Summary

A8MSI8

Homolog: B4F6X2.
Function: LYR motif-containing protein 9.

Statistics

Total GO Annotation: 54
Unique PROST Go: 54
Unique BLAST Go: 0

Total Homologs: 121
Unique PROST Homologs: 112
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was B4F6X2 (LYR motif-containing protein 9) with a FATCAT P-Value: 0.0 and RMSD of 0.35 angstrom. The sequence alignment identity is 75.6%.
Structural alignment shown in left. Query protein A8MSI8 colored as red in alignment, homolog B4F6X2 colored as blue. Query protein A8MSI8 is also shown in right top, homolog B4F6X2 showed in right bottom. They are colored based on secondary structures. 

  A8MSI8 MAPLPGAELVRRPLQLYRYLLRCCQQLPTKGIQQHYKHAVRQSFRVHSDEDNPERIQQIIKRAIEDADWIMNKYKKQN 78
  B4F6X2 MPPLPGAELVHNPLQLYRYLLRCCKLLPTESLQHYYRHSVKQSFRVHADEDDPERIQQIIKRAIEDADWVLNKYKKES 78

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0005737 cytoplasm
2. P GO:0034553 mitochondrial respiratory chain complex II assembly
2. P GO:0043035 chromatin insulator sequence binding
2. P GO:1990221 L-cysteine desulfurase complex
2. P GO:0071819 DUBm complex
2. P GO:0030374 nuclear receptor coactivator activity
2. P GO:0022904 respiratory electron transport chain
2. P GO:0005747 mitochondrial respiratory chain complex I
2. P GO:0015976 carbon utilization
2. P GO:0010460 positive regulation of heart rate
2. P GO:0005762 mitochondrial large ribosomal subunit
2. P GO:0005643 nuclear pore
2. P GO:0006368 transcription elongation from RNA polymerase II promoter
2. P GO:0016578 histone deubiquitination
2. P GO:0009631 cold acclimation
2. P GO:0033615 mitochondrial proton-transporting ATP synthase complex assembly
2. P GO:0006094 gluconeogenesis
2. P GO:0031966 mitochondrial membrane
2. P GO:0006406 mRNA export from nucleus
2. P GO:0005758 mitochondrial intermembrane space
2. P GO:0006120 mitochondrial electron transport, NADH to ubiquinone
2. P GO:0050881 musculoskeletal movement
2. P GO:0003713 transcription coactivator activity
2. P GO:0006111 regulation of gluconeogenesis
2. P GO:0070131 positive regulation of mitochondrial translation
2. P GO:0050995 negative regulation of lipid catabolic process
2. P GO:0030437 ascospore formation
2. P GO:0000124 SAGA complex
2. P GO:0061469 regulation of type B pancreatic cell proliferation
2. P GO:0045777 positive regulation of blood pressure
2. P GO:0008137 NADH dehydrogenase (ubiquinone) activity
2. P GO:0045271 respiratory chain complex I
2. P GO:0005759 mitochondrial matrix
2. P GO:0005739 mitochondrion
2. P GO:0015031 protein transport
2. P GO:0001094 TFIID-class transcription factor complex binding
2. P GO:0032543 mitochondrial translation
2. P GO:0031936 obsolete negative regulation of chromatin silencing
2. P GO:0032307 negative regulation of prostaglandin secretion
2. P GO:0006979 response to oxidative stress
2. P GO:0055093 response to hyperoxia
2. P GO:0016604 nuclear body
2. P GO:0044183 protein folding chaperone
2. P GO:0045944 positive regulation of transcription by RNA polymerase II
2. P GO:1900139 negative regulation of arachidonic acid secretion
2. P GO:0014850 response to muscle activity
2. P GO:0006312 mitotic recombination
2. P GO:0042776 mitochondrial ATP synthesis coupled proton transport
2. P GO:0034551 mitochondrial respiratory chain complex III assembly
2. P GO:0070390 transcription export complex 2
2. P GO:0070742 C2H2 zinc finger domain binding
2. P GO:0016226 iron-sulfur cluster assembly
2. P GO:0032981 mitochondrial respiratory chain complex I assembly
2. P GO:0006105 succinate metabolic process

