	Ankyrin repeat domain-containing protein 49	1.22e-07	9.80e-04	4.25e-05
2. P	Q5EFR1	I-Kappa-B like protein I1	NA	1.56e-02	NA
2. P	A6NGH8	Ankyrin repeat domain-containing protein 61	6.09e-08	6.29e-05	NA
2. P	Q5I159	I-Kappa-B like protein C2	NA	6.82e-03	NA
2. P	Q5UPB2	Putative ankyrin repeat protein L38	NA	3.13e-03	NA
2. P	Q5I144	I-Kappa-B like protein H1	NA	3.77e-07	NA
2. P	P51480	Cyclin-dependent kinase inhibitor 2A	1.31e-05	4.75e-03	NA
2. P	A6NJG2	Ankyrin repeat domain-containing protein SOWAHD	4.59e-05	6.92e-04	NA
2. P	Q5I140	I-Kappa-B like protein J1	NA	6.29e-05	NA
2. P	Q5I126	I-kappa-B like protein N2	NA	4.34e-07	NA
2. P	Q4ULD9	Putative ankyrin repeat protein RF_0783	6.36e-08	2.94e-03	NA
2. P	Q810N6	Ankyrin repeat domain-containing protein 45	1.28e-06	4.93e-07	NA
2. P	Q5I160	I-Kappa-B like protein C1	NA	4.52e-13	NA
2. P	Q95LR4	Ankyrin repeat and SOCS box protein 17	6.77e-03	1.58e-02	NA
2. P	Q8BY98	Ankyrin repeat domain-containing protein SOWAHD	1.00e-04	3.72e-05	NA
2. P	Q9P7I0	Ankyrin repeat-containing protein C105.02c	3.09e-05	4.95e-03	NA
2. P	P09959	Regulatory protein SWI6	9.93e-03	1.99e-02	NA
2. P	Q8WXK4	Ankyrin repeat and SOCS box protein 12	5.60e-10	1.39e-05	NA
2. P	Q5I125	I-Kappa-B like protein N3	NA	1.87e-03	NA
2. P	Q1RIW0	Putative ankyrin repeat protein RBE_0623	1.12e-04	3.70e-03	NA
2. P	Q5I155	I-Kappa-B like protein F2	NA	3.16e-02	NA
2. P	Q96BM1	Ankyrin repeat domain-containing protein 9	1.38e-06	5.44e-03	NA
2. P	P0C965	IkB-like protein	NA	1.26e-06	NA
2. P	O36972	IkB-like protein	NA	3.26e-06	NA
2. P	Q641X1	Ankyrin repeat domain-containing protein 61	6.94e-07	1.49e-05	NA
2. P	O51360	Putative ankyrin repeat protein BB_0399	5.22e-08	4.80e-02	NA
2. P	P42771	Cyclin-dependent kinase inhibitor 2A	6.87e-11	4.98e-05	NA
2. P	Q2T9W8	Ankyrin repeat domain-containing protein 61	1.32e-07	1.51e-05	NA
2. P	Q76U48	IkB-like protein	NA	1.31e-04	NA
2. P	Q4UKJ5	Putative ankyrin repeat protein RF_1081	1.03e-03	3.88e-02	NA
2. P	Q5I149	I-Kappa-B like protein G1	NA	1.38e-12	NA
2. P	Q5TZF3	Ankyrin repeat domain-containing protein 45	3.36e-06	3.16e-03	NA
2. P	Q1RJ94	Putative ankyrin repeat protein RBE_0489	3.54e-06	1.54e-03	NA
2. P	Q5I148	I-Kappa-B like protein G2	NA	2.67e-04	NA
2. P	Q8BH83	Ankyrin repeat domain-containing protein 9	1.44e-06	1.17e-04	NA
2. P	P0C966	IkB-like protein	NA	5.47e-06	NA
2. P	Q8VHP9	Ankyrin repeat and SOCS box protein 17	6.09e-03	4.84e-02	NA
2. P	P0C964	IkB-like protein	NA	1.16e-05	NA
2. P	Q5I156	I-Kappa-B like protein F1	NA	1.94e-07	NA
2. P	P53066	Ankyrin repeat-containing protein YGL242C	5.70e-05	1.37e-04	NA
2. P	P42772	Cyclin-dependent kinase 4 inhibitor B	2.91e-12	1.55e-02	NA
2. P	Q5UNX2	Putative ankyrin repeat protein L715	NA	2.09e-04	NA
3. B	Q7TQI7	Ankyrin repeat and BTB/POZ domain-containing protein 2	9.72e-04	NA	0.004
3. B	Q8N9V6	Ankyrin repeat domain-containing protein 53	9.96e-06	NA	9.21e-05
3. B	Q8BX02	KN motif and ankyrin repeat domain-containing protein 2	5.88e-04	NA	1.06e-04
3. B	Q8VHS6	Ankyrin repeat and SOCS box protein 15	5.50e-07	NA	0.003
3. B	Q5URB9	Putative ankyrin repeat protein R840	NA	NA	7.59e-05
3. B	Q5UPD5	Putative ankyrin repeat protein L59	NA	NA	0.002
3. B	P20632	Interferon antagonist K1L	NA	NA	9.51e-05
3. B	Q1RGM2	Putative ankyrin repeat protein RBE_1411	4.47e-06	NA	0.003
3. B	Q9J5H9	Putative ankyrin repeat protein FPV022	NA	NA	1.56e-08
3. B	Q8IUH5	Palmitoyltransferase ZDHHC17	7.27e-06	NA	1.70e-11
3. B	Q54KA7	Ankyrin repeat, PH and SEC7 domain containing protein secG	8.27e-04	NA	2.25e-20
3. B	Q0V8G2	GA-binding protein subunit beta-2	5.66e-07	NA	1.27e-04
3. B	P59672	Ankyrin repeat and SAM domain-containing protein 1A	5.78e-04	NA	2.31e-06
3. B	Q6AFL2	Putative ankyrin-containing lipoprotein Lxx09580	3.25e-11	NA	2.87e-04
3. B	O14974	Protein phosphatase 1 regulatory subunit 12A	2.39e-04	NA	0.010
3. B	Q99NH0	Ankyrin repeat domain-containing protein 17	7.03e-02	NA	1.49e-13
3. B	Q2QL84	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.71e-06	NA	1.75e-06
3. B	A9JR78	Tonsoku-like protein	1.22e-02	NA	7.03e-07
3. B	P57078	Receptor-interacting serine/threonine-protein kinase 4	1.59e-08	NA	9.00e-08
3. B	Q6P9J5	KN motif and ankyrin repeat domain-containing protein 4	3.83e-03	NA	4.36e-05
3. B	Q499M5	Ankyrin repeat domain-containing protein 16	8.77e-12	NA	0.002
3. B	Q2QLB5	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	2.20e-07	NA	4.80e-07
3. B	Q1LZC5	Ankyrin repeat domain-containing protein 54	5.77e-07	NA	5.95e-09
3. B	Q9Y575	Ankyrin repeat and SOCS box protein 3	8.63e-11	NA	2.15e-06
3. B	P0C6P7	Protein fem-1 homolog B	6.62e-08	NA	7.03e-07
3. B	Q8CEF1	Protein fem-1 homolog C	1.08e-07	NA	6.25e-11
3. B	Q4FE45	E3 ubiquitin-protein ligase XBAT33	1.24e-10	NA	0.001
3. B	Q9J5H8	Putative ankyrin repeat protein FPV023	NA	NA	3.20e-11
3. B	D3J162	Protein VAPYRIN	2.50e-06	NA	5.76e-06
3. B	Q4UJ75	Putative ankyrin repeat domain-containing protein 20A4	1.37e-05	NA	7.08e-56
3. B	Q06527	Ankyrin homolog	7.00e-11	NA	8.12e-11
3. B	Q9UM47	Neurogenic locus notch homolog protein 3	6.42e-02	NA	1.15e-10
3. B	Q8N7Z5	Ankyrin repeat domain-containing protein 31	6.09e-02	NA	0.018
3. B	Q01317	Ankyrin repeat protein nuc-2	5.20e-03	NA	0.038
3. B	P14585	Protein lin-12	5.25e-03	NA	3.81e-05
3. B	O14593	DNA-binding protein RFXANK	1.85e-09	NA	3.13e-13
3. B	Q8LSQ2	Probable signal recognition particle 43 kDa protein, chloroplastic	3.02e-04	NA	9.44e-05
3. B	Q99466	Neurogenic locus notch homolog protein 4	1.92e-02	NA	1.34e-07
3. B	Q07E41	Cortactin-binding protein 2	1.50e-02	NA	2.39e-10
3. B	Q00PJ3	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	9.98e-08	NA	2.51e-06
3. B	P62774	Myotrophin	2.37e-12	NA	0.006
3. B	Q8K4M9	Oxysterol-binding protein-related protein 1	3.40e-04	NA	0.019
3. B	P97819	85/88 kDa calcium-independent phospholipase A2	9.12e-05	NA	4.07e-10
3. B	Q02357	Ankyrin-1	5.46e-03	NA	1.55e-09
3. B	O44997	Death-associated protein kinase dapk-1	1.77e-03	NA	6.96e-11
3. B	P41412	Cell division cycle-related protein res2/pct1	2.19e-04	NA	1.52e-04
3. B	Q2QLC6	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.49e-07	NA	7.45e-06
3. B	Q4ULZ2	Putative ankyrin repeat protein RF_0580	4.67e-10	NA	1.14e-10
3. B	Q5D0W8	BTB/POZ domain and ankyrin repeat-containing protein NPR1	9.47e-04	NA	0.007
3. B	Q8N8A2	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B	4.43e-05	NA	1.27e-12
3. B	Q9NU02	Ankyrin repeat and EF-hand domain-containing protein 1	6.35e-04	NA	5.34e-08
