Results | PROST

Summary

A8MTB9

Homolog: P11465.
Function: Pregnancy-specific beta-1-glycoprotein 2.

Statistics

Total GO Annotation: 514
Unique PROST Go: 384
Unique BLAST Go: 53

Total Homologs: 254
Unique PROST Homologs: 202
Unique BLAST Homologs: 25

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was P11465 (Pregnancy-specific beta-1-glycoprotein 2) with a FATCAT P-Value: 1.08e-14 and RMSD of 1.72 angstrom. The sequence alignment identity is 24.0%.
Structural alignment shown in left. Query protein A8MTB9 colored as red in alignment, homolog P11465 colored as blue. Query protein A8MTB9 is also shown in right top, homolog P11465 showed in right bottom. They are colored based on secondary structures.

  A8MTB9 M-DLSRPRWS--L-WRRVFLMASLL-ACGICQASGQIFI-TQTLGI-KGYRTVVALDKVPEDVQEYSWYWG-AND-----SA----GNMIISHKPPSAQQ 83
  P11465 MGPLSAPPCTEHIKWKGLLVTASLLNFWNL-PTTAQVTIEAQPPKVSEGKDVLLLVHNLPQNLTGYIWYKGQIRDLYHYITSYVVDGQIIIY-------- 91

  A8MTB9 PGPMYTGRERVNREGSLLIRPTALNDTGNYTVRVVA-GNETQRATGW----LEVLELGSNLGISVNASSL--VENMDSVAADC--LTNVTNITWYVN--D 172
  P11465 -GPAYSGRETAYSNASLLIQNVTREDAGSYTLHIIKRGDGTRGVTGYFTFTL-YLETPKP---SISSSNLNPREAMETVILTCDPETPDTSYQWWMNGQS 186

  A8MTB9 VPTSSSDRMTISPDGKTLVILRVSRYDRT---IQCMIESFPEIFQRSERISLTVAYGPDYVLLRSNPDDFNGIVTAEIGSQVEMECICYSFLDLKYHWIH 269
  P11465 LP--MTHRFQLSETNRTLFLFGVTKY--TAGPYECEIRNSGS-ASRSDPVTLNLLHGPD--LPRIHP-SYTNYRS---GDNLYLSCFANSNPPAQYSWTI 275

  A8MTB9 NGSLLNFSDAKMNL--SSLAWEQMGRYRCTVENPVTQLIMYMDVRIQAPHEDLTCCPQRFLHLRIHGDVPHHADSAGWRLHLWSPDPCSDQPLLNQDKSG 367
  P11465 NG---KFQQSGQNLFIPQITTKHSGLYVCSVRNSAT------------GEESSTS-----LTVKV---------SASTRIGL--------LPLLNPT--- 335

  A8MTB9 SMSVHPRPEDKTRRASR 384
  P11465 ----------------- 335

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
1. PB	GO:0007565	female pregnancy
1. PB	GO:0044319	wound healing, spreading of cells
1. PB	GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules
1. PB	GO:1903387	positive regulation of homophilic cell adhesion
1. PB	GO:1990782	protein tyrosine kinase binding
1. PB	GO:0015125	bile acid transmembrane transporter activity
1. PB	GO:0050860	negative regulation of T cell receptor signaling pathway
1. PB	GO:0001819	positive regulation of cytokine production
1. PB	GO:0030424	axon
1. PB	GO:1903670	regulation of sprouting angiogenesis
1. PB	GO:0030334	regulation of cell migration
1. PB	GO:0070372	regulation of ERK1 and ERK2 cascade
1. PB	GO:0005911	cell-cell junction
1. PB	GO:0031005	filamin binding
1. PB	GO:0019903	protein phosphatase binding
1. PB	GO:0033691	sialic acid binding
1. PB	GO:0090331	negative regulation of platelet aggregation
1. PB	GO:0009986	cell surface
1. PB	GO:0035577	azurophil granule membrane
1. PB	GO:0043116	negative regulation of vascular permeability
1. PB	GO:0009897	external side of plasma membrane
1. PB	GO:0005737	cytoplasm
1. PB	GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules
1. PB	GO:0043318	negative regulation of cytotoxic T cell degranulation
1. PB	GO:0070593	dendrite self-avoidance
1. PB	GO:0030054	cell junction
1. PB	GO:0016324	apical plasma membrane
1. PB	GO:0038158	granulocyte colony-stimulating factor signaling pathway
1. PB	GO:0070062	extracellular exosome
1. PB	GO:0015721	bile acid and bile salt transport
1. PB	GO:0031528	microvillus membrane
1. PB	GO:0007098	centrosome cycle
1. PB	GO:0030853	negative regulation of granulocyte differentiation
1. PB	GO:2001214	positive regulation of vasculogenesis
1. PB	GO:0005130	granulocyte colony-stimulating factor receptor binding
1. PB	GO:0070348	negative regulation of brown fat cell proliferation
1. PB	GO:0045671	negative regulation of osteoclast differentiation
1. PB	GO:0042130	negative regulation of T cell proliferation
1. PB	GO:0098742	cell-cell adhesion via plasma-membrane adhesion molecules
1. PB	GO:0016328	lateral plasma membrane
1. PB	GO:0042058	regulation of epidermal growth factor receptor signaling pathway
1. PB	GO:0005912	adherens junction
1. PB	GO:0045717	negative regulation of fatty acid biosynthetic process
1. PB	GO:0032426	stereocilium tip
1. PB	GO:0045601	regulation of endothelial cell differentiation
1. PB	GO:0035325	Toll-like receptor binding
1. PB	GO:1903385	regulation of homophilic cell adhesion
1. PB	GO:0009925	basal plasma membrane
1. PB	GO:0038016	insulin receptor internalization
1. PB	GO:0035726	common myeloid progenitor cell proliferation
1. PB	GO:0051055	negative regulation of lipid biosynthetic process
1. PB	GO:0032692	negative regulation of interleukin-1 production
1. PB	GO:0014066	regulation of phosphatidylinositol 3-kinase signaling
1. PB	GO:0002859	negative regulation of natural killer cell mediated cytotoxicity directed against tumor cell target
1. PB	GO:0002376	immune system process
1. PB	GO:0007155	cell adhesion
1. PB	GO:0001558	regulation of cell growth
1. PB	GO:0060312	regulation of blood vessel remodeling
1. PB	GO:0045216	cell-cell junction organization
1. PB	GO:0001568	blood vessel development
1. PB	GO:0042803	protein homodimerization activity
1. PB	GO:2000346	negative regulation of hepatocyte proliferation
1. PB	GO:0030246	carbohydrate binding
1. PB	GO:0035579	specific granule membrane
1. PB	GO:0031225	anchored component of membrane
1. PB	GO:0034116	positive regulation of heterotypic cell-cell adhesion
1. PB	GO:0042113	B cell activation
1. PB	GO:0001915	negative regulation of T cell mediated cytotoxicity
1. PB	GO:0019900	kinase binding
1. PB	GO:0010594	regulation of endothelial cell migration
1. PB	GO:0001818	negative regulation of cytokine production
1. PB	GO:1901143	insulin catabolic process
1. PB	GO:0098632	cell-cell adhesion mediator activity
1. PB	GO:0006469	negative regulation of protein kinase activity
1. PB	GO:0045779	negative regulation of bone resorption
1. PB	GO:0042802	identical protein binding
1. PB	GO:0070821	tertiary granule membrane
2. P	GO:0046007	negative regulation of activated T cell proliferation
2. P	GO:0033010	paranodal junction
2. P	GO:0019226	transmission of nerve impulse