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB B6NK32 LYR motif-containing protein 9 0.00e+00 3.43e-40 2.45e-24
1. PB B5XFA7 LYR motif-containing protein 2 3.01e-13 1.80e-30 0.049
1. PB Q3UN90 LYR motif-containing protein 9 0.00e+00 7.41e-70 3.93e-49
1. PB A5D7J1 LYR motif-containing protein 9 0.00e+00 3.36e-86 1.11e-50
1. PB A8MSI8 LYR motif-containing protein 9 0 4.31e-129 8.41e-54
1. PB B3DFV0 LYR motif-containing protein 9 0.00e+00 3.21e-66 1.62e-35
1. PB A9SNJ1 LYR motif-containing protein PHYPADRAFT_186863 7.79e-10 1.97e-17 0.008
1. PB B4F6X2 LYR motif-containing protein 9 0.00e+00 5.08e-74 4.60e-42
1. PB B2RZD7 LYR motif-containing protein 9 0.00e+00 5.21e-82 1.05e-48
2. P P42114 NADH-ubiquinone oxidoreductase 14.8 kDa subunit 7.70e-06 2.56e-10 NA
2. P Q4R5J1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 5.26e-05 5.20e-11 NA
2. P B3DLF3 LYR motif-containing protein 2 1.47e-11 1.20e-33 NA
2. P B5XCZ6 Electron transfer flavoprotein regulatory factor 1 6.25e-09 1.53e-11 NA
2. P Q0MQA2 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 4.90e-05 9.12e-11 NA
2. P Q753Y5 Increased recombination centers protein 19 4.12e-03 1.10e-02 NA
2. P Q8K215 LYR motif-containing protein 4 2.47e-10 3.34e-13 NA
2. P Q9CR13 Protein FMC1 homolog 4.02e-05 2.34e-04 NA
2. P Q0MQA3 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 1.05e-05 7.60e-14 NA
2. P Q9US02 Succinate dehydrogenase assembly factor 1, mitochondrial 6.51e-10 1.29e-21 NA
2. P Q559Z4 Probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 5.74e-05 7.51e-09 NA
2. P Q54PT6 Electron transfer flavoprotein regulatory factor 1 homolog 1.47e-06 1.71e-04 NA
2. P B4JLC3 Enhancer of yellow 2 transcription factor 2.17e-02 4.93e-03 NA
2. P Q54T58 LYR motif-containing protein 1 1.57e-08 5.82e-05 NA
2. P Q6BIY6 Succinate dehydrogenase assembly factor 3, mitochondrial 1.87e-06 2.88e-10 NA
2. P B4L1Z8 Enhancer of yellow 2 transcription factor 9.23e-04 1.70e-02 NA
2. P B5XD90 LYR motif-containing protein 4B 4.29e-11 1.81e-15 NA
2. P Q4QQY2 Complex III assembly factor LYRM7 4.45e-07 1.80e-02 NA
2. P Q54FN9 LYR motif-containing protein 4 2.44e-10 2.31e-20 NA
2. P B4PY93 Enhancer of yellow 2 transcription factor 2.23e-03 3.99e-02 NA
2. P B8NCF0 Mitochondrial zinc maintenance protein 1, mitochondrial 1.12e-06 2.96e-02 NA
2. P P58503 30S ribosomal protein S17e 2.67e-03 1.88e-02 NA
2. P Q8SZ16 Succinate dehydrogenase assembly factor 3, mitochondrial 1.90e-06 1.37e-07 NA
2. P Q6DCS1 LYR motif-containing protein 4 1.09e-10 1.20e-14 NA
2. P Q9CQZ5 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 1.09e-05 1.07e-09 NA
2. P B4M6M6 Enhancer of yellow 2 transcription factor 4.25e-03 6.46e-03 NA
2. P P0CC00 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 4.14e-05 1.17e-10 NA
2. P Q3E785 Succinate dehydrogenase assembly factor 1, mitochondrial 7.90e-07 2.38e-27 NA
2. P Q32LM5 LYR motif-containing protein 2 5.50e-12 4.25e-33 NA
2. P Q0MQA1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 4.94e-05 9.12e-11 NA
2. P Q63362 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 4.09e-05 2.07e-11 NA