3. B	Q29RM5	Protein fem-1 homolog A	2.71e-05	NA	7.95e-10
3. B	Q9ZU96	Ankyrin repeat-containing protein At2g01680	3.83e-07	NA	1.43e-05
3. B	Q5TYM7	CARD- and ANK-domain containing inflammasome adapter protein	1.16e-06	NA	5.61e-07
3. B	B2FKA7	Actin-binding protein Smlt3054	1.17e-06	NA	6.65e-06
3. B	Q5U312	Ankycorbin	1.25e-04	NA	1.67e-10
3. B	Q21920	Ankyrin repeat and KH domain-containing protein mask-1	7.31e-02	NA	9.01e-06
3. B	Q65XV2	E3 ubiquitin-protein ligase XB3	1.06e-06	NA	2.54e-04
3. B	Q5R6D7	Ankyrin repeat and SOCS box protein 8	2.16e-09	NA	3.70e-12
3. B	S0DPL8	Apicidin F cluster transcription factor apf2	2.02e-06	NA	1.26e-07
3. B	A1ZBY1	Protein fem-1 homolog B	3.27e-06	NA	5.52e-08
3. B	Q554E7	Putative ZDHHC-type palmitoyltransferase 5	1.60e-05	NA	7.93e-08
3. B	A6QL64	Ankyrin repeat domain-containing protein 36A	9.59e-03	NA	1.94e-45
3. B	Q9VUX2	E3 ubiquitin-protein ligase mind-bomb	1.56e-03	NA	1.64e-09
3. B	Q4JHE0	Probable E3 ubiquitin-protein ligase XBOS36	4.24e-07	NA	2.15e-05
3. B	P53356	Tyrosine-protein kinase HTK16	1.00e-04	NA	1.70e-06
3. B	Q9SQK3	Ankyrin repeat domain-containing protein EMB506, chloroplastic	4.85e-07	NA	5.78e-12
3. B	Q7T0Q1	Myotrophin	4.00e-12	NA	5.74e-05
3. B	Q6P6B7	Ankyrin repeat domain-containing protein 16	4.32e-08	NA	3.16e-06
3. B	A2AQH4	BCL-6 corepressor-like protein 1	1.88e-01	NA	8.21e-04
3. B	O70511	Ankyrin-3	6.17e-02	NA	9.23e-13
3. B	Q5R8C8	Ankyrin repeat domain-containing protein 46	3.19e-08	NA	1.66e-04
3. B	Q3U0D9	E3 ubiquitin-protein ligase HACE1	2.26e-05	NA	1.25e-07
3. B	Q90623	Protein phosphatase 1 regulatory subunit 12A	4.49e-04	NA	0.003
3. B	Q9TXQ1	Poly [ADP-ribose] polymerase tankyrase	2.61e-02	NA	3.08e-05
3. B	Q7Z8U2	Palmitoyltransferase akr1	8.18e-06	NA	1.36e-12
3. B	Q5UPE2	Putative ankyrin repeat protein L63	NA	NA	4.06e-06
3. B	Q7T163	Kinase D-interacting substrate of 220 kDa B	5.69e-03	NA	3.74e-15
3. B	Q68DC2	Ankyrin repeat and SAM domain-containing protein 6	2.64e-04	NA	5.24e-08
3. B	Q9J505	Putative ankyrin repeat protein FPV230	NA	NA	0.012
3. B	A1X154	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.94e-06	NA	1.83e-04
3. B	Q7XUW4	Potassium channel KOR2	2.37e-05	NA	4.38e-05
3. B	Q6RI86	Transient receptor potential cation channel subfamily A member 1	1.31e-03	NA	1.21e-06
3. B	Q1RMI3	GA-binding protein subunit beta-1	1.16e-08	NA	3.54e-05
3. B	Q9WV48	SH3 and multiple ankyrin repeat domains protein 1	4.86e-02	NA	0.002
3. B	Q8N2N9	Ankyrin repeat domain-containing protein 36B	9.14e-04	NA	5.32e-48
3. B	Q6BP80	Palmitoyltransferase AKR1	4.47e-06	NA	0.007
3. B	Q63369	Nuclear factor NF-kappa-B p105 subunit (Fragment)	6.56e-06	NA	0.002
3. B	D3J163	Protein VAPYRIN-LIKE	7.78e-07	NA	0.007
3. B	Q10311	Ankyrin repeat-containing protein C6C3.08	1.97e-11	NA	2.06e-08
3. B	Q07DW4	Cortactin-binding protein 2	1.06e-02	NA	9.61e-11
3. B	A5A3E0	POTE ankyrin domain family member F	8.80e-05	NA	2.24e-47
3. B	A2A690	Protein TANC2	9.17e-03	NA	3.58e-10
3. B	Q6KAE5	Probable E3 ubiquitin-protein ligase XBOS32	2.43e-10	NA	0.006
3. B	Q38898	Potassium channel AKT2/3	5.23e-04	NA	0.001
3. B	Q1RJM6	Putative ankyrin repeat protein RBE_0357	2.65e-04	NA	6.96e-04
3. B	Q8CGN4	BCL-6 corepressor	2.76e-01	NA	0.012
3. B	Q61982	Neurogenic locus notch homolog protein 3	6.86e-02	NA	5.74e-11
3. B	Q7T3P8	Protein fem-1 homolog C	1.15e-07	NA	1.13e-11
3. B	Q80UP3	Diacylglycerol kinase zeta	6.35e-03	NA	0.002
3. B	Q5UPX1	Putative ankyrin repeat protein L289	NA	NA	0.001
3. B	P17221	Sex-determining protein fem-1	6.84e-06	NA	3.04e-06
3. B	Q8BXP5	Photoreceptor ankyrin repeat protein	1.44e-06	NA	1.04e-06
3. B	O83515	Putative ankyrin repeat-containing protein TP_0502	1.65e-11	NA	8.28e-05
3. B	A7MB89	Protein fem-1 homolog C	1.19e-07	NA	5.81e-11
3. B	Q9WTT2	Caseinolytic peptidase B protein homolog	3.24e-03	NA	2.87e-05
3. B	Q80T11	Usher syndrome type-1G protein homolog	2.69e-05	NA	6.88e-08
3. B	Q9D2J7	Ankyrin repeat and EF-hand domain-containing protein 1	8.93e-07	NA	0.001
3. B	Q5UQF1	Putative ankyrin repeat protein L483	NA	NA	0.006
3. B	Q9H2K2	Poly [ADP-ribose] polymerase tankyrase-2	8.86e-04	NA	4.23e-06
3. B	Q9D061	Acyl-CoA-binding domain-containing protein 6	1.30e-06	NA	4.10e-09
3. B	Q9BXX2	Ankyrin repeat domain-containing protein 30B	1.06e-03	NA	1.02e-113
3. B	Q06547	GA-binding protein subunit beta-1	9.86e-08	NA	6.75e-05
3. B	A6NHY2	Ankyrin repeat and death domain-containing protein 1B	3.15e-07	NA	6.74e-08
3. B	Q5RCK5	Ankyrin repeat and SOCS box protein 7	1.74e-10	NA	9.62e-06
3. B	Q8UVC1	Inversin	3.15e-04	NA	2.81e-13
3. B	Q5SQ80	Putative ankyrin repeat domain-containing protein 20A2	1.74e-05	NA	3.36e-56
3. B	Q2IBD4	Cortactin-binding protein 2	8.85e-03	NA	6.20e-09
3. B	P0CG39	POTE ankyrin domain family member J	1.61e-04	NA	1.40e-46
3. B	P46530	Neurogenic locus notch homolog protein 1	7.93e-02	NA	1.86e-11
3. B	Q6TGW5	Osteoclast-stimulating factor 1	1.94e-07	NA	6.12e-05
3. B	Q2IBE3	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	2.48e-07	NA	2.09e-06
3. B	Q63618	Espin	1.58e-04	NA	7.58e-05
3. B	Q1RIZ4	Putative ankyrin repeat protein RBE_0589	1.25e-08	NA	0.004
3. B	B9EJA2	Cortactin-binding protein 2	1.02e-02	NA	4.45e-09
3. B	Q8MJ50	Osteoclast-stimulating factor 1	6.02e-07	NA	0.037
3. B	Q8CGB3	Uveal autoantigen with coiled-coil domains and ankyrin repeats	6.47e-04	NA	1.31e-08
3. B	Q8IWB6	Inactive serine/threonine-protein kinase TEX14	1.08e-01	NA	3.45e-08
3. B	Q3UES3	Poly [ADP-ribose] polymerase tankyrase-2	6.10e-04	NA	4.36e-08
3. B	A5WVX9	Palmitoyltransferase ZDHHC17	5.40e-06	NA	5.27e-12
3. B	Q9J504	Putative ankyrin repeat protein FPV231	NA	NA	1.83e-15
3. B	Q91ZT9	Ankyrin repeat and SOCS box protein 8	2.13e-08	NA	4.49e-12
3. B	Q6W2J9	BCL-6 corepressor	3.58e-01	NA	0.012
3. B	Q9Y2G4	Ankyrin repeat domain-containing protein 6	6.12e-07	NA	1.07e-14
3. B	Q58CT0	Dynein axonemal heavy chain 12	3.38e-06	NA	0.012
3. B	F1LTE0	Protein TANC2	8.15e-03	NA	3.75e-10
3. B	O08764	Ankyrin repeat and BTB/POZ domain-containing protein 2	1.01e-03	NA	0.006
3. B	B1AK53	Espin	1.57e-04	NA	4.85e-05
3. B	Q495M9	Usher syndrome type-1G protein	9.25e-05	NA	6.04e-08
3. B	Q9ERC1	Unconventional myosin-XVI	1.97e-02	NA	0.036
3. B	Q9P2R3	Rabankyrin-5	1.19e-03	NA	3.85e-07
3. B	Q8BZ25	Ankyrin repeat and protein kinase domain-containing protein 1	1.11e-05	NA	6.68e-14
3. B	Q8UVC3	Inversin	4.61e-04	NA	7.89e-13
3. B	P13508	Protein glp-1	2.73e-03	NA	2.99e-04
3. B	Q9SCX5	Probable potassium channel AKT5	2.87e-04	NA	6.60e-10
