Summary

A8MU93

Homolog: P08041.
Function: Gas vesicle protein C.

Statistics

Total GO Annotation: 45
Unique PROST Go: 39
Unique BLAST Go: 6

Total Homologs: 63
Unique PROST Homologs: 60
Unique BLAST Homologs: 1

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was P08041 (Gas vesicle protein C) with a FATCAT P-Value: 3.89e-06 and RMSD of 2.35 angstrom. The sequence alignment identity is 17.5%.
Structural alignment shown in left. Query protein A8MU93 colored as red in alignment, homolog P08041 colored as blue. Query protein A8MU93 is also shown in right top, homolog P08041 showed in right bottom. They are colored based on secondary structures. 

  A8MU93 ----MASARGAKQS-SPRVGTTRYTETS-TVRVETSSHRVETSSRRVET-SQ-RRS-EGPS---LSPSGKRLPRILEASSR-------HVE--SSSQR-- 77
  P08041 MTPLMIRIRQEHRGIAEEV-TQLFKDTQEFLSV-TTAQRQAQAKEQAENLHQFHKDLEKDTEEFLTDTAKE--RMAKAKQQAEDLFQFHKEMAENTQEFL 96

  A8MU93 TETTSRHV-----RASSLR-----VE--TSLHCAESPTPRAKPAARQNEKTAR------------- 118
  P08041 SETAKERMAQAQEQARQLREFHQNLEQTTNEFLADTAKERMAQAQEQKQQLHQFRQDLFASIFGTF 162

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0018149 peptide cross-linking
2. P GO:0043029 T cell homeostasis
2. P GO:1900740 positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway
2. P GO:0042771 intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
2. P GO:0030216 keratinocyte differentiation
2. P GO:0045095 keratin filament
2. P GO:0006919 activation of cysteine-type endopeptidase activity involved in apoptotic process
2. P GO:0009411 response to UV
2. P GO:0033172 gas vesicle shell
2. P GO:0051117 ATPase binding
2. P GO:0008061 chitin binding
2. P GO:0031424 keratinization
2. P GO:0048147 negative regulation of fibroblast proliferation
2. P GO:0008630 intrinsic apoptotic signaling pathway in response to DNA damage
2. P GO:0010165 response to X-ray
2. P GO:0039545 suppression by virus of host viral-induced cytoplasmic pattern recognition receptor signaling pathway via inhibition of MAVS activity
2. P GO:0044164 host cell cytosol
2. P GO:0010917 negative regulation of mitochondrial membrane potential
2. P GO:0070059 intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress
2. P GO:0033644 host cell membrane
2. P GO:0005829 cytosol
2. P GO:0005576 extracellular region
2. P GO:0001836 release of cytochrome c from mitochondria
2. P GO:0003779 actin binding
2. P GO:0032355 response to estradiol
2. P GO:0016607 nuclear speck
2. P GO:0005537 mannose binding
2. P GO:0005882 intermediate filament
2. P GO:0043525 positive regulation of neuron apoptotic process
2. P GO:0008544 epidermis development
2. P GO:0030435 sporulation resulting in formation of a cellular spore
2. P GO:0046870 cadmium ion binding
2. P GO:0005186 pheromone activity
2. P GO:0031214 biomineral tissue development
2. P GO:0043517 positive regulation of DNA damage response, signal transduction by p53 class mediator
2. P GO:0072332 intrinsic apoptotic signaling pathway by p53 class mediator
2. P GO:0031412 gas vesicle organization
2. P GO:0003785 actin monomer binding
2. P GO:0001533 cornified envelope
3. B GO:0006511 ubiquitin-dependent protein catabolic process
3. B GO:0035519 protein K29-linked ubiquitination
3. B GO:0010994 free ubiquitin chain polymerization
3. B GO:1904855 proteasome regulatory particle binding
3. B GO:0061630 ubiquitin protein ligase activity
3. B GO:0051974 negative regulation of telomerase activity

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q8BGJ3 Uncharacterized protein C17orf100 homolog 2.04e-07 5.85e-25 4.00e-35
1. PB A8MU93 Uncharacterized protein C17orf100 0 6.38e-157 1.56e-75
2. P P02961 Small, acid-soluble spore protein gamma-type 3.59e-04 4.06e-02 NA
2. P O15602 Actobindin homolog (Fragment) 4.23e-01 1.50e-05 NA
2. P Q9CQK8 Small proline-rich protein 2A1 6.47e-01 2.93e-03 NA
2. P P07907 Rhodotorucin-A peptides type 1 9.55e-01 1.86e-06 NA
2. P O09116 Small proline-rich protein 3 8.88e-01 2.82e-03 NA
2. P Q8WSW3 Cadmium metallothionein 9.33e-01 2.54e-02 NA
2. P Q8K0G7 Proline, histidine and glycine-rich protein 1 9.16e-01 1.70e-04 NA
2. P P83762 Submaxillary mucin (Fragment) 6.61e-01 3.66e-03 NA
2. P O17389 Thymosin beta 1.57e-02 6.60e-04 NA
2. P Q8T6B3 Metallothionein-