2. P O60068 Protein isd11 1.58e-07 1.18e-04 NA
2. P L0R8F8 MIEF1 upstream open reading frame protein 5.86e-07 1.65e-34 NA
2. P Q96HJ9 Protein FMC1 homolog 3.46e-05 4.59e-04 NA
2. P Q8U0U1 30S ribosomal protein S17e 2.58e-03 4.84e-02 NA
2. P P82116 Protein bcn92 3.11e-10 2.20e-13 NA
2. P Q9CZ83 39S ribosomal protein L55, mitochondrial 1.36e-01 2.07e-02 NA
2. P A6ZYX9 Succinate dehydrogenase assembly factor 1, mitochondrial 8.01e-07 2.38e-27 NA
2. P Q1XDB1 Putative DNA-directed RNA polymerase subunit omega 6.47e-05 3.59e-02 NA
2. P B5FXA0 Electron transfer flavoprotein regulatory factor 1 3.62e-09 2.36e-09 NA
2. P Q9HD34 LYR motif-containing protein 4 2.34e-10 3.04e-12 NA
2. P P62506 54S ribosomal protein L44, mitochondrial 1.57e-02 1.61e-05 NA
2. P Q59L89 Succinate dehydrogenase assembly factor 3, mitochondrial 2.23e-06 1.40e-10 NA
2. P Q1G3M2 LYR motif-containing protein At3g19508 5.54e-07 4.13e-07 NA
2. P B0WG73 Enhancer of yellow 2 transcription factor 2.41e-03 1.00e-04 NA
2. P Q6CUY0 Succinate dehydrogenase assembly factor 3, mitochondrial 2.41e-06 7.75e-10 NA
2. P Q54HG5 Succinate dehydrogenase assembly factor 1A, mitochondrial 1.21e-05 1.14e-23 NA
2. P Q9LHI0 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 1.64e-05 1.60e-11 NA
2. P B8JLQ0 LYR motif-containing protein 4 9.94e-09 6.67e-16 NA
2. P B6GWX1 Mitochondrial zinc maintenance protein 1, mitochondrial 1.78e-05 1.07e-03 NA
2. P Q3SZA2 Protein FMC1 homolog 3.06e-05 2.49e-04 NA
2. P Q4IN52 Succinate dehydrogenase assembly factor 3, mitochondrial 2.33e-06 1.92e-08 NA
2. P Q54F42 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 1.46e-05 1.69e-13 NA
2. P A9UMQ3 LYR motif-containing protein 1 1.04e-05 7.28e-03 NA
2. P Q29IN4 Enhancer of yellow 2 transcription factor 1.82e-03 2.70e-03 NA
2. P Q751X1 Succinate dehydrogenase assembly factor 3, mitochondrial 3.93e-06 6.81e-06 NA
2. P A3KNJ8 LYR motif-containing protein 5B 5.88e-08 4.42e-11 NA
2. P B5FZA8 LYR motif-containing protein 4 1.46e-10 1.50e-16 NA
2. P Q16718 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 5.19e-05 9.12e-11 NA
2. P Q6IPR1 Electron transfer flavoprotein regulatory factor 1 5.93e-09 1.62e-13 NA
2. P B5X5U9 LYR motif-containing protein 4A 2.19e-10 1.64e-14 NA
2. P A7S1A4 Protein FMC1 homolog 4.20e-05 6.24e-06 NA
2. P Q18359 Probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 1.40e-04 9.36e-06 NA
2. P Q9NU23 LYR motif-containing protein 2 1.48e-11 1.04e-35 NA
2. P O46098 Protein bcn92 3.89e-10 5.51e-13 NA
2. P Q39084 Late embryogenis abundant protein 41 3.32e-01 1.84e-02 NA
2. P Q2U0V4 Mitochondrial zinc maintenance protein 1, mitochondrial 1.34e-06 9.69e-03 NA
2. P Q5RES3 LYR motif-containing protein 2 1.55e-11 5.08e-36 NA
2. P Q91V16 Electron transfer flavoprotein regulatory factor 1 4.04e-09 4.29e-14 NA
2. P Q55BM0 Succinate dehydrogenase assembly factor 1B, mitochondrial 2.86e-10 4.34e-05 NA
2. P Q5BBH7 Succinate dehydrogenase assembly factor 3, mitochondrial 4.43e-06 1.04e-07 NA
2. P Q5RIM0 LYR motif-containing protein 2 1.71e-11 2.56e-38 NA
2. P Q17MZ8 Enhancer of yellow 2 transcription factor 6.59e-03 9.25e-04 NA