3. B	Q2QLG0	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	7.26e-07	NA	3.27e-07
3. B	Q05823	2-5A-dependent ribonuclease	9.57e-05	NA	1.35e-05
3. B	P57044	Integrin-linked protein kinase	8.38e-08	NA	3.06e-09
3. B	Q8ZWC4	Putative ankyrin repeat protein PAE1861	1.10e-09	NA	4.11e-08
3. B	Q91XL9	Oxysterol-binding protein-related protein 1	3.00e-04	NA	0.011
3. B	O54910	NF-kappa-B inhibitor epsilon	4.63e-08	NA	3.79e-06
3. B	Q75HP9	Potassium channel AKT2	2.22e-03	NA	1.77e-05
3. B	Q4X251	Palmitoyltransferase akr1	7.21e-06	NA	1.76e-12
3. B	Q8WMX7	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.95e-06	NA	7.66e-07
3. B	Q12013	Probable palmitoyltransferase AKR2	1.06e-04	NA	8.48e-05
3. B	Q08E43	Ankyrin repeat and SOCS box protein 8	2.64e-08	NA	3.74e-12
3. B	Q5UPG6	Putative ankyrin repeat protein L92	NA	NA	6.19e-05
3. B	Q8VBX0	Ankyrin repeat and SOCS box protein 13	1.59e-10	NA	5.30e-09
3. B	B7WN72	Protein shank	2.59e-03	NA	6.32e-05
3. B	Q9Z205	DNA-binding protein RFXANK	1.68e-08	NA	2.09e-11
3. B	Q14678	KN motif and ankyrin repeat domain-containing protein 1	7.19e-03	NA	1.33e-06
3. B	Q9BXW6	Oxysterol-binding protein-related protein 1	3.35e-04	NA	0.037
3. B	Q00653	Nuclear factor NF-kappa-B p100 subunit	3.05e-04	NA	3.57e-05
3. B	Q5ZLC8	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C	6.38e-04	NA	8.14e-09
3. B	Q9ULT8	E3 ubiquitin-protein ligase HECTD1	2.11e-01	NA	0.003
3. B	Q68LP1	E3 ubiquitin-protein ligase MIB2	1.71e-05	NA	3.58e-06
3. B	Q01484	Ankyrin-2	NA	NA	6.51e-11
3. B	Q9UK73	Protein fem-1 homolog B	7.94e-08	NA	6.66e-07
3. B	Q2QLH1	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	2.38e-07	NA	4.98e-07
3. B	F8W2M1	E3 ubiquitin-protein ligase HACE1	2.05e-06	NA	3.87e-06
3. B	Q9WV71	Ankyrin repeat and SOCS box protein 4	3.88e-09	NA	1.24e-04
3. B	Q4R739	Ankyrin repeat domain-containing protein 53	2.78e-06	NA	4.92e-04
3. B	Q9J513	Putative ankyrin repeat protein FPV222	NA	NA	1.08e-09
3. B	Q9DBR7	Protein phosphatase 1 regulatory subunit 12A	5.99e-04	NA	0.017
3. B	Q9U518	L-asparaginase	6.22e-06	NA	1.13e-06
3. B	Q9Y283	Inversin	4.63e-04	NA	3.62e-12
3. B	Q9J512	Putative ankyrin repeat protein FPV223	NA	NA	0.001
3. B	Q495B1	Ankyrin repeat and death domain-containing protein 1A	1.88e-09	NA	3.50e-12
3. B	Q9M8S6	Potassium channel SKOR	2.87e-04	NA	1.37e-05
3. B	Q9ULH0	Kinase D-interacting substrate of 220 kDa	5.19e-04	NA	1.84e-16
3. B	G3I6Z6	Neurogenic locus notch homolog protein 1	NA	NA	1.18e-10
3. B	Q5XJ13	Ankyrin repeat and SAM domain-containing protein 6	1.78e-04	NA	2.48e-06
3. B	Q9BGT9	Ankyrin repeat and SOCS box protein 7	1.71e-10	NA	9.70e-06
3. B	P14360	Putative ankyrin repeat protein FPV240	NA	NA	5.27e-06
3. B	O70445	BRCA1-associated RING domain protein 1	5.72e-04	NA	2.49e-05
3. B	Q4UKJ3	Putative ankyrin repeat protein RF_1087	1.70e-06	NA	0.008
3. B	Q3U0L2	Ankyrin repeat domain-containing protein 33B	2.00e-05	NA	0.004
3. B	Q09YK6	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.15e-06	NA	7.00e-07
3. B	Q86SG2	Ankyrin repeat domain-containing protein 23	2.03e-11	NA	2.70e-14
3. B	Q5UPG5	Putative ankyrin repeat protein L93	NA	NA	6.74e-14
3. B	Q9J502	Putative ankyrin repeat protein FPV233	NA	NA	2.02e-09
3. B	Q9WV72	Ankyrin repeat and SOCS box protein 3	4.97e-11	NA	2.65e-06
3. B	Q876L4	Probable palmitoyltransferase AKR2	5.34e-05	NA	4.56e-05
3. B	Q80SY4	E3 ubiquitin-protein ligase MIB1	2.72e-04	NA	3.80e-11
3. B	Q876L5	Palmitoyltransferase AKR1	2.71e-05	NA	2.44e-07
3. B	Q4I8B6	Palmitoyltransferase AKR1	2.58e-05	NA	1.25e-10
3. B	P16157	Ankyrin-1	4.69e-03	NA	3.80e-10
3. B	Q5VUR7	Putative ankyrin repeat domain-containing protein 20A3	6.23e-05	NA	3.10e-56
3. B	O88202	60 kDa lysophospholipase	3.36e-07	NA	1.52e-07
3. B	Q502M6	Ankyrin repeat domain-containing protein 29	9.34e-11	NA	4.72e-09
3. B	Q337A0	Probable E3 ubiquitin-protein ligase XBOS33	8.79e-06	NA	3.78e-04
3. B	Q6S8J3	POTE ankyrin domain family member E	3.50e-05	NA	1.60e-47
3. B	Q0VGY8	Protein TANC1	2.06e-03	NA	2.71e-11
3. B	P0C0T2	Ankyrin repeat and SAM domain-containing protein 6	4.01e-04	NA	4.36e-10
3. B	O95271	Poly [ADP-ribose] polymerase tankyrase-1	2.29e-03	NA	1.59e-07
3. B	G0LXV8	Alpha-latrotoxin-Lh1a (Fragment)	2.26e-03	NA	2.05e-07
3. B	Q15027	Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1	5.47e-03	NA	0.041
3. B	Q9Y566	SH3 and multiple ankyrin repeat domains protein 1	7.10e-02	NA	5.87e-04
3. B	Q653P0	Potassium channel KOR1	5.43e-04	NA	1.08e-05
3. B	Q6PFX9	Poly [ADP-ribose] polymerase tankyrase-1	3.02e-03	NA	1.50e-07
3. B	Q2IBG0	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	4.73e-07	NA	4.83e-06
3. B	Q9J5I3	Putative ankyrin repeat protein FPV018	NA	NA	1.26e-05
3. B	Q94B55	Putative E3 ubiquitin-protein ligase XBAT31	1.55e-08	NA	8.85e-08
3. B	Q6P1S6	Myotrophin	2.23e-11	NA	0.001
3. B	C7B178	Protein VAPYRIN	2.39e-07	NA	1.29e-05
3. B	Q5R4M7	Ankyrin repeat and SOCS box protein 6	1.66e-07	NA	0.003
3. B	Q875M2	Palmitoyltransferase AKR1	2.45e-05	NA	6.98e-08
3. B	Q71S21	Inversin-B	1.86e-04	NA	2.31e-12
3. B	Q8VHK2	Caskin-1	2.66e-03	NA	6.48e-07
3. B	Q9R172	Neurogenic locus notch homolog protein 3	7.02e-02	NA	4.31e-11
3. B	Q29Q26	Ankyrin repeat domain-containing protein 2B	7.33e-06	NA	4.08e-05
3. B	Q5JPF3	Ankyrin repeat domain-containing protein 36C	4.30e-03	NA	1.44e-44
3. B	Q4P6L3	Palmitoyltransferase AKR1	6.07e-05	NA	8.01e-08
3. B	Q9P0K7	Ankycorbin	1.08e-04	NA	2.34e-12
3. B	Q6DGX3	Ankyrin repeat domain-containing protein 54	2.56e-06	NA	2.46e-07
3. B	Q3V096	Ankyrin repeat domain-containing protein 42	1.39e-07	NA	7.14e-04
3. B	O13987	Ankyrin and IPT/TIG repeat-containing protein C26H5.05	1.06e-01	NA	0.019
3. B	Q7Z020	Transient receptor potential cation channel subfamily A member 1	4.12e-04	NA	0.033
3. B	Q96AX9	E3 ubiquitin-protein ligase MIB2	2.93e-05	NA	1.59e-06
3. B	A0A3L7I2I8	85/88 kDa calcium-independent phospholipase A2	3.98e-04	NA	3.29e-10
3. B	Q5UPH0	Putative ankyrin repeat protein L100	NA	NA	0.019
3. B	Q86YR6	POTE ankyrin domain family member D	6.19e-07	NA	2.06e-48
3. B	Q5UPE3	Putative ankyrin repeat protein L62	NA	NA	0.003
3. B	Q83DF6	Putative ankyrin repeat protein CBU_0781	2.65e-05	NA	0.014
3. B	Q923M0	Protein phosphatase 1 regulatory subunit 16A	6.89e-07	NA	0.009
3. B	Q94527	Nuclear factor NF-kappa-B p110 subunit	3.19e-03	NA	2.58e-06
3. B	Q6F3J0	Nuclear factor NF-kappa-B p105 subunit	2.13e-04	NA	2.43e-04
3. B	Q8N9B4	Ankyrin repeat domain-containing protein 42	1.89e-07	NA	0.001