2. P	GO:0001779	natural killer cell differentiation
2. P	GO:0032701	negative regulation of interleukin-18 production
2. P	GO:0060369	positive regulation of Fc receptor mediated stimulatory signaling pathway
2. P	GO:2000676	positive regulation of type B pancreatic cell apoptotic process
2. P	GO:0001773	myeloid dendritic cell activation
2. P	GO:0045121	membrane raft
2. P	GO:0030010	establishment of cell polarity
2. P	GO:0086016	AV node cell action potential
2. P	GO:0005244	voltage-gated ion channel activity
2. P	GO:0002250	adaptive immune response
2. P	GO:0031338	regulation of vesicle fusion
2. P	GO:0032743	positive regulation of interleukin-2 production
2. P	GO:0003823	antigen binding
2. P	GO:0023035	CD40 signaling pathway
2. P	GO:1903556	negative regulation of tumor necrosis factor superfamily cytokine production
2. P	GO:0002517	T cell tolerance induction
2. P	GO:0060307	regulation of ventricular cardiac muscle cell membrane repolarization
2. P	GO:0035879	plasma membrane lactate transport
2. P	GO:0038064	collagen receptor activity
2. P	GO:0001812	positive regulation of type I hypersensitivity
2. P	GO:0019863	IgE binding
2. P	GO:0046684	response to pyrethroid
2. P	GO:0140081	glycosylated region protein binding
2. P	GO:0099054	presynapse assembly
2. P	GO:1902961	positive regulation of aspartic-type endopeptidase activity involved in amyloid precursor protein catabolic process
2. P	GO:0042127	regulation of cell population proliferation
2. P	GO:2000660	negative regulation of interleukin-1-mediated signaling pathway
2. P	GO:0030018	Z disc
2. P	GO:0050732	negative regulation of peptidyl-tyrosine phosphorylation
2. P	GO:0042110	T cell activation
2. P	GO:0045176	apical protein localization
2. P	GO:0032693	negative regulation of interleukin-10 production
2. P	GO:0099061	integral component of postsynaptic density membrane
2. P	GO:0007267	cell-cell signaling
2. P	GO:0045576	mast cell activation
2. P	GO:1902683	regulation of receptor localization to synapse
2. P	GO:0035160	maintenance of epithelial integrity, open tracheal system
2. P	GO:0072672	neutrophil extravasation
2. P	GO:0010460	positive regulation of heart rate
2. P	GO:0032753	positive regulation of interleukin-4 production
2. P	GO:0010765	positive regulation of sodium ion transport
2. P	GO:0002819	regulation of adaptive immune response
2. P	GO:0033629	negative regulation of cell adhesion mediated by integrin
2. P	GO:0005272	sodium channel activity
2. P	GO:0001618	virus receptor activity
2. P	GO:0032690	negative regulation of interleukin-1 alpha production
2. P	GO:0060048	cardiac muscle contraction
2. P	GO:0050777	negative regulation of immune response
2. P	GO:0001798	positive regulation of type IIa hypersensitivity
2. P	GO:2001204	regulation of osteoclast development
2. P	GO:0008542	visual learning
2. P	GO:0072659	protein localization to plasma membrane
2. P	GO:0086015	SA node cell action potential
2. P	GO:0007202	activation of phospholipase C activity
2. P	GO:0035725	sodium ion transmembrane transport
2. P	GO:0005886	plasma membrane
2. P	GO:1905404	positive regulation of activated CD8-positive, alpha-beta T cell apoptotic process
2. P	GO:0042104	positive regulation of activated T cell proliferation
2. P	GO:0035151	regulation of tube size, open tracheal system
2. P	GO:0006911	phagocytosis, engulfment
2. P	GO:0034987	immunoglobulin receptor binding
2. P	GO:0007520	myoblast fusion
2. P	GO:2001186	negative regulation of CD8-positive, alpha-beta T cell activation
2. P	GO:0019966	interleukin-1 binding
2. P	GO:0030889	negative regulation of B cell proliferation
2. P	GO:0050930	induction of positive chemotaxis
2. P	GO:2000439	positive regulation of monocyte extravasation
2. P	GO:2000556	positive regulation of T-helper 1 cell cytokine production
2. P	GO:0061343	cell adhesion involved in heart morphogenesis
2. P	GO:0042271	susceptibility to natural killer cell mediated cytotoxicity
2. P	GO:0001540	amyloid-beta binding
2. P	GO:0040011	locomotion
2. P	GO:0005055	laminin receptor activity
2. P	GO:1905449	regulation of Fc-gamma receptor signaling pathway involved in phagocytosis
2. P	GO:0060077	inhibitory synapse
2. P	GO:0010596	negative regulation of endothelial cell migration
2. P	GO:0014911	positive regulation of smooth muscle cell migration
2. P	GO:0042734	presynaptic membrane
2. P	GO:0007259	receptor signaling pathway via JAK-STAT
2. P	GO:1900271	regulation of long-term synaptic potentiation
2. P	GO:0008045	motor neuron axon guidance
2. P	GO:0150104	transport across blood-brain barrier
2. P	GO:0060291	long-term synaptic potentiation
2. P	GO:0019772	low-affinity IgG receptor activity
2. P	GO:0099560	synaptic membrane adhesion
2. P	GO:0007160	cell-matrix adhesion
2. P	GO:0050870	positive regulation of T cell activation
2. P	GO:1900273	positive regulation of long-term synaptic potentiation
2. P	GO:0098743	cell aggregation
2. P	GO:0004908	interleukin-1 receptor activity
2. P	GO:0014002	astrocyte development
2. P	GO:0150072	positive regulation of arginase activity
2. P	GO:0034706	sodium channel complex
2. P	GO:0098688	parallel fiber to Purkinje cell synapse
2. P	GO:0031226	intrinsic component of plasma membrane
2. P	GO:0072657	protein localization to membrane
2. P	GO:0005887	integral component of plasma membrane
2. P	GO:0043209	myelin sheath
2. P	GO:0010763	positive regulation of fibroblast migration
2. P	GO:0070160	tight junction
2. P	GO:0033624	negative regulation of integrin activation
2. P	GO:0045123	cellular extravasation
2. P	GO:0002765	immune response-inhibiting signal transduction
2. P	GO:0005178	integrin binding
2. P	GO:0050892	intestinal absorption
2. P	GO:0032735	positive regulation of interleukin-12 production
2. P	GO:0070374	positive regulation of ERK1 and ERK2 cascade
2. P	GO:0044325	transmembrane transporter binding
2. P	GO:2000145	regulation of cell motility
2. P	GO:0098942	retrograde trans-synaptic signaling by trans-synaptic protein complex
2. P	GO:0030425	dendrite
2. P	GO:1901216	positive regulation of neuron death