2. P G2TRM0 ATP synthase assembly factor fmc1, mitochondrial 4.63e-05 2.32e-05 NA
2. P P62507 54S ribosomal protein L44, mitochondrial 3.39e-02 7.28e-03 NA
2. P Q6FMR7 Succinate dehydrogenase assembly factor 3, mitochondrial 4.94e-06 2.61e-05 NA
2. P Q0MQA4 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 8.31e-06 2.04e-13 NA
2. P P0CM00 Succinate dehydrogenase assembly factor 3, mitochondrial 2.40e-06 1.20e-03 NA
2. P Q7Z7F7 39S ribosomal protein L55, mitochondrial 7.20e-02 4.66e-03 NA
2. P Q945M1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 4.34e-06 2.64e-05 NA
2. P Q4G012 Protein FMC1 homolog 2.84e-05 1.43e-03 NA
2. P P0CM01 Succinate dehydrogenase assembly factor 3, mitochondrial 2.62e-06 1.20e-03 NA
2. P A9UL63 Protein FMC1 homolog 2.30e-05 5.17e-04 NA
2. P P23935 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 4.08e-05 1.00e-09 NA
2. P Q0MQA5 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 1.04e-05 2.04e-13 NA
2. P A0JPA6 Complex III assembly factor LYRM7 4.54e-07 2.21e-02 NA
2. P Q4WHK3 Succinate dehydrogenase assembly factor 3, mitochondrial 3.75e-06 3.36e-12 NA
2. P Q8MNU8 Protein FMC1 homolog 5.45e-06 4.48e-07 NA
2. P Q4PCI7 Succinate dehydrogenase assembly factor 3, mitochondrial 6.47e-07 1.00e-02 NA
2. P Q9P7Y2 Succinate dehydrogenase assembly factor 3, mitochondrial 1.40e-06 1.99e-11 NA
2. P Q02366 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 1.02e-05 2.07e-13 NA
2. P A7S1H9 Succinate dehydrogenase assembly factor 3, mitochondrial 4.46e-07 3.62e-02 NA
2. P Q9VE04 39S ribosomal protein L55, mitochondrial 6.53e-01 3.14e-03 NA
2. P P56556 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 8.22e-06 2.04e-13 NA
2. P Q04401 Succinate dehydrogenase assembly factor 3, mitochondrial 5.37e-06 1.35e-04 NA
2. P Q7SF55 Succinate dehydrogenase assembly factor 3, mitochondrial 6.89e-06 3.50e-04 NA
2. P Q0VCR0 Electron transfer flavoprotein regulatory factor 1 1.87e-07 1.53e-12 NA
2. P Q9CPP6 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 4.14e-05 2.01e-11 NA
2. P Q503U1 LYR motif-containing protein 5A 3.03e-09 9.00e-15 NA
2. P Q0VCG0 LYR motif-containing protein 4 2.11e-10 4.73e-10 NA
2. P B4F7A1 Complex III assembly factor LYRM7 5.26e-07 4.32e-02 NA
2. P P0CB99 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 4.86e-05 2.22e-09 NA
2. P Q6Q560 Protein ISD11 8.11e-10 1.96e-21 NA
2. P Q5AX36 Mitochondrial zinc maintenance protein 1, mitochondrial 2.03e-06 3.72e-02 NA
2. P P51376 Putative DNA-directed RNA polymerase subunit omega 4.67e-05 1.08e-03 NA
2. P Q8R033 LYR motif-containing protein 2 2.40e-11 1.17e-37 NA
2. P Q5PQ90 LYR motif-containing protein 2 2.57e-11 7.03e-33 NA
2. P B2GV91 LYR motif-containing protein 2 2.78e-11 2.13e-35 NA
2. P Q54NR3 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 2.17e-06 4.92e-02 NA
2. P A1C9A5 Mitochondrial zinc maintenance protein 1, mitochondrial 1.54e-05 4.67e-02 NA
2. P P0C146 Succinate dehydrogenase assembly factor 3, mitochondrial 9.89e-06 2.33e-07 NA
2. P P21571 ATP synthase-coupling factor 6, mitochondrial 1.40e-02 6.40e-03 NA