3. B	Q07E28	Cortactin-binding protein 2	1.06e-02	NA	4.12e-10
3. B	Q5H9F3	BCL-6 corepressor-like protein 1	3.43e-01	NA	7.69e-04
3. B	Q8WXK3	Ankyrin repeat and SOCS box protein 13	3.75e-09	NA	7.05e-09
3. B	Q5TYW2	Ankyrin repeat domain-containing protein 20A1	2.41e-05	NA	6.34e-56
3. B	Q5GIG6	Serine/threonine-protein kinase TNNI3K	5.24e-07	NA	7.46e-06
3. B	Q92625	Ankyrin repeat and SAM domain-containing protein 1A	1.47e-03	NA	8.88e-07
3. B	Q3UUF8	Ankyrin repeat domain-containing protein 34B	1.04e-04	NA	0.006
3. B	Q09YI3	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.55e-06	NA	2.83e-06
3. B	A0M8T5	Cortactin-binding protein 2	1.17e-02	NA	1.86e-09
3. B	Q9J5I9	Putative ankyrin repeat protein FPV012	NA	NA	1.82e-04
3. B	Q2KI79	Ankyrin repeat family A protein 2	6.69e-07	NA	3.43e-08
3. B	Q5ZM55	Protein fem-1 homolog B	1.80e-07	NA	9.08e-07
3. B	Q07E15	Cortactin-binding protein 2	6.23e-03	NA	2.19e-10
3. B	Q6UB98	Ankyrin repeat domain-containing protein 12	1.53e-01	NA	0.001
3. B	A6QPE7	Ankyrin repeat domain-containing protein 65	4.58e-09	NA	8.26e-12
3. B	Q9XZC0	Alpha-latrocrustotoxin-Lt1a (Fragment)	8.40e-05	NA	1.50e-04
3. B	Q9NVP4	Double zinc ribbon and ankyrin repeat-containing protein 1	8.37e-03	NA	0.013
3. B	Q94A76	Potassium channel GORK	3.86e-05	NA	2.26e-08
3. B	Q1ZXR2	Probable serine/threonine-protein kinase DDB_G0267566	3.17e-02	NA	0.005
3. B	Q8Q0U0	Putative ankyrin repeat protein MM_0045	6.29e-09	NA	2.98e-18
3. B	Q8N961	Ankyrin repeat and BTB/POZ domain-containing protein 2	9.79e-04	NA	0.004
3. B	Q7EZ44	Probable E3 ubiquitin-protein ligase XBOS35	2.74e-10	NA	0.002
3. B	O35516	Neurogenic locus notch homolog protein 2	3.44e-02	NA	4.35e-10
3. B	Q5VYY1	Ankyrin repeat domain-containing protein 22	2.22e-16	NA	4.64e-12
3. B	Q6XJU9	Osteoclast-stimulating factor 1	2.51e-07	NA	1.77e-04
3. B	Q03017	NF-kappa-B inhibitor cactus	9.15e-07	NA	2.67e-05
3. B	B8N0E6	Ankyrin-repeat domain containing transcription coregulator asaA	3.10e-04	NA	1.66e-07
3. B	O75762	Transient receptor potential cation channel subfamily A member 1	4.46e-04	NA	1.62e-07
3. B	Q5M9H0	Ankyrin repeat and SAM domain-containing protein 3	2.80e-06	NA	4.78e-15
3. B	Q8VD46	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	3.01e-07	NA	2.00e-06
3. B	Q5UPA0	Putative ankyrin repeat protein L25	NA	NA	3.09e-05
3. B	Q6NY19	KN motif and ankyrin repeat domain-containing protein 3	4.44e-04	NA	5.21e-05
3. B	E7BQV0	BTB/POZ domain and ankyrin repeat-containing protein NPR1	1.22e-03	NA	0.005
3. B	O74977	VMS1 homolog C1827.04	1.94e-02	NA	0.005
3. B	P19838	Nuclear factor NF-kappa-B p105 subunit	6.65e-04	NA	1.64e-05
3. B	A0M8S4	Cortactin-binding protein 2	1.46e-02	NA	1.82e-09
3. B	Q24145	Tyrosine-protein kinase Shark	9.20e-04	NA	0.004
3. B	Q9TU71	Ankyrin repeat domain-containing protein 1	1.51e-09	NA	7.18e-15
3. B	Q18297	Transient receptor potential cation channel subfamily A member 1 homolog	1.61e-03	NA	1.90e-08
3. B	E9Q4F7	Ankyrin repeat domain-containing protein 11	1.93e-01	NA	8.23e-06
3. B	Q8WWH4	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	2.14e-07	NA	1.88e-06
3. B	Q1RJN6	Putative ankyrin repeat protein RBE_0347	1.33e-06	NA	3.31e-04
3. B	P98150	Nuclear factor NF-kappa-B p100 subunit	3.74e-05	NA	6.32e-06
3. B	Q5UQZ7	Putative ankyrin repeat protein R901	NA	NA	8.49e-05
3. B	Q5RF15	Serine/threonine-protein kinase TNNI3K	1.24e-08	NA	1.10e-04
3. B	Q8C008	Double zinc ribbon and ankyrin repeat-containing protein 1	2.18e-02	NA	0.001
3. B	Q9VFD5	Protein fem-1 homolog CG6966	4.15e-07	NA	9.35e-10
3. B	Q6P9K8	Caskin-1	7.35e-04	NA	1.26e-06
3. B	Q2IBA2	Cortactin-binding protein 2	1.21e-02	NA	1.76e-09
3. B	Q5UR04	Putative ankyrin repeat protein R911	NA	NA	2.51e-04
3. B	Q812A3	Ankyrin repeat domain-containing protein 23	3.39e-10	NA	1.17e-12
3. B	Q3SWY2	Integrin-linked protein kinase	2.62e-06	NA	4.39e-09
3. B	A5PMU4	Ankyrin repeat and sterile alpha motif domain-containing protein 1B	2.41e-04	NA	9.80e-05
3. B	Q876A6	Palmitoyltransferase AKR1	2.26e-05	NA	3.13e-12
3. B	P0C7A6	Ankyrin repeat and BTB/POZ domain-containing protein BTBD11-B	5.97e-04	NA	0.039
3. B	Q5UR87	Putative ankyrin repeat protein R634	NA	NA	0.016
3. B	Q96KQ7	Histone-lysine N-methyltransferase EHMT2	9.08e-04	NA	2.68e-11
3. B	P25799	Nuclear factor NF-kappa-B p105 subunit	4.91e-04	NA	3.32e-04
3. B	Q92882	Osteoclast-stimulating factor 1	5.64e-07	NA	0.017
3. B	Q99LW0	Ankyrin repeat domain-containing protein 10	7.85e-07	NA	1.34e-04
3. B	Q6GNY1	E3 ubiquitin-protein ligase mib1	1.11e-04	NA	1.37e-10
3. B	Q91ZU0	Ankyrin repeat and SOCS box protein 7	1.94e-10	NA	1.01e-05
3. B	Q5UPV1	Putative ankyrin repeat protein L271	NA	NA	6.78e-06
3. B	Q9JLU4	SH3 and multiple ankyrin repeat domains protein 3	1.33e-02	NA	0.029
3. B	A2A2Z9	Ankyrin repeat domain-containing protein 18B	6.74e-05	NA	3.12e-55
3. B	Q5UPU4	Putative ankyrin repeat protein R267	NA	NA	0.038
3. B	Q9J5H7	Putative ankyrin repeat protein FPV024	NA	NA	1.42e-07
3. B	Q09701	Palmitoyltransferase akr1	1.60e-06	NA	2.19e-08
3. B	Q01705	Neurogenic locus notch homolog protein 1	1.08e-01	NA	1.13e-10
3. B	Q9Z2G1	Protein fem-1 homolog A-A	2.12e-05	NA	6.72e-12
3. B	P0C550	Potassium channel AKT1	1.23e-03	NA	5.83e-08
3. B	X1WE18	KN motif and ankyrin repeat domain-containing protein 2	4.78e-03	NA	0.002
3. B	G5EGA3	Ankyrin repeat and LEM domain-containing protein 1 homolog	3.99e-02	NA	0.008
3. B	Q5UQI7	Putative ankyrin repeat protein R838	NA	NA	0.002
3. B	Q8WXK1	Ankyrin repeat and SOCS box protein 15	8.47e-07	NA	0.021
3. B	Q2IBF8	Cortactin-binding protein 2	9.78e-03	NA	7.72e-10
3. B	Q2T9K6	Protein fem-1 homolog C	1.27e-07	NA	4.60e-13
3. B	Q9ULJ7	Ankyrin repeat domain-containing protein 50	1.79e-03	NA	2.91e-11
3. B	Q07DX6	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.22e-07	NA	4.64e-06
3. B	A5PK26	Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1	3.68e-03	NA	0.004
3. B	Q8VHK1	Caskin-2	5.72e-04	NA	0.024
3. B	Q9ZCL3	Putative ankyrin repeat protein RP714	2.37e-12	NA	8.59e-06
3. B	Q9Y6X6	Unconventional myosin-XVI	1.05e-02	NA	0.028
3. B	P46531	Neurogenic locus notch homolog protein 1	7.24e-02	NA	2.16e-10
3. B	Q2IBE6	Cortactin-binding protein 2	1.02e-02	NA	1.69e-08
3. B	Q3ZBX7	Ankyrin repeat domain-containing protein 1	2.30e-09	NA	3.92e-12
3. B	Q4V869	Acyl-CoA-binding domain-containing protein 6	6.59e-06	NA	1.29e-10
3. B	Q09YG9	Cortactin-binding protein 2	1.13e-02	NA	1.32e-08