2. P	GO:0005248	voltage-gated sodium channel activity
2. P	GO:2000403	positive regulation of lymphocyte migration
2. P	GO:0002845	positive regulation of tolerance induction to tumor cell
2. P	GO:0007166	cell surface receptor signaling pathway
2. P	GO:0071639	positive regulation of monocyte chemotactic protein-1 production
2. P	GO:0090264	regulation of immune complex clearance by monocytes and macrophages
2. P	GO:2001256	regulation of store-operated calcium entry
2. P	GO:0098685	Schaffer collateral - CA1 synapse
2. P	GO:0044291	cell-cell contact zone
2. P	GO:2000509	negative regulation of dendritic cell chemotaxis
2. P	GO:0034113	heterotypic cell-cell adhesion
2. P	GO:1900272	negative regulation of long-term synaptic potentiation
2. P	GO:0150102	negative regulation of monocyte activation
2. P	GO:0050868	negative regulation of T cell activation
2. P	GO:0032731	positive regulation of interleukin-1 beta production
2. P	GO:0010759	positive regulation of macrophage chemotaxis
2. P	GO:0050901	leukocyte tethering or rolling
2. P	GO:0030971	receptor tyrosine kinase binding
2. P	GO:0086014	atrial cardiac muscle cell action potential
2. P	GO:0032689	negative regulation of interferon-gamma production
2. P	GO:0032695	negative regulation of interleukin-12 production
2. P	GO:0050862	positive regulation of T cell receptor signaling pathway
2. P	GO:0042102	positive regulation of T cell proliferation
2. P	GO:0090022	regulation of neutrophil chemotaxis
2. P	GO:0043220	Schmidt-Lanterman incisure
2. P	GO:0001811	negative regulation of type I hypersensitivity
2. P	GO:0050839	cell adhesion molecule binding
2. P	GO:0090557	establishment of endothelial intestinal barrier
2. P	GO:0086012	membrane depolarization during cardiac muscle cell action potential
2. P	GO:2000349	negative regulation of CD40 signaling pathway
2. P	GO:0001805	positive regulation of type III hypersensitivity
2. P	GO:0070379	high mobility group box 1 binding
2. P	GO:0019763	immunoglobulin receptor activity
2. P	GO:0002725	negative regulation of T cell cytokine production
2. P	GO:0007162	negative regulation of cell adhesion
2. P	GO:0005923	bicellular tight junction
2. P	GO:0086062	voltage-gated sodium channel activity involved in Purkinje myocyte action potential
2. P	GO:0032740	positive regulation of interleukin-17 production
2. P	GO:0051493	regulation of cytoskeleton organization
2. P	GO:0021966	corticospinal neuron axon guidance
2. P	GO:0090138	regulation of actin cytoskeleton organization by cell-cell adhesion
2. P	GO:0098609	cell-cell adhesion
2. P	GO:0086010	membrane depolarization during action potential
2. P	GO:0043507	positive regulation of JUN kinase activity
2. P	GO:0071663	positive regulation of granzyme B production
2. P	GO:0042552	myelination
2. P	GO:0033004	negative regulation of mast cell activation
2. P	GO:0002693	positive regulation of cellular extravasation
2. P	GO:0019227	neuronal action potential propagation
2. P	GO:1903829	positive regulation of protein localization
2. P	GO:0045334	clathrin-coated endocytic vesicle
2. P	GO:0050727	regulation of inflammatory response
2. P	GO:0002429	immune response-activating cell surface receptor signaling pathway
2. P	GO:0050790	regulation of catalytic activity
2. P	GO:0042590	antigen processing and presentation of exogenous peptide antigen via MHC class I
2. P	GO:1900747	negative regulation of vascular endothelial growth factor signaling pathway
2. P	GO:0042267	natural killer cell mediated cytotoxicity
2. P	GO:0010976	positive regulation of neuron projection development
2. P	GO:0031941	filamentous actin
2. P	GO:0019884	antigen processing and presentation of exogenous antigen
2. P	GO:0005902	microvillus
2. P	GO:0045217	cell-cell junction maintenance
2. P	GO:0030110	HLA-C specific inhibitory MHC class I receptor activity
2. P	GO:0036477	somatodendritic compartment
2. P	GO:0032966	negative regulation of collagen biosynthetic process
2. P	GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II
2. P	GO:0034333	adherens junction assembly
2. P	GO:0031290	retinal ganglion cell axon guidance
2. P	GO:0001934	positive regulation of protein phosphorylation
2. P	GO:0086091	regulation of heart rate by cardiac conduction
2. P	GO:0071593	lymphocyte aggregation
2. P	GO:0032720	negative regulation of tumor necrosis factor production
2. P	GO:0032755	positive regulation of interleukin-6 production
2. P	GO:0001774	microglial cell activation
2. P	GO:0042129	regulation of T cell proliferation
2. P	GO:0002605	negative regulation of dendritic cell antigen processing and presentation
2. P	GO:0031642	negative regulation of myelination
2. P	GO:0035020	regulation of Rac protein signal transduction
2. P	GO:0098880	maintenance of postsynaptic specialization structure
2. P	GO:0030315	T-tubule
2. P	GO:1901215	negative regulation of neuron death
2. P	GO:1905522	negative regulation of macrophage migration
2. P	GO:0002266	follicular dendritic cell activation
2. P	GO:0002503	peptide antigen assembly with MHC class II protein complex
2. P	GO:2000510	positive regulation of dendritic cell chemotaxis
2. P	GO:0002028	regulation of sodium ion transport
2. P	GO:0032733	positive regulation of interleukin-10 production
2. P	GO:0035683	memory T cell extravasation
2. P	GO:1900744	regulation of p38MAPK cascade
2. P	GO:0150079	negative regulation of neuroinflammatory response
2. P	GO:1901731	positive regulation of platelet aggregation
2. P	GO:0005540	hyaluronic acid binding
2. P	GO:0032729	positive regulation of interferon-gamma production
2. P	GO:1904645	response to amyloid-beta
2. P	GO:1902414	protein localization to cell junction
2. P	GO:1900016	negative regulation of cytokine production involved in inflammatory response
2. P	GO:0032685	negative regulation of granulocyte macrophage colony-stimulating factor production
2. P	GO:1904861	excitatory synapse assembly
2. P	GO:1903615	positive regulation of protein tyrosine phosphatase activity
2. P	GO:0098636	protein complex involved in cell adhesion
2. P	GO:0035633	maintenance of blood-brain barrier
2. P	GO:1902564	negative regulation of neutrophil activation
2. P	GO:0086002	cardiac muscle cell action potential involved in contraction
2. P	GO:2000249	regulation of actin cytoskeleton reorganization
2. P	GO:0004910	interleukin-1, type II, blocking receptor activity
2. P	GO:0060371	regulation of atrial cardiac muscle cell membrane depolarization
2. P	GO:0002891	positive regulation of immunoglobulin mediated immune response
2. P	GO:0051101	regulation of DNA binding
2. P	GO:0007165	signal transduction
2. P	GO:0010255	glucose mediated signaling pathway
2. P	GO:0048846	axon extension involved in axon guidance
2. P	GO:0031774	leukotriene receptor binding
2. P	GO:0043305	negative regulation of mast cell degranulation
2. P	GO:0033005	positive regulation of mast cell activation
2. P	GO:1904646	cellular response to amyloid-beta
2. P	GO:0002668	negative regulation of T cell anergy
2. P	GO:1900453	negative regulation of long-term synaptic depression
2. P	GO:0050766	positive regulation of phagocytosis
2. P	GO:0045590	negative regulation of regulatory T cell differentiation
2. P	GO:0086047	membrane depolarization during Purkinje myocyte cell action potential
2. P	GO:0032761	positive regulation of lymphotoxin A production
2. P	GO:0008037	cell recognition
2. P	GO:0005105	type 1 fibroblast growth factor receptor binding
2. P	GO:0045066	regulatory T cell differentiation
2. P	GO:0016323	basolateral plasma membrane
2. P	GO:0048170	positive regulation of long-term neuronal synaptic plasticity
2. P	GO:0043031	negative regulation of macrophage activation
2. P	GO:0014704	intercalated disc
2. P	GO:0002316	follicular B cell differentiation
2. P	GO:0090559	regulation of membrane permeability
2. P	GO:0006955	immune response
2. P	GO:0006910	phagocytosis, recognition
2. P	GO:0033860	regulation of NAD(P)H oxidase activity
2. P	GO:0002313	mature B cell differentiation involved in immune response
2. P	GO:0030593	neutrophil chemotaxis
2. P	GO:0099059	integral component of presynaptic active zone membrane
2. P	GO:2000405	negative regulation of T cell migration
2. P	GO:0030057	desmosome
2. P	GO:0060101	negative regulation of phagocytosis, engulfment
2. P	GO:0002418	immune response to tumor cell
2. P	GO:0002270	plasmacytoid dendritic cell activation
2. P	GO:2000562	negative regulation of CD4-positive, alpha-beta T cell proliferation
2. P	GO:0038023	signaling receptor activity
2. P	GO:0051606	detection of stimulus
2. P	GO:0045777	positive regulation of blood pressure
2. P	GO:0031252	cell leading edge
2. P	GO:0097021	lymphocyte migration into lymphoid organs
2. P	GO:0002436	immune complex clearance by monocytes and macrophages
2. P	GO:0033595	response to genistein
2. P	GO:0030165	PDZ domain binding
2. P	GO:0001814	negative regulation of antibody-dependent cellular cytotoxicity
2. P	GO:0070945	neutrophil-mediated killing of gram-negative bacterium
2. P	GO:0045087	innate immune response
2. P	GO:0019864	IgG binding
2. P	GO:1905710	positive regulation of membrane permeability
2. P	GO:0001780	neutrophil homeostasis
2. P	GO:0042289	MHC class II protein binding
2. P	GO:0010955	negative regulation of protein processing
2. P	GO:0030948	negative regulation of vascular endothelial growth factor receptor signaling pathway
2. P	GO:1902623	negative regulation of neutrophil migration
2. P	GO:2000558	positive regulation of immunoglobulin production in mucosal tissue
2. P	GO:0061041	regulation of wound healing
2. P	GO:0032722	positive regulation of chemokine production
2. P	GO:0071222	cellular response to lipopolysaccharide
2. P	GO:0001518	voltage-gated sodium channel complex
2. P	GO:0086006	voltage-gated sodium channel activity involved in cardiac muscle cell action potential
2. P	GO:0051497	negative regulation of stress fiber assembly
2. P	GO:0007411	axon guidance
2. P	GO:0002860	positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target
2. P	GO:0045056	transcytosis
2. P	GO:0032760	positive regulation of tumor necrosis factor production
2. P	GO:0150003	regulation of spontaneous synaptic transmission
2. P	GO:1990138	neuron projection extension
2. P	GO:0051899	membrane depolarization
2. P	GO:0046641	positive regulation of alpha-beta T cell proliferation
2. P	GO:0097530	granulocyte migration
2. P	GO:0002769	natural killer cell inhibitory signaling pathway
2. P	GO:0019871	sodium channel inhibitor activity
2. P	GO:0031295	T cell costimulation
2. P	GO:0043236	laminin binding
2. P	GO:0005102	signaling receptor binding
2. P	GO:1903523	negative regulation of blood circulation
2. P	GO:0072714	response to selenite ion
2. P	GO:1902396	protein localization to bicellular tight junction
2. P	GO:0019233	sensory perception of pain
2. P	GO:0046330	positive regulation of JNK cascade
2. P	GO:0097241	hematopoietic stem cell migration to bone marrow
2. P	GO:1905150	regulation of voltage-gated sodium channel activity
2. P	GO:1990051	activation of protein kinase C activity
2. P	GO:2000649	regulation of sodium ion transmembrane transporter activity
2. P	GO:0033268	node of Ranvier
2. P	GO:2001199	negative regulation of dendritic cell differentiation
2. P	GO:0019767	IgE receptor activity
2. P	GO:1900745	positive regulation of p38MAPK cascade
2. P	GO:0002729	positive regulation of natural killer cell cytokine production
2. P	GO:0007611	learning or memory
2. P	GO:0045743	positive regulation of fibroblast growth factor receptor signaling pathway
2. P	GO:0032715	negative regulation of interleukin-6 production
2. P	GO:0050852	T cell receptor signaling pathway
2. P	GO:0150077	regulation of neuroinflammatory response
2. P	GO:0031103	axon regeneration
2. P	GO:0001914	regulation of T cell mediated cytotoxicity
2. P	GO:0086005	ventricular cardiac muscle cell action potential
2. P	GO:0001787	natural killer cell proliferation
2. P	GO:0034394	protein localization to cell surface
2. P	GO:0050853	B cell receptor signaling pathway
2. P	GO:0086080	protein binding involved in heterotypic cell-cell adhesion