3. B	Q8HXA6	Ankyrin repeat and SOCS box protein 15	4.56e-06	NA	0.014
3. B	Q0P5G1	Tonsoku-like protein	1.57e-02	NA	1.05e-04
3. B	Q91ZU1	Ankyrin repeat and SOCS box protein 6	1.08e-07	NA	0.021
3. B	Q52T38	Protein S-acyltransferase 24	8.87e-06	NA	0.003
3. B	P0C6S7	Ankyrin repeat and sterile alpha motif domain-containing protein 1B	2.62e-04	NA	0.001
3. B	Q96JP0	Protein fem-1 homolog C	1.03e-07	NA	5.86e-11
3. B	P0C6C1	Ankyrin repeat domain-containing protein 34C	6.23e-05	NA	4.81e-05
3. B	F1N6G5	E3 ubiquitin-protein ligase HACE1	2.34e-05	NA	8.84e-08
3. B	Q8NFD2	Ankyrin repeat and protein kinase domain-containing protein 1	1.07e-05	NA	1.49e-15
3. B	Q865U8	Ankyrin repeat domain-containing protein 1	9.74e-10	NA	1.59e-12
3. B	Q9DF58	Integrin-linked protein kinase	1.01e-07	NA	2.02e-10
3. B	Q6NZL6	Tonsoku-like protein	2.09e-02	NA	9.61e-05
3. B	O60237	Protein phosphatase 1 regulatory subunit 12B	6.07e-05	NA	0.003
3. B	Q1LZH7	KN motif and ankyrin repeat domain-containing protein 2	7.95e-04	NA	1.27e-05
3. B	P17442	Phosphate system positive regulatory protein PHO81	1.60e-02	NA	9.96e-05
3. B	Q8QN36	Ankyrin repeat domain-containing protein CP77	NA	NA	0.007
3. B	A2VDR2	Acyl-CoA-binding domain-containing protein 6	1.92e-06	NA	2.55e-12
3. B	Q00PJ1	Cortactin-binding protein 2	2.38e-02	NA	9.03e-10
3. B	Q54BA2	Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800	3.99e-05	NA	8.18e-11
3. B	Q9VCA8	Ankyrin repeat and KH domain-containing protein mask	NA	NA	2.37e-13
3. B	Q04861	Nuclear factor NF-kappa-B p105 subunit	2.43e-04	NA	8.48e-04
3. B	A2ARS0	Ankyrin repeat domain-containing protein 63	1.08e-07	NA	0.001
3. B	F1MJR8	Inactive serine/threonine-protein kinase TEX14	5.76e-02	NA	8.03e-08
3. B	Q15327	Ankyrin repeat domain-containing protein 1	8.98e-10	NA	1.42e-12
3. B	Q25338	Delta-latroinsectotoxin-Lt1a	1.39e-04	NA	2.96e-09
3. B	Q5UPB6	Putative ankyrin repeat protein L45	NA	NA	0.011
3. B	Q9BXX3	Ankyrin repeat domain-containing protein 30A	6.28e-04	NA	5.07e-129
3. B	Q86YT6	E3 ubiquitin-protein ligase MIB1	3.18e-04	NA	4.17e-11
3. B	Q94CT7	Probable E3 ubiquitin-protein ligase XBOS31	8.31e-08	NA	1.12e-06
3. B	Q9TZC4	Integrin-linked protein kinase homolog pat-4	1.82e-09	NA	2.41e-10
3. B	O89019	Inversin	7.69e-04	NA	9.70e-13
3. B	Q5SUE8	Ankyrin repeat domain-containing protein 40	2.95e-03	NA	0.037
3. B	Q66JD7	Acyl-CoA-binding domain-containing protein 6	1.62e-07	NA	6.54e-11
3. B	Q9J4Z8	Putative ankyrin repeat protein FPV242	NA	NA	0.002
3. B	Q69ZU8	Ankyrin repeat domain-containing protein 6	6.81e-07	NA	5.06e-14
3. B	Q8WMX8	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	3.64e-07	NA	2.76e-06
3. B	Q07DZ7	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.43e-07	NA	0.014
3. B	Q0JKV1	Potassium channel AKT1	1.18e-03	NA	5.67e-08
3. B	Q09YH1	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.70e-07	NA	3.46e-07
3. B	Q2IBB2	Cortactin-binding protein 2	1.38e-02	NA	1.38e-11
3. B	Q5UPG7	Putative ankyrin repeat protein L91	NA	NA	0.016
3. B	Q9EQG6	Kinase D-interacting substrate of 220 kDa	7.05e-03	NA	3.29e-16
3. B	Q5ZLC6	Ankyrin repeat domain-containing protein 10	1.55e-06	NA	3.46e-05
3. B	Q4KL97	Ankyrin repeat domain-containing protein 1	7.18e-10	NA	8.48e-12
3. B	Q91955	Myotrophin	3.73e-12	NA	0.005
3. B	O43150	Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2	2.67e-02	NA	0.011
3. B	P58546	Myotrophin	2.44e-12	NA	0.006
3. B	Q2QLG9	Cortactin-binding protein 2	1.04e-02	NA	2.29e-08
3. B	Q4R544	Ankyrin repeat and SOCS box protein 8	2.22e-09	NA	9.57e-13
3. B	Q9J4Z6	Putative ankyrin repeat protein FPV244	NA	NA	1.33e-06
3. B	Q9J5A7	Putative ankyrin repeat protein FPV115	NA	NA	8.68e-06
3. B	Q5ZJJ9	Osteoclast-stimulating factor 1	6.34e-07	NA	0.037
3. B	Q07E17	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.84e-07	NA	3.66e-06
3. B	Q9UVH3	Palmitoyltransferase AKR1 (Fragment)	5.81e-06	NA	1.60e-05
3. B	O08560	Diacylglycerol kinase zeta	5.79e-03	NA	0.024
3. B	P0CG38	POTE ankyrin domain family member I	1.78e-04	NA	2.14e-46
3. B	A0JP26	POTE ankyrin domain family member B3	1.09e-05	NA	7.78e-49
3. B	Q5UPA2	Putative ankyrin repeat protein L23	NA	NA	0.024
3. B	O74205	Transcription factor TOXE	2.16e-06	NA	2.52e-06
3. B	Q09YJ5	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	3.44e-07	NA	5.17e-06
3. B	Q8WMX6	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	2.36e-07	NA	2.36e-06
3. B	Q5F478	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B	4.07e-05	NA	4.57e-13
3. B	Q8K3X6	Ankyrin repeat and SAM domain-containing protein 4B	1.77e-05	NA	7.80e-05
3. B	Q5UP14	Putative ankyrin repeat protein R845	NA	NA	0.020
3. B	Q9J507	Putative ankyrin repeat protein FPV228	NA	NA	6.60e-10
3. B	Q7TQP6	Serine/threonine-protein kinase TNNI3K	6.42e-07	NA	2.58e-05
3. B	P0CS67	Palmitoyltransferase AKR1	8.78e-06	NA	1.49e-14
3. B	Q9Z2G0	Protein fem-1 homolog B	1.97e-06	NA	6.78e-07
3. B	Q5UP11	Putative ankyrin repeat protein R848	NA	NA	3.21e-05
3. B	G5E8K5	Ankyrin-3	1.54e-02	NA	7.69e-13
3. B	Q6DD51	Caskin-2	4.92e-04	NA	0.001
3. B	Q3TYA6	M-phase phosphoprotein 8	2.41e-04	NA	1.69e-04
3. B	P21783	Neurogenic locus notch homolog protein 1	1.21e-01	NA	1.87e-06
3. B	Q8TF21	Ankyrin repeat domain-containing protein 24	5.21e-04	NA	5.90e-06
3. B	A0A0A6YYL3	POTE ankyrin domain family member B	2.29e-07	NA	8.36e-50
3. B	A0A0R4IQZ2	Putative palmitoyltransferase ZDHHC13	1.53e-05	NA	1.18e-13
3. B	Q96HA7	Tonsoku-like protein	5.96e-03	NA	4.27e-05
3. B	Q5CZ79	Ankyrin repeat domain-containing protein 20B	2.40e-05	NA	3.62e-57
3. B	Q9H765	Ankyrin repeat and SOCS box protein 8	4.16e-09	NA	4.16e-12
3. B	Q3KP44	Ankyrin repeat domain-containing protein 55	3.95e-05	NA	1.28e-05
3. B	Q99549	M-phase phosphoprotein 8	4.54e-04	NA	1.15e-04
3. B	Q1RJR6	Putative ankyrin repeat protein RBE_0317	1.40e-09	NA	4.12e-06
3. B	Q10728	Protein phosphatase 1 regulatory subunit 12A	2.19e-04	NA	0.017
3. B	P07207	Neurogenic locus Notch protein	NA	NA	3.65e-07
3. B	Q07DV1	Cortactin-binding protein 2	1.16e-02	NA	4.88e-09
3. B	Q9CWU2	Palmitoyltransferase ZDHHC13	1.24e-05	NA	6.36e-12
3. B	Q9W0T5	Transient receptor potential channel pyrexia	7.69e-05	NA	3.23e-09
3. B	Q9NWX5	Ankyrin repeat and SOCS box protein 6	1.00e-07	NA	0.004
3. B	Q5W7F2	ADP-ribosylation factor GTPase-activating protein AGD3	5.57e-02	NA	0.042
3. B	Q9STP8	Acyl-CoA-binding domain-containing protein 2	1.44e-05	NA	1.90e-10
3. B	Q04749	Target of rapamycin complex 2 subunit AVO2	2.24e-08	NA	0.015