2. P	GO:0150074	positive regulation of protein-glutamine gamma-glutamyltransferase activity
2. P	GO:2000566	positive regulation of CD8-positive, alpha-beta T cell proliferation
2. P	GO:0099056	integral component of presynaptic membrane
2. P	GO:0002318	myeloid progenitor cell differentiation
2. P	GO:0043204	perikaryon
2. P	GO:0001817	regulation of cytokine production
2. P	GO:0001772	immunological synapse
2. P	GO:2001200	positive regulation of dendritic cell differentiation
2. P	GO:0050776	regulation of immune response
2. P	GO:0002523	leukocyte migration involved in inflammatory response
2. P	GO:0006909	phagocytosis
2. P	GO:2000353	positive regulation of endothelial cell apoptotic process
2. P	GO:0016338	calcium-independent cell-cell adhesion via plasma membrane cell-adhesion molecules
2. P	GO:0019770	IgG receptor activity
2. P	GO:0032703	negative regulation of interleukin-2 production
2. P	GO:0015026	coreceptor activity
2. P	GO:1905898	positive regulation of response to endoplasmic reticulum stress
2. P	GO:0002232	leukocyte chemotaxis involved in inflammatory response
2. P	GO:0001788	antibody-dependent cellular cytotoxicity
2. P	GO:0002485	antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-dependent
2. P	GO:1901018	positive regulation of potassium ion transmembrane transporter activity
2. P	GO:0044548	S100 protein binding
2. P	GO:0007159	leukocyte cell-cell adhesion
2. P	GO:1903142	positive regulation of establishment of endothelial barrier
2. P	GO:0050785	advanced glycation end-product receptor activity
2. P	GO:0002639	positive regulation of immunoglobulin production
2. P	GO:0002924	negative regulation of humoral immune response mediated by circulating immunoglobulin
2. P	GO:0002336	B-1 B cell lineage commitment
2. P	GO:0045954	positive regulation of natural killer cell mediated cytotoxicity
2. P	GO:0002622	regulation of B cell antigen processing and presentation
2. P	GO:0098982	GABA-ergic synapse
2. P	GO:0001932	regulation of protein phosphorylation
2. P	GO:0007286	spermatid development
2. P	GO:0016021	integral component of membrane
2. P	GO:1904472	positive regulation of endothelin production
2. P	GO:2000514	regulation of CD4-positive, alpha-beta T cell activation
2. P	GO:0043184	vascular endothelial growth factor receptor 2 binding
2. P	GO:1904465	negative regulation of matrix metallopeptidase secretion
2. P	GO:0036057	slit diaphragm
2. P	GO:0030101	natural killer cell activation
2. P	GO:0043183	vascular endothelial growth factor receptor 1 binding
2. P	GO:0090647	modulation of age-related behavioral decline
2. P	GO:2000810	regulation of bicellular tight junction assembly
2. P	GO:0005829	cytosol
2. P	GO:0010801	negative regulation of peptidyl-threonine phosphorylation
2. P	GO:0034260	negative regulation of GTPase activity
2. P	GO:0061337	cardiac conduction
2. P	GO:0001933	negative regulation of protein phosphorylation
2. P	GO:0004888	transmembrane signaling receptor activity
2. P	GO:0048143	astrocyte activation
2. P	GO:0002277	myeloid dendritic cell activation involved in immune response
2. P	GO:0001820	serotonin secretion
2. P	GO:0099557	trans-synaptic signaling by trans-synaptic complex, modulating synaptic transmission
2. P	GO:0072540	T-helper 17 cell lineage commitment
2. P	GO:0046658	anchored component of plasma membrane
2. P	GO:0042169	SH2 domain binding
2. P	GO:0060370	susceptibility to T cell mediated cytotoxicity
2. P	GO:0017080	sodium channel regulator activity
2. P	GO:0060100	positive regulation of phagocytosis, engulfment
2. P	GO:0060373	regulation of ventricular cardiac muscle cell membrane depolarization
2. P	GO:1901224	positive regulation of NIK/NF-kappaB signaling
2. P	GO:0001813	regulation of antibody-dependent cellular cytotoxicity
3. B	GO:0030198	extracellular matrix organization
3. B	GO:0005509	calcium ion binding
3. B	GO:0034613	cellular protein localization
3. B	GO:0060351	cartilage development involved in endochondral bone morphogenesis
3. B	GO:0072359	circulatory system development
3. B	GO:0009617	response to bacterium
3. B	GO:0060170	ciliary membrane
3. B	GO:0098797	plasma membrane protein complex
3. B	GO:0007420	brain development
3. B	GO:0060548	negative regulation of cell death
3. B	GO:2000252	negative regulation of feeding behavior
3. B	GO:0009888	tissue development
3. B	GO:0001525	angiogenesis
3. B	GO:0071636	positive regulation of transforming growth factor beta production
3. B	GO:0050849	negative regulation of calcium-mediated signaling
3. B	GO:0005604	basement membrane
3. B	GO:0019901	protein kinase binding
3. B	GO:0005796	Golgi lumen
3. B	GO:1905907	negative regulation of amyloid fibril formation
3. B	GO:0005819	spindle
3. B	GO:0010832	negative regulation of myotube differentiation
3. B	GO:0034109	homotypic cell-cell adhesion
3. B	GO:0008022	protein C-terminus binding
3. B	GO:0055037	recycling endosome
3. B	GO:0050859	negative regulation of B cell receptor signaling pathway
3. B	GO:0072686	mitotic spindle
3. B	GO:0040008	regulation of growth
3. B	GO:0002638	negative regulation of immunoglobulin production
3. B	GO:0006898	receptor-mediated endocytosis
3. B	GO:0007605	sensory perception of sound
3. B	GO:0030888	regulation of B cell proliferation
3. B	GO:0005813	centrosome
3. B	GO:2000811	negative regulation of anoikis
3. B	GO:0030021	extracellular matrix structural constituent conferring compression resistance
3. B	GO:0048738	cardiac muscle tissue development
3. B	GO:0030496	midbody
3. B	GO:0005576	extracellular region
3. B	GO:1904906	positive regulation of endothelial cell-matrix adhesion via fibronectin
3. B	GO:0031012	extracellular matrix
3. B	GO:0043406	positive regulation of MAP kinase activity
3. B	GO:0003779	actin binding
3. B	GO:0030133	transport vesicle
3. B	GO:0062023	collagen-containing extracellular matrix
3. B	GO:0034235	GPI anchor binding
3. B	GO:0032869	cellular response to insulin stimulus
3. B	GO:0005615	extracellular space
3. B	GO:0042609	CD4 receptor binding
3. B	GO:0005516	calmodulin binding
3. B	GO:0001791	IgM binding
3. B	GO:0032154	cleavage furrow
3. B	GO:0071575	integral component of external side of plasma membrane
3. B	GO:0009887	animal organ morphogenesis
3. B	GO:0045545	syndecan binding

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	P11464	Pregnancy-specific beta-1-glycoprotein 1	1.76e-07	4.38e-06	1.93e-08
1. PB	Q925P2	Carcinoembryonic antigen-related cell adhesion molecule 2	1.72e-10	2.27e-13	1.70e-20
1. PB	Q9D871	Carcinoembryonic antigen-related cell adhesion molecule 18	4.82e-13	3.34e-26	6.21e-144
1. PB	Q16557	Pregnancy-specific beta-1-glycoprotein 3	6.14e-07	1.68e-10	7.69e-08
1. PB	P11465	Pregnancy-specific beta-1-glycoprotein 2	1.08e-14	3.71e-07	3.67e-14
1. PB	P40199	Carcinoembryonic antigen-related cell adhesion molecule 6	9.99e-08	2.36e-04	7.49e-28
1. PB	A6QQC6	HEPACAM family member 2	4.18e-06	6.80e-03	4.07e-05
1. PB	D3ZQE1	Carcinoembryonic antigen-related cell adhesion molecule 16	4.11e-12	1.97e-02	4.08e-22
1. PB	A8MVW5	HEPACAM family member 2	4.90e-07	2.33e-05	0.002
1. PB	E9QA28	Carcinoembryonic antigen-related cell adhesion molecule 16	1.02e-11	4.05e-04	1.45e-20
1. PB	Q6UY09	Carcinoembryonic antigen-related cell adhesion molecule 20	1.98e-05	2.91e-02	5.96e-13
1. PB	Q9UQ74	Pregnancy-specific beta-1-glycoprotein 8	2.07e-08	1.32e-09	4.48e-09
1. PB	Q4VAH7	HEPACAM family member 2	3.65e-08	1.60e-05	2.89e-05
1. PB	P16573	Carcinoembryonic antigen-related cell adhesion molecule 1	2.72e-08	6.29e-10	1.59e-17
1. PB	Q9D2Z1	Carcinoembryonic antigen-related cell adhesion molecule 20	1.18e-04	2.60e-02	5.04e-13
1. PB	Q14002	Carcinoembryonic antigen-related cell adhesion molecule 7	5.05e-06	2.78e-03	1.08e-15
1. PB	P31809	Carcinoembryonic antigen-related cell adhesion molecule 1	8.59e-10	4.14e-11	3.03e-15
1. PB	Q13046	Putative pregnancy-specific beta-1-glycoprotein 7	5.01e-08	1.34e-09	2.31e-06
1. PB	Q00887	Pregnancy-specific beta-1-glycoprotein 9	3.60e-09	1.16e-11	1.34e-06
1. PB	Q00888	Pregnancy-specific beta-1-glycoprotein 4	1.68e-08	6.60e-08	6.77e-09
1. PB	Q15238	Pregnancy-specific beta-1-glycoprotein 5	3.27e-13	1.77e-06	2.54e-18
1. PB	Q00889	Pregnancy-specific beta-1-glycoprotein 6	2.12e-07	4.98e-13	2.96e-10
1. PB	P31997	Carcinoembryonic antigen-related cell adhesion molecule 8	4.48e-10	7.30e-06	8.37e-27
1. PB	A8MTB9	Carcinoembryonic antigen-related cell adhesion molecule 18	0	1.20e-134	0.0
1. PB	P13688	Carcinoembryonic antigen-related cell adhesion molecule 1	1.04e-06	1.80e-09	5.18e-25
1. PB	Q9UQ72	Pregnancy-specific beta-1-glycoprotein 11	8.97e-10	2.66e-05	3.73e-15
1. PB	Q3KPI0	Carcinoembryonic antigen-related cell adhesion molecule 21	4.13e-06	7.51e-10	2.36e-13
2. P	Q96NY8	Nectin-4	8.05e-08	3.49e-03	NA
2. P	Q9MYX7	Cytotoxic T-lymphocyte protein 4	3.61e-02	3.69e-04	NA
2. P	P43626	Killer cell immunoglobulin-like receptor 2DL1	6.98e-03	3.57e-02	NA
2. P	Q7ZXX1	Cell adhesion molecule 3	5.01e-05	3.27e-06	NA
2. P	O46631	Tyrosine-protein phosphatase non-receptor type substrate 1	1.35e-03	2.28e-02	NA
2. P	P27930	Interleukin-1 receptor type 2	1.20e-05	5.96e-04	NA
2. P	A5A6L6	Sodium channel subunit beta-1	9.42e-03	9.00e-03	NA
2. P	A7XUX6	Selection and upkeep of intraepithelial T-cells protein 2	2.09e-02	2.97e-02	NA
2. P	P50895	Basal cell adhesion molecule	2.51e-04	4.14e-07	NA
2. P	Q92637	High affinity immunoglobulin gamma Fc receptor IB	1.57e-03	2.73e-02	NA
2. P	G5EGI7	Zwei Ig domain protein zig-1	6.90e-03	1.19e-03	NA
2. P	P35737	Class II histocompatibility antigen, M beta 1 chain	1.45e-01	4.75e-02	NA
2. P	Q9ESS6	Basal cell adhesion molecule	1.65e-04	1.67e-02	NA
2. P	Q9BH13	CD166 antigen	4.42e-05	2.75e-02	NA
2. P	Q90Y50	Coxsackievirus and adenovirus receptor homolog	5.69e-03	2.99e-02	NA
2. P	Q9NZQ7	Programmed cell death 1 ligand 1	6.80e-03	4.89e-04	NA
2. P	P01902	H-2 class I histocompatibility antigen, K-D alpha chain	1.28e-01	1.97e-02	NA
2. P	Q14953	Killer cell immunoglobulin-like receptor 2DS5	2.37e-03	3.81e-02	NA
2. P	P42071	T-lymphocyte activation antigen CD86	1.96e-03	1.68e-05	NA
2. P	Q9R069	Basal cell adhesion molecule	2.68e-04	5.16e-04	NA
2. P	Q28125	Intercellular adhesion molecule 3	1.08e-02	1.03e-02	NA
2. P	Q9JK00	Sodium channel subunit beta-3	1.60e-03	4.51e-03	NA
2. P	Q86UW8	Hyaluronan and proteoglycan link protein 4	7.73e-02	2.51e-02	NA
2. P	O43699	Sialic acid-binding Ig-like lectin 6	8.61e-06	2.92e-03	NA
2. P	Q61490	CD166 antigen	7.21e-05	8.83e-03	NA
2. P	Q1WIM3	Cell adhesion molecule 3	9.88e-06	4.06e-09	NA
2. P	Q5NKV6	Intercellular adhesion molecule 1	3.92e-03	4.88e-02	NA
2. P	Q8R007	Nectin-4	1.91e-06	3.19e-03	NA
2. P	Q63495	Advanced glycosylation end product-specific receptor	4.18e-06	1.17e-06	NA
2. P	P54900	Sodium channel subunit beta-2	1.05e-02	3.81e-02	NA
2. P	Q9Y336	Sialic acid-binding Ig-like lectin 9	1.54e-06	2.42e-02	NA
2. P	Q9BY67	Cell adhesion molecule 1	5.26e-05	7.21e-05	NA
2. P	P97952	Sodium channel subunit beta-1	9.49e-03	1.08e-02	NA
2. P	P10522	Myelin protein P0	6.88e-03	5.70e-03	NA
2. P	Q1WIM1	Cell adhesion molecule 4	1.12e-05	1.62e-09	NA
2. P	Q5NKU6	Intercellular adhesion molecule 3	2.95e-02	4.05e-03	NA
2. P	Q80WM4	Hyaluronan and proteoglycan link protein 4	2.80e-02	1.49e-03	NA
2. P	Q9D7L8	Transmembrane and immunoglobulin domain-containing protein 1	7.12e-06	1.40e-05	NA
2. P	P23735	Ig mu chain C region membrane-bound form	7.08e-03	7.42e-03	NA
2. P	P0C788	OX-2 membrane glycoprotein homolog	NA	3.60e-05	NA
2. P	Q9NYZ4	Sialic acid-binding Ig-like lectin 8	2.36e-06	1.16e-02	NA
2. P	O35112	CD166 antigen	4.39e-05	2.00e-02	NA
2. P	P32506	Poliovirus receptor homolog	1.19e-04	5.16e-06	NA
2. P	Q9Y639	Neuroplastin	2.07e-04	5.49e-03	NA
2. P	A0A0B4J1G0	Low affinity immunoglobulin gamma Fc region receptor IV	2.71e-04	4.14e-02	NA
2. P	Q68FQ2	Junctional adhesion molecule C	1.31e-02	7.23e-07	NA
2. P	Q9XSI1	Cytotoxic T-lymphocyte protein 4	4.15e-02	6.22e-04	NA
2. P	Q9JHJ8	ICOS ligand	6.35e-03	4.07e-05	NA
2. P	P27931	Interleukin-1 receptor type 2	2.66e-05	2.89e-04	NA