3. B	A2CIR5	Ankyrin repeat-containing protein NPR4	1.06e-06	NA	0.007
3. B	Q1RHQ8	Putative ankyrin repeat protein RBE_1025	2.95e-09	NA	7.27e-07
3. B	Q07DX4	Cortactin-binding protein 2	1.08e-02	NA	2.03e-08
3. B	Q63ZY3	KN motif and ankyrin repeat domain-containing protein 2	8.53e-04	NA	5.33e-04
3. B	Q9CR42	Ankyrin repeat domain-containing protein 1	3.09e-11	NA	7.95e-16
3. B	Q8BTZ5	Ankyrin repeat domain-containing protein 46	4.02e-08	NA	6.09e-06
3. B	A6NK59	Ankyrin repeat and SOCS box protein 14	3.08e-07	NA	2.96e-05
3. B	Q8BLA8	Transient receptor potential cation channel subfamily A member 1	1.38e-03	NA	1.28e-06
3. B	Q8H569	Potassium channel AKT3	1.12e-03	NA	3.08e-08
3. B	Q5UQ08	Putative ankyrin repeat protein R787	NA	NA	0.002
3. B	A8VU90	Ankyrin repeat and LEM domain-containing protein 1	2.74e-05	NA	0.016
3. B	O73630	Nuclear factor NF-kappa-B p100 subunit	4.82e-04	NA	8.23e-08
3. B	Q5UQV3	Putative ankyrin repeat protein L371	NA	NA	5.67e-06
3. B	Q6C520	Palmitoyltransferase AKR1	8.76e-06	NA	7.30e-08
3. B	Q2QLA2	Cortactin-binding protein 2	1.39e-02	NA	7.57e-11
3. B	P12932	Ankyrin repeat domain-containing protein CP77	NA	NA	0.017
3. B	O75179	Ankyrin repeat domain-containing protein 17	6.38e-02	NA	1.53e-13
3. B	Q5UQJ2	Putative ankyrin repeat protein R863	NA	NA	7.61e-04
3. B	Q86AT8	Stress-activated protein kinase alpha	1.58e-05	NA	0.002
3. B	Q09YM8	Cortactin-binding protein 2	1.06e-02	NA	1.50e-10
3. B	Q9WTK5	Nuclear factor NF-kappa-B p100 subunit	1.61e-03	NA	1.88e-05
3. B	Q6GPE5	Protein fem-1 homolog B	1.57e-07	NA	4.18e-07
3. B	Q8WXE0	Caskin-2	8.87e-04	NA	0.003
3. B	Q69ZR2	E3 ubiquitin-protein ligase HECTD1	3.49e-01	NA	0.002
3. B	Q4R690	Palmitoyltransferase ZDHHC13	3.96e-05	NA	1.04e-10
3. B	Q07E30	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.84e-07	NA	1.96e-06
3. B	Q5DW34	Histone-lysine N-methyltransferase EHMT1	2.49e-03	NA	3.60e-12
3. B	Q80YE7	Death-associated protein kinase 1	2.77e-03	NA	8.79e-16
3. B	Q5URB8	Putative ankyrin repeat protein R841	NA	NA	0.025
3. B	Q5UPG0	Putative ankyrin repeat protein L86	NA	NA	5.58e-06
3. B	E9PTT0	Palmitoyltransferase ZDHHC17	8.30e-06	NA	1.57e-11
3. B	P0DJE3	Alpha-latrotoxin-Lhe1a	2.24e-03	NA	1.39e-06
3. B	O00221	NF-kappa-B inhibitor epsilon	6.92e-07	NA	1.64e-05
3. B	Q2IBF5	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	3.73e-07	NA	1.86e-06
3. B	Q9VSA4	Tonsoku-like protein	2.10e-02	NA	0.003
3. B	Q3UYR4	Espin-like protein	4.89e-04	NA	0.020
3. B	Q8IWZ3	Ankyrin repeat and KH domain-containing protein 1	5.69e-02	NA	6.72e-14
3. B	Q4V890	Protein fem-1 homolog A	4.67e-06	NA	1.19e-11
3. B	Q8IVF6	Ankyrin repeat domain-containing protein 18A	1.89e-04	NA	8.81e-53
3. B	Q9J5H5	Putative ankyrin repeat protein FPV026	NA	NA	2.55e-06
3. B	Q9J4Z4	Putative ankyrin repeat protein FPV246	NA	NA	9.47e-14
3. B	A6NC57	Ankyrin repeat domain-containing protein 62	1.67e-05	NA	3.69e-51
3. B	Q5RD76	NAD-capped RNA hydrolase NUDT12	2.89e-03	NA	0.008
3. B	Q4ACU6	SH3 and multiple ankyrin repeat domains protein 3	1.44e-02	NA	0.029
3. B	Q6AI12	Ankyrin repeat domain-containing protein 40	1.84e-03	NA	0.034
3. B	Q8C6Y6	Ankyrin repeat and SOCS box protein 14	2.27e-06	NA	3.46e-07
3. B	Q5UPJ9	Putative ankyrin repeat protein L122	NA	NA	3.29e-07
3. B	Q5AL27	Palmitoyltransferase AKR1	4.90e-05	NA	6.24e-05
3. B	Q54F46	Homeobox protein Wariai	8.24e-05	NA	5.51e-12
3. B	Q108T9	Cortactin-binding protein 2	1.40e-02	NA	2.59e-10
3. B	Q9H672	Ankyrin repeat and SOCS box protein 7	1.75e-10	NA	9.98e-06
3. B	Q9ET47	Espin	2.08e-04	NA	5.28e-05
3. B	Q9GKW8	Ankyrin repeat and death domain-containing protein 1A (Fragment)	3.59e-07	NA	7.18e-10
3. B	Q05921	2-5A-dependent ribonuclease	9.53e-06	NA	1.31e-06
3. B	Q5ZIJ9	E3 ubiquitin-protein ligase MIB2	6.97e-05	NA	1.15e-05
3. B	Q07DV3	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.12e-07	NA	3.72e-07
3. B	Q80VM7	Ankyrin repeat domain-containing protein 24	1.66e-04	NA	1.12e-07
3. B	P50086	Probable 26S proteasome regulatory subunit p28	7.89e-14	NA	0.008
3. B	Q1RHT6	Putative ankyrin repeat protein RBE_0997	6.61e-09	NA	1.92e-15
3. B	Q505D1	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A	2.14e-04	NA	1.80e-15
3. B	O90760	Putative ankyrin repeat protein FPV031	NA	NA	4.53e-04
3. B	Q8IUH4	Palmitoyltransferase ZDHHC13	1.59e-04	NA	1.93e-12
3. B	P81069	GA-binding protein subunit beta-2	1.40e-06	NA	1.47e-04
3. B	Q54GC8	Acyl-CoA-binding domain-containing protein 6 homolog	2.89e-06	NA	1.90e-07
3. B	Q9UPS8	Ankyrin repeat domain-containing protein 26	3.55e-03	NA	8.96e-65
3. B	Q9VUW9	Palmitoyltransferase Hip14	1.20e-05	NA	5.16e-11
3. B	Q9NXR5	Ankyrin repeat domain-containing protein 10	1.20e-06	NA	3.59e-05
3. B	Q00420	GA-binding protein subunit beta-1	2.40e-09	NA	6.40e-05
3. B	Q6NLQ8	E3 ubiquitin-protein ligase XBAT32	2.74e-06	NA	0.004
3. B	Q9J508	Putative ankyrin repeat protein FPV227	NA	NA	1.11e-05
3. B	Q1RI12	Putative ankyrin repeat protein RBE_0921	4.52e-05	NA	5.29e-06
3. B	Q9Y6H5	Synphilin-1	4.98e-04	NA	3.70e-04
3. B	A4D7T3	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.58e-07	NA	2.31e-04
3. B	Q5ZXN6	Phosphocholine transferase AnkX	1.51e-03	NA	5.77e-06
3. B	Q8R516	E3 ubiquitin-protein ligase MIB2	1.76e-05	NA	1.40e-05
3. B	P83757	NF-kappa-B inhibitor cactus	NA	NA	7.28e-04
3. B	Q13418	Integrin-linked protein kinase	2.67e-06	NA	4.56e-09
3. B	Q8BG95	Protein phosphatase 1 regulatory subunit 12B	1.39e-04	NA	0.002
3. B	Q9FDY4	BTB/POZ domain and ankyrin repeat-containing protein NPR1	9.45e-04	NA	0.007
3. B	Q6ZVH7	Espin-like protein	3.72e-04	NA	0.023
3. B	Q9C0D5	Protein TANC1	3.65e-03	NA	2.67e-10
3. B	Q9GKS9	Double zinc ribbon and ankyrin repeat-containing protein 1	2.45e-03	NA	0.009
3. B	Q5BKI6	Ankyrin repeat domain-containing protein 1	8.98e-10	NA	5.73e-13
3. B	Q9Z1P7	KN motif and ankyrin repeat domain-containing protein 3	8.47e-05	NA	3.41e-05
3. B	Q9J516	Putative ankyrin repeat protein FPV219	NA	NA	6.58e-05
3. B	Q07DZ5	Cortactin-binding protein 2	1.01e-02	NA	2.36e-10
3. B	Q09YN0	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.23e-07	NA	4.42e-07
3. B	Q2TXF6	Ankyrin repeat domain-containing protein oryK	4.12e-04	NA	0.005
3. B	D3YZU1	SH3 and multiple ankyrin repeat domains protein 1	6.16e-02	NA	0.002
3. B	Q02989	Alpha-latroinsectotoxin-Lt1a (Fragment)	8.53e-04	NA	2.68e-09
3. B	Q60J38	Ankyrin repeat and KH domain-containing protein CBG24701	8.78e-02	NA	7.41e-07
3. B	D3ZD05	KN motif and ankyrin repeat domain-containing protein 2	6.68e-04	NA	8.32e-05