2. P	Q28110	Low affinity immunoglobulin gamma Fc region receptor II	1.32e-03	1.61e-02	NA
2. P	P42070	T-lymphocyte activation antigen CD80	2.60e-03	1.53e-05	NA
2. P	Q18PI6	SLAM family member 5	9.57e-04	1.15e-04	NA
2. P	Q99795	Cell surface A33 antigen	1.95e-02	4.44e-05	NA
2. P	Q9QUM4	Signaling lymphocytic activation molecule	1.28e-03	5.89e-07	NA
2. P	P57087	Junctional adhesion molecule B	1.18e-02	1.66e-03	NA
2. P	Q91664	V-set and immunoglobulin domain-containing protein 1	1.53e-03	8.74e-03	NA
2. P	Q9NQ25	SLAM family member 7	1.08e-02	9.18e-03	NA
2. P	Q8MJ02	Natural cytotoxicity triggering receptor 3	5.31e-02	2.53e-02	NA
2. P	P78410	Butyrophilin subfamily 3 member A2	9.33e-03	7.47e-06	NA
2. P	D3YX43	V-set and immunoglobulin domain-containing protein 10	1.33e-03	6.93e-03	NA
2. P	Q96A28	SLAM family member 9	1.81e-05	3.11e-02	NA
2. P	P31042	T-cell-specific surface glycoprotein CD28	8.70e-02	6.67e-03	NA
2. P	Q8K4F0	CD226 antigen	1.25e-03	3.24e-06	NA
2. P	Q66KX2	Cell adhesion molecule 4	4.63e-05	1.21e-07	NA
2. P	P42072	Cytotoxic T-lymphocyte protein 4	2.88e-02	3.35e-03	NA
2. P	Q9JHY1	Junctional adhesion molecule A	4.64e-04	2.04e-04	NA
2. P	Q18806	Neuronal immunoglobulin domain-containing protein rig-3	2.23e-03	2.31e-02	NA
2. P	Q8TD46	Cell surface glycoprotein CD200 receptor 1	1.88e-03	9.90e-05	NA
2. P	Q9ES58	Cell surface glycoprotein CD200 receptor 1	1.19e-03	1.01e-05	NA
2. P	Q68EV1	CD276 antigen homolog	1.20e-02	1.09e-05	NA
2. P	Q91Y57	Sialic acid-binding Ig-like lectin 12	3.94e-06	7.21e-05	NA
2. P	Q9NY72	Sodium channel subunit beta-3	1.61e-03	1.90e-03	NA
2. P	Q8N743	Killer cell immunoglobulin-like receptor 3DL3	2.00e-04	3.67e-02	NA
2. P	Q61790	Lymphocyte activation gene 3 protein	1.10e-04	1.37e-04	NA
2. P	P12319	High affinity immunoglobulin epsilon receptor subunit alpha	1.14e-03	1.28e-03	NA
2. P	Q6XJV6	Cell surface glycoprotein CD200 receptor 2	1.25e-02	1.57e-05	NA
2. P	Q15762	CD226 antigen	2.69e-03	3.42e-04	NA
2. P	Q8HXJ7	Sodium channel subunit beta-3	1.08e-03	1.41e-03	NA
2. P	A5D7C3	Myelin protein zero-like protein 3	6.58e-03	2.12e-02	NA
2. P	Q00954	Sodium channel subunit beta-1	9.28e-03	1.16e-02	NA
2. P	P08920	T-cell surface antigen CD2	1.02e-02	2.80e-03	NA
2. P	Q96PQ1	Sialic acid-binding Ig-like lectin 12	1.65e-04	2.37e-02	NA
2. P	P42292	CD166 antigen	9.46e-04	2.66e-05	NA
2. P	Q3T113	Transmembrane and immunoglobulin domain-containing protein 1	1.82e-04	1.91e-07	NA
2. P	A0A0E4BZH1	Selection and upkeep of intraepithelial T-cells protein 1	1.38e-02	1.53e-03	NA
2. P	Q95MM9	Signaling lymphocytic activation molecule	3.24e-03	1.24e-06	NA
2. P	P20138	Myeloid cell surface antigen CD33	1.61e-02	9.00e-03	NA
2. P	Q7YR73	Inducible T-cell costimulator	2.42e-01	6.29e-03	NA
2. P	Q5E9Z9	Nectin-4	1.21e-07	2.88e-02	NA
2. P	Q64JA4	Sialic acid-binding Ig-like lectin 13	2.55e-07	3.66e-07	NA
2. P	O95297	Myelin protein zero-like protein 1	7.61e-02	4.33e-03	NA
2. P	Q96DU3	SLAM family member 6	4.36e-03	3.60e-06	NA
2. P	Q6UXZ0	Transmembrane and immunoglobulin domain-containing protein 1	4.92e-05	3.02e-06	NA
2. P	Q13291	Signaling lymphocytic activation molecule	7.39e-04	1.08e-05	NA
2. P	O14931	Natural cytotoxicity triggering receptor 3	1.94e-02	1.95e-02	NA
2. P	Q5TFQ8	Signal-regulatory protein beta-1 isoform 3	1.01e-04	9.91e-03	NA
2. P	A7XV04	Selection and upkeep of intraepithelial T-cells protein 7	1.19e-02	7.28e-03	NA
2. P	Q8BLK3	Limbic system-associated membrane protein	1.83e-07	1.64e-08	NA
2. P	Q95132	Intercellular adhesion molecule 1	1.71e-02	5.54e-03	NA
2. P	P61484	Natural cytotoxicity triggering receptor 3	4.87e-03	3.19e-02	NA
2. P	Q99N28	Cell adhesion molecule 3	1.62e-06	1.56e-09	NA
2. P	P11364	Viral T-cell receptor beta chain-like T17T-22	NA	4.09e-07	NA
2. P	P27645	Low affinity immunoglobulin gamma Fc region receptor III	3.56e-03	3.50e-04	NA
2. P	Q9Z109	V-set and immunoglobulin domain-containing protein 2	2.85e-03	8.09e-03	NA
2. P	P31994	Low affinity immunoglobulin gamma Fc region receptor II-b	3.40e-04	1.91e-02	NA
2. P	Q90773	Protein CEPU-1	5.99e-07	9.91e-03	NA
2. P	Q7TPB4	CD276 antigen	1.86e-03	4.68e-07	NA
2. P	O75144	ICOS ligand	3.18e-03	7.54e-05	NA
2. P	P43303	Interleukin-1 receptor type 2	1.82e-05	1.08e-02	NA
2. P	Q6GMZ9	V-set and immunoglobulin domain-containing protein 10	2.11e-03	7.26e-04	NA
2. P	A3KPA0	Junctional adhesion molecule 3B	1.74e-03	1.97e-02	NA
2. P	Q2KI11	Sodium channel subunit beta-3	1.40e-03	6.17e-03	NA
2. P	P04218	OX-2 membrane glycoprotein	4.64e-05	3.70e-02	NA
2. P	Q6WEB5	Myelin protein P0	8.83e-03	4.33e-03	NA
2. P	P53788	Sodium channel subunit beta-1	9.38e-03	4.84e-04	NA
2. P	O00241	Signal-regulatory protein beta-1	3.54e-04	7.73e-04	NA
2. P	Q8R5M8	Cell adhesion molecule 1	1.09e-04	1.50e-03	NA
2. P	Q9JKE2	Triggering receptor expressed on myeloid cells 1	1.64e-02	1.21e-02	NA
2. P	Q9XT56	Junctional adhesion molecule A	9.69e-04	9.11e-04	NA
2. P	Q8BHK6	SLAM family member 7	3.93e-03	1.03e-04	NA
2. P	Q9Y286	Sialic acid-binding Ig-like lectin 7	7.36e-06	2.86e-04	NA
2. P	Q08E08	Sodium channel subunit beta-4	2.22e-02	3.49e-03	NA
2. P	Q24372	Lachesin	3.74e-05	3.77e-06	NA
2. P	Q5BK54	Lymphocyte activation gene 3 protein	8.29e-05	3.59e-03	NA
2. P	Q9EP73	Programmed cell death 1 ligand 1	3.29e-03	6.50e-06	NA
2. P	P30816	Envelope glycoprotein E	NA	2.99e-02	NA
2. P	Q8BHK2	Sodium channel subunit beta-3	1.63e-03	1.48e-02	NA
2. P	Q15109	Advanced glycosylation end product-specific receptor	5.90e-05	1.61e-06	NA
2. P	P06907	Myelin protein P0	1.02e-02	1.60e-02	NA
2. P	Q96IQ7	V-set and immunoglobulin domain-containing protein 2	6.11e-03	9.27e-03	NA
2. P	Q6AYP5	Cell adhesion molecule 1	8.28e-05	3.28e-02	NA
2. P	Q6Q8B3	Cell surface glycoprotein CD200 receptor 2	4.19e-03	3.35e-03	NA
2. P	Q9P1W8	Signal-regulatory protein gamma	2.04e-04	3.44e-02	NA
2. P	Q5JXA9	Signal-regulatory protein beta-2	1.84e-03	8.74e-04	NA
2. P	Q92154	Schwann cell myelin protein	3.84e-04	8.93e-04	NA
2. P	Q9JI59	Junctional adhesion molecule B	1.37e-02	2.57e-05	NA
2. P	Q9JK39	Butyrophilin-like protein 10	1.61e-03	2.10e-04	NA