3. B	Q8T2Q0	Putative ZDHHC-type palmitoyltransferase 6	2.64e-05	NA	0.001
3. B	B2RXR6	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B	4.14e-05	NA	2.76e-13
3. B	Q502K3	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C	1.58e-04	NA	1.99e-10
3. B	Q66H07	Fibronectin type 3 and ankyrin repeat domains 1 protein	1.33e-08	NA	1.03e-11
3. B	Q69YU3	Ankyrin repeat domain-containing protein 34A	7.00e-05	NA	1.83e-06
3. B	Q9C104	Glycerophosphocholine phosphodiesterase gde1	2.93e-03	NA	0.001
3. B	Q7M6U3	Inactive serine/threonine-protein kinase TEX14	4.17e-02	NA	2.24e-08
3. B	Q20500	Intracellular phospholipase A2	8.42e-03	NA	9.38e-07
3. B	Q9EP71	Ankycorbin	8.50e-05	NA	2.29e-10
3. B	Q9FIT8	ADP-ribosylation factor GTPase-activating protein AGD1	2.38e-02	NA	0.001
3. B	Q5PQ89	Ankyrin repeat domain-containing protein 34B	1.80e-04	NA	2.41e-04
3. B	Q2QLB3	Cortactin-binding protein 2	1.17e-02	NA	1.03e-08
3. B	Q05753	Ankyrin repeat domain-containing protein, chloroplastic	3.19e-06	NA	4.70e-14
3. B	Q8HYY4	Uveal autoantigen with coiled-coil domains and ankyrin repeats protein	1.77e-03	NA	5.14e-07
3. B	Q6UB99	Ankyrin repeat domain-containing protein 11	4.10e-01	NA	4.96e-06
3. B	O22265	Signal recognition particle 43 kDa protein, chloroplastic	8.81e-05	NA	1.44e-05
3. B	O55222	Integrin-linked protein kinase	1.98e-06	NA	5.24e-09
3. B	Q9J569	Putative ankyrin repeat protein FPV162	NA	NA	1.22e-06
3. B	Q969K4	Ankyrin repeat and BTB/POZ domain-containing protein 1	6.21e-03	NA	0.002
3. B	Q8MJ49	Osteoclast-stimulating factor 1	5.45e-07	NA	0.038
3. B	Q08DV6	Ankyrin repeat and SOCS box protein 3	9.55e-11	NA	9.71e-08
3. B	Q9SAR5	Ankyrin repeat domain-containing protein 2A	2.97e-07	NA	1.97e-06
3. B	Q76K24	Ankyrin repeat domain-containing protein 46	1.62e-08	NA	5.49e-06
3. B	Q09103	Eye-specific diacylglycerol kinase	3.50e-02	NA	0.008
3. B	Q4V8X4	Acyl-CoA-binding domain-containing protein 6	2.40e-07	NA	1.27e-10
3. B	Q04721	Neurogenic locus notch homolog protein 2	7.83e-02	NA	4.47e-10
3. B	Q9DCN1	NAD-capped RNA hydrolase NUDT12	7.18e-03	NA	0.015
3. B	Q09YI1	Cortactin-binding protein 2	1.59e-02	NA	3.39e-10
3. B	Q9C7A2	Ankyrin repeat-containing protein ITN1	1.38e-06	NA	4.48e-06
3. B	Q8N6D5	Ankyrin repeat domain-containing protein 29	4.66e-10	NA	2.76e-07
3. B	O15084	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A	3.41e-04	NA	5.41e-15
3. B	Q5NVB9	Palmitoyltransferase ZDHHC13	4.03e-05	NA	1.69e-12
3. B	Q7T2B9	Myotrophin	4.19e-12	NA	0.004
3. B	Q9J4Z5	Putative ankyrin repeat protein FPV245	NA	NA	1.61e-10
3. B	Q6P9Z4	Protein fem-1 homolog A	7.91e-08	NA	5.19e-13
3. B	Q8BTI7	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C	6.95e-04	NA	3.44e-11
3. B	Q9GZV1	Ankyrin repeat domain-containing protein 2	1.58e-08	NA	5.30e-11
3. B	Q9QW30	Neurogenic locus notch homolog protein 2	7.28e-02	NA	5.18e-10
3. B	Q6GQX6	Ankyrin repeat and SAM domain-containing protein 6	4.33e-04	NA	7.77e-09
3. B	Q108U1	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.79e-07	NA	5.17e-06
3. B	Q86U10	60 kDa lysophospholipase	4.61e-07	NA	4.77e-06
3. B	Q60649	Caseinolytic peptidase B protein homolog	5.49e-04	NA	5.87e-05
3. B	Q2IBB1	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.83e-06	NA	8.02e-07
3. B	Q3SX00	Ankyrin repeat domain-containing protein 46	3.17e-08	NA	1.93e-04
3. B	Q9SM23	Acyl-CoA-binding domain-containing protein 1	5.64e-06	NA	8.70e-12
3. B	Q59H18	Serine/threonine-protein kinase TNNI3K	1.01e-05	NA	4.78e-05
3. B	Q99PE2	Ankyrin repeat family A protein 2	3.15e-07	NA	1.34e-07
3. B	Q7ZYG4	Osteoclast-stimulating factor 1	6.33e-07	NA	0.042
3. B	Q0VC93	Ankyrin repeat domain-containing protein 37	7.11e-06	NA	0.038
3. B	Q9BSK4	Protein fem-1 homolog A	5.94e-06	NA	8.09e-10
3. B	Q9H9B1	Histone-lysine N-methyltransferase EHMT1	1.90e-03	NA	1.52e-11
3. B	Q99ME3	Synphilin-1	9.95e-04	NA	6.75e-04
3. B	Q9BQG2	NAD-capped RNA hydrolase NUDT12	3.84e-03	NA	0.009
3. B	A0JNU3	60 kDa lysophospholipase	3.78e-07	NA	1.42e-06
3. B	Q28BK1	E3 ubiquitin-protein ligase HACE1	4.88e-05	NA	4.72e-07
3. B	D4A615	Tonsoku-like protein	4.42e-02	NA	9.02e-05
3. B	Q9J5I7	Putative ankyrin repeat protein FPV014	NA	NA	9.95e-06
3. B	H3BUK9	POTE ankyrin domain family member B2	1.27e-05	NA	8.36e-50
3. B	Q9BZF9	Uveal autoantigen with coiled-coil domains and ankyrin repeats	1.96e-03	NA	1.51e-06
3. B	Q9DAM9	Fibronectin type 3 and ankyrin repeat domains 1 protein	2.16e-08	NA	1.40e-11
3. B	Q8N283	Ankyrin repeat domain-containing protein 35	2.55e-04	NA	3.89e-10
3. B	Q1RJR4	Putative ankyrin repeat protein RBE_0319	6.95e-06	NA	0.001
3. B	O60733	85/88 kDa calcium-independent phospholipase A2	6.87e-05	NA	6.40e-10
3. B	Q8BLB8	Ankyrin repeat domain-containing protein 34C	1.09e-04	NA	3.66e-05
3. B	Q9ERK0	Receptor-interacting serine/threonine-protein kinase 4	1.67e-06	NA	1.95e-08
3. B	Q810B6	Rabankyrin-5	9.01e-04	NA	1.38e-07
3. B	Q9J517	Putative ankyrin repeat protein FPV218	NA	NA	4.33e-05
3. B	Q09YJ3	Cortactin-binding protein 2	8.47e-03	NA	3.75e-10
3. B	Q12955	Ankyrin-3	NA	NA	8.80e-13
3. B	Q6TNT2	Ankyrin repeat domain-containing protein 46	6.36e-08	NA	6.62e-04
3. B	Q8C0T1	Protein fem-1 homolog A-B	3.99e-05	NA	4.36e-11
3. B	A2RUV0	Neurogenic locus notch homolog protein 1	1.54e-01	NA	1.59e-09
3. B	P04297	Interferon antagonist K1L	NA	NA	1.28e-04
3. B	Q38998	Potassium channel AKT1	4.47e-04	NA	6.43e-06
3. B	Q80TN5	Palmitoyltransferase ZDHHC17	9.75e-06	NA	1.45e-11
3. B	C9JTQ0	Ankyrin repeat domain-containing protein 63	3.53e-07	NA	7.87e-04
3. B	Q7S3M5	Palmitoyltransferase akr1	7.02e-05	NA	3.18e-12
3. B	Q7Z6G8	Ankyrin repeat and sterile alpha motif domain-containing protein 1B	2.83e-04	NA	7.52e-04
3. B	Q99LJ2	Ankyrin repeat and BTB/POZ domain-containing protein 1	9.19e-03	NA	0.002
3. B	A5PLL1	Ankyrin repeat domain-containing protein 34B	1.23e-04	NA	0.008
3. B	Q5R5V4	Integrin-linked protein kinase	2.36e-06	NA	5.05e-09
3. B	Q4UKX2	Putative ankyrin repeat protein RF_0950	9.90e-09	NA	1.27e-09
3. B	F1M5M3	Inactive serine/threonine-protein kinase TEX14	NA	NA	2.45e-06
3. B	P62775	Myotrophin	2.01e-12	NA	0.006
3. B	Q6ZW76	Ankyrin repeat and SAM domain-containing protein 3	4.61e-05	NA	3.76e-15
3. B	Q2IBB4	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.97e-07	NA	2.05e-06
3. B	Q9BYB0	SH3 and multiple ankyrin repeat domains protein 3	1.67e-02	NA	7.56e-04
3. B	Q9TZM3	Leucine-rich repeat serine/threonine-protein kinase 1	1.98e-01	NA	9.96e-10
3. B	P31695	Neurogenic locus notch homolog protein 4	1.87e-02	NA	4.20e-07
3. B	Q8GXE6	Potassium channel AKT6	5.63e-05	NA	1.75e-08
3. B	A0A140LI88	Ankyrin repeat domain-containing protein 31	1.41e-01	NA	0.010
3. B	Q5E9N5	Caseinolytic peptidase B protein homolog	2.97e-04	NA	1.23e-04
3. B	Q09YK4	Cortactin-binding protein 2	1.18e-02	NA	6.17e-08
3. B	Q8C8R3	Ankyrin-2	NA	NA	2.58e-10
3. B	E1C656	E3 ubiquitin-protein ligase HACE1	3.34e-06	NA	5.65e-07
3. B	Q6F6B3	Protein TANC1	3.35e-03	NA	9.12e-11
3. B	P17369	Ankyrin repeat protein 14	NA	NA	1.23e-04
3. B	Q86W74	Ankyrin repeat domain-containing protein 46	1.01e-08	NA	1.93e-04
3. B	Q07DY6	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	2.50e-07	NA	6.44e-06
3. B	Q8N8V4	Ankyrin repeat and SAM domain-containing protein 4B	2.41e-05	NA	2.51e-05
3. B	Q7SIG6	Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2	2.02e-02	NA	0.009
3. B	Q4R7L8	NAD-capped RNA hydrolase NUDT12	4.22e-03	NA	0.008
3. B	P40480	Protein HOS4	3.13e-03	NA	7.61e-06
3. B	Q9UU77	Ankyrin repeat-containing protein P1E11.10	5.04e-07	NA	0.003
3. B	Q9H9E1	Ankyrin repeat family A protein 2	2.47e-08	NA	1.55e-08
3. B	Q6NXT1	Ankyrin repeat domain-containing protein 54	1.05e-06	NA	1.23e-08
3. B	Q8BIZ1	Ankyrin repeat and sterile alpha motif domain-containing protein 1B	1.19e-03	NA	7.13e-04
3. B	Q6AWW5	Ankyrin repeat-containing protein At5g02620	6.04e-07	NA	7.16e-10
3. B	Q9QZH2	BRCA1-associated RING domain protein 1	5.64e-04	NA	8.76e-05
3. B	Q92HB1	Putative ankyrin repeat protein RC0860	3.55e-05	NA	0.002
3. B	Q5T7N3	KN motif and ankyrin repeat domain-containing protein 4	1.19e-03	NA	0.005
3. B	Q7ZT11	Ankyrin repeat domain-containing protein 1	4.51e-10	NA	1.29e-14
3. B	Q07E43	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.58e-07	NA	2.99e-06
3. B	Q8TC84	Fibronectin type 3 and ankyrin repeat domains protein 1	2.04e-08	NA	8.67e-12
3. B	Q9J503	Putative ankyrin repeat protein FPV232	NA	NA	0.010
3. B	Q99728	BRCA1-associated RING domain protein 1	4.96e-03	NA	6.12e-05
3. B	P97570	85/88 kDa calcium-independent phospholipase A2	7.62e-04	NA	9.36e-10
3. B	Q6S8J7	POTE ankyrin domain family member A	3.80e-07	NA	6.86e-52
3. B	Q07008	Neurogenic locus notch homolog protein 1	1.12e-01	NA	1.15e-10
3. B	A3AYR1	Acyl-CoA-binding domain-containing protein 4	1.29e-06	NA	1.21e-12
3. B	Q3UMR0	Ankyrin repeat domain-containing protein 27	5.28e-04	NA	1.62e-07
3. B	Q9H078	Caseinolytic peptidase B protein homolog	2.03e-03	NA	1.00e-04
3. B	Q3T0F7	Myotrophin	2.10e-12	NA	0.006
3. B	Q811D2	Ankyrin repeat domain-containing protein 26	4.30e-03	NA	1.34e-59
3. B	Q07DY4	Cortactin-binding protein 2	1.40e-02	NA	1.93e-09
3. B	Q9VL06	E3 ubiquitin-protein ligase Ufd4	NA	NA	0.011
3. B	Q9HCD6	Protein TANC2	9.59e-03	NA	2.19e-10
3. B	A1X157	Cortactin-binding protein 2	1.33e-02	NA	2.37e-10
3. B	Q9D3J5	Ankyrin repeat domain-containing protein 22	6.66e-16	NA	4.08e-08
3. B	Q9Z148	Histone-lysine N-methyltransferase EHMT2	2.23e-04	NA	1.02e-10
3. B	Q9GL21	Uveal autoantigen with coiled-coil domains and ankyrin repeats	1.63e-03	NA	1.65e-06
3. B	Q1RK13	Putative ankyrin repeat protein RBE_0220	2.36e-05	NA	3.62e-08
3. B	Q54XX5	Probable serine/threonine-protein kinase DDB_G0278535	1.87e-04	NA	2.41e-07
3. B	Q9CZK6	Ankyrin repeat and SAM domain-containing protein 3	1.60e-06	NA	1.07e-16
3. B	Q5UPF8	Putative ankyrin repeat protein L88	NA	NA	2.81e-07
3. B	Q99J82	Integrin-linked protein kinase	2.37e-06	NA	5.24e-09
3. B	Q2QLF8	Cortactin-binding protein 2	1.67e-02	NA	6.21e-09
3. B	Q2IBF7	Cortactin-binding protein 2	1.21e-02	NA	1.24e-08
3. B	Q71S22	Inversin-A	4.78e-04	NA	1.65e-12
3. B	Q8TAK5	GA-binding protein subunit beta-2	1.13e-07	NA	1.95e-04
3. B	Q5XIU1	Ankyrin repeat and BTB/POZ domain-containing protein 1	9.14e-03	NA	0.001
3. B	A0M8T3	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	5.01e-07	NA	1.07e-06
3. B	Q5BJT1	Ankyrin repeat domain-containing protein 34A	1.02e-04	NA	1.65e-06
3. B	Q4UMH6	Putative ankyrin repeat protein RF_0381	9.53e-05	NA	3.98e-15
3. B	P53355	Death-associated protein kinase 1	5.26e-04	NA	7.81e-17
3. B	Q804S5	E3 ubiquitin-protein ligase mib1	1.54e-04	NA	5.85e-11
3. B	Q8IYU2	E3 ubiquitin-protein ligase HACE1	1.97e-06	NA	8.92e-08
3. B	Q875S9	Palmitoyltransferase AKR1	1.37e-05	NA	1.67e-11
3. B	P0CS66	Palmitoyltransferase AKR1	1.04e-05	NA	1.49e-14
3. B	Q6B858	Fibronectin type 3 and ankyrin repeat domains protein 1	5.18e-11	NA	9.26e-12
3. B	Q8NB46	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C	5.51e-04	NA	1.51e-11
3. B	Q9J4Z7	Putative ankyrin repeat protein FPV243	NA	NA	0.020
3. B	Q5REW9	Ankyrin repeat domain-containing protein 27	9.41e-05	NA	1.43e-09
3. B	Q863Z4	Myotrophin	2.16e-12	NA	0.006
3. B	Q6JAN1	Inversin	6.06e-04	NA	3.94e-12
3. B	G3V8T1	M-phase phosphoprotein 8	2.64e-04	NA	1.51e-04
3. B	F4IS56	Integrin-linked protein kinase 1	1.38e-03	NA	0.007
3. B	Q5RJK8	Acyl-CoA-binding domain-containing protein 6	2.22e-06	NA	5.44e-10
3. B	D3ZBM7	E3 ubiquitin-protein ligase HACE1	1.19e-04	NA	6.30e-08
3. B	Q9J5G9	Putative ankyrin repeat protein FPV034	NA	NA	1.54e-10
3. B	A2AS55	Ankyrin repeat domain-containing protein 16	1.10e-06	NA	0.006
3. B	Q2QLA4	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	3.00e-07	NA	3.05e-06
3. B	P23631	Alpha-latrotoxin-Lt1a	4.61e-03	NA	1.46e-05
3. B	P39010	Palmitoyltransferase AKR1	3.72e-05	NA	2.81e-06
3. B	Q8WXD9	Caskin-1	5.11e-04	NA	6.25e-07
3. B	Q8R560	Ankyrin repeat domain-containing protein 1	1.23e-09	NA	8.23e-15
3. B	Q9FY48	E3 ubiquitin-protein ligase KEG	6.51e-03	NA	1.06e-06
3. B	Q54XY6	Probable serine/threonine-protein kinase DDB_G0278521	1.22e-03	NA	0.008
3. B	A0A084B9Z8	Ankyrin repeat domain-containing protein SAT10	6.27e-02	NA	2.56e-07
3. B	Q8WZ74	Cortactin-binding protein 2	1.51e-02	NA	1.22e-08
3. B	Q3EC11	Probable protein S-acyltransferase 23	1.60e-05	NA	6.41e-07
3. B	Q5B0V6	Palmitoyltransferase akr1	1.33e-05	NA	7.05e-12
3. B	Q8BLD6	Ankyrin repeat domain-containing protein 55	4.46e-05	NA	8.25e-05
3. B	Q6DRG7	Protein phosphatase 1 regulatory subunit 12A	1.11e-04	NA	8.79e-04
3. B	Q9VBP3	Poly [ADP-ribose] polymerase tankyrase	1.20e-03	NA	8.99e-06
3. B	Q7Z3H0	Photoreceptor ankyrin repeat protein	2.57e-05	NA	0.003
3. B	Q6DCL5	E3 ubiquitin-protein ligase HACE1	2.33e-05	NA	6.31e-07
3. B	Q9BR61	Acyl-CoA-binding domain-containing protein 6	1.52e-06	NA	5.08e-11
3. B	Q2QL82	Cortactin-binding protein 2	9.99e-03	NA	4.47e-10
3. B	Q96NW4	Ankyrin repeat domain-containing protein 27	2.38e-04	NA	8.65e-09