2. P	P26151	High affinity immunoglobulin gamma Fc receptor I	6.25e-05	4.97e-03	NA
2. P	Q95LH0	Sialic acid-binding Ig-like lectin 12	1.14e-04	1.26e-02	NA
2. P	Q8IYS5	Osteoclast-associated immunoglobulin-like receptor	5.78e-04	2.08e-04	NA
2. P	Q9JLM2	Natural killer cell receptor 2B4	1.06e-04	3.08e-04	NA
2. P	Q96LA5	Fc receptor-like protein 2	4.73e-04	3.70e-02	NA
2. P	P08508	Low affinity immunoglobulin gamma Fc region receptor III	2.44e-04	2.18e-03	NA
2. P	P97546	Neuroplastin	3.74e-04	1.95e-03	NA
2. P	Q9MZ08	Basal cell adhesion molecule	2.93e-04	1.56e-06	NA
2. P	Q8N126	Cell adhesion molecule 3	9.37e-05	2.68e-08	NA
2. P	Q08ET2	Sialic acid-binding Ig-like lectin 14	9.79e-07	1.41e-08	NA
2. P	P18627	Lymphocyte activation gene 3 protein	3.84e-05	9.43e-07	NA
2. P	Q9UM44	HERV-H LTR-associating protein 2	2.52e-04	2.95e-04	NA
2. P	Q07699	Sodium channel subunit beta-1	8.01e-03	9.00e-03	NA
2. P	Q96N03	V-set and transmembrane domain-containing protein 2-like protein	5.07e-02	4.88e-02	NA
2. P	Q56A07	Sodium channel subunit beta-2	2.25e-03	1.81e-02	NA
2. P	Q28173	Advanced glycosylation end product-specific receptor	3.77e-05	2.22e-06	NA
2. P	Q62151	Advanced glycosylation end product-specific receptor	2.37e-05	2.63e-07	NA
2. P	P16410	Cytotoxic T-lymphocyte protein 4	2.63e-02	3.93e-03	NA
2. P	Q9JKA5	Cell surface A33 antigen	1.33e-03	5.73e-05	NA
2. P	Q13740	CD166 antigen	4.83e-05	2.35e-02	NA
2. P	O88775	Embigin	1.05e-01	4.30e-05	NA
2. P	Q9ET39	SLAM family member 6	6.62e-02	1.71e-11	NA
2. P	P25189	Myelin protein P0	9.93e-03	7.42e-03	NA
2. P	P33681	T-lymphocyte activation antigen CD80	3.56e-04	1.33e-02	NA
2. P	P26453	Basigin	1.20e-04	4.62e-02	NA
2. P	Q22125	Zwei Ig domain protein zig-6	1.19e-04	2.18e-05	NA
2. P	Q6UX52	Protein IL-40	5.87e-03	5.28e-06	NA
2. P	P18181	CD48 antigen	4.21e-06	1.29e-03	NA
2. P	Q4PPC4	Sodium channel subunit beta-1	9.31e-03	1.16e-02	NA
2. P	P09793	Cytotoxic T-lymphocyte protein 4	1.27e-01	1.97e-02	NA
2. P	O18906	CD226 antigen	3.46e-03	5.49e-04	NA
2. P	Q26474	Lachesin	3.60e-05	4.56e-07	NA
2. P	Q14952	Killer cell immunoglobulin-like receptor 2DS3	6.71e-03	1.21e-02	NA
2. P	Q2YHT7	Cell surface glycoprotein CD200 receptor 1-A	1.84e-03	9.37e-05	NA
2. P	Q8N0Z9	V-set and immunoglobulin domain-containing protein 10	4.07e-04	3.22e-02	NA
2. P	A6NMB1	Sialic acid-binding Ig-like lectin 16	2.22e-05	8.65e-04	NA
2. P	Q6ZMC9	Sialic acid-binding Ig-like lectin 15	2.77e-03	4.74e-04	NA
2. P	Q6PDS0	V-set and transmembrane domain-containing protein 2-like protein	1.85e-02	7.47e-06	NA
2. P	Q9D8B7	Junctional adhesion molecule C	7.23e-03	1.71e-06	NA
2. P	P42081	T-lymphocyte activation antigen CD86	2.94e-03	1.11e-06	NA
2. P	Q9ES57	Cell surface glycoprotein CD200 receptor 1	3.94e-03	2.34e-04	NA
2. P	P43628	Killer cell immunoglobulin-like receptor 2DL3	3.79e-03	3.38e-02	NA
2. P	P10252	CD48 antigen	5.83e-06	2.24e-02	NA
2. P	Q6DJ83	Cell adhesion molecule 2	9.49e-05	4.14e-02	NA
2. P	Q5UKY4	Cell surface glycoprotein CD200 receptor 3	1.88e-02	7.38e-06	NA
2. P	Q9UIB8	SLAM family member 5	3.44e-03	1.86e-02	NA
2. P	Q8NFZ8	Cell adhesion molecule 4	1.02e-05	4.06e-09	NA
2. P	Q8VE98	CD276 antigen	2.60e-03	2.24e-07	NA
2. P	Q9BX67	Junctional adhesion molecule C	2.39e-03	2.47e-06	NA
2. P	Q2WGK2	Junctional adhesion molecule A	2.75e-03	7.26e-04	NA
2. P	Q0V881	Lymphocyte antigen 6 complex locus protein G6f	2.09e-02	1.08e-02	NA
2. P	Q9P0V8	SLAM family member 8	1.03e-03	7.71e-03	NA
2. P	P27573	Myelin protein P0	1.21e-02	1.28e-02	NA
2. P	Q00609	T-lymphocyte activation antigen CD80	9.87e-04	1.08e-05	NA
2. P	Q17QN4	Sodium channel subunit beta-1	8.07e-04	2.98e-03	NA
2. P	O88792	Junctional adhesion molecule A	9.29e-04	7.62e-05	NA
2. P	Q8R464	Cell adhesion molecule 4	9.37e-05	2.13e-08	NA
2. P	P21995	Embigin	1.04e-01	1.41e-02	NA
2. P	Q29983	MHC class I polypeptide-related sequence A	1.70e-01	2.00e-02	NA
2. P	P43627	Killer cell immunoglobulin-like receptor 2DL2	4.91e-03	3.05e-02	NA
2. P	P15151	Poliovirus receptor	1.32e-04	1.23e-06	NA
2. P	P42082	T-lymphocyte activation antigen CD86	3.25e-03	1.77e-03	NA
2. P	P97300	Neuroplastin	2.81e-04	1.66e-02	NA
2. P	Q9BQ51	Programmed cell death 1 ligand 2	2.54e-02	1.91e-04	NA
2. P	P32942	Intercellular adhesion molecule 3	8.82e-03	1.73e-03	NA
3. B	Q8NDA2	Hemicentin-2	NA	NA	5.58e-04
3. B	O95428	Papilin	5.78e-02	NA	0.002
3. B	A0A0B4J1L0	Carcinoembryonic antigen-related cell adhesion molecule 15	1.04e-06	NA	6.48e-15
3. B	Q62845	Contactin-4	1.11e-03	NA	0.042
3. B	Q9N1E5	B-cell receptor CD22 (Fragment)	5.65e-06	NA	0.008
3. B	Q05793	Basement membrane-specific heparan sulfate proteoglycan core protein	NA	NA	0.017
3. B	Q96RW7	Hemicentin-1	NA	NA	5.14e-05
3. B	Q7Z692	Carcinoembryonic antigen-related cell adhesion molecule 19	2.05e-03	NA	0.007
3. B	D3YXG0	Hemicentin-1	NA	NA	2.04e-07
3. B	Q9N1E3	B-cell receptor CD22 (Fragment)	3.74e-06	NA	8.98e-04
3. B	Q2WEN9	Carcinoembryonic antigen-related cell adhesion molecule 16	3.03e-12	NA	1.92e-21
3. B	P06731	Carcinoembryonic antigen-related cell adhesion molecule 5	2.21e-08	NA	4.37e-24
3. B	Q810J1	Pregnancy-specific glycoprotein 22	8.41e-09	NA	1.23e-11
3. B	P98160	Basement membrane-specific heparan sulfate proteoglycan core protein	NA	NA	0.017
3. B	Q3UKK2	Carcinoembryonic antigen-related cell adhesion molecule 5	3.78e-05	NA	1.36e-05
3. B	Q9N1E6	B-cell receptor CD22 (Fragment)	6.66e-06	NA	0.008
3. B	P40198	Carcinoembryonic antigen-related cell adhesion molecule 3	1.68e-03	NA	1.09e-06
3. B	Q640R3	Hepatocyte cell adhesion molecule	1.01e-03	NA	0.013
3. B	P20273	B-cell receptor CD22	2.48e-04	NA	0.006
3. B	Q63111	Carcinoembryonic antigen-related cell adhesion molecule 3	7.12e-07	NA	1.04e-08
3. B	A4FUY1	Hepatocyte cell adhesion molecule	9.85e-04	NA	0.006
3. B	O75871	Carcinoembryonic antigen-related cell adhesion molecule 4	1.82e-04	NA	2.88e-06
3. B	Q90W79	Contactin-5	1.42e-02	NA	0.017
3. B	Q14CZ8	Hepatocyte cell adhesion molecule	4.83e-03	NA	0.003
3. B	D3YZF7	V-set and immunoglobulin domain-containing protein 10-like	2.01e-03	NA	1.59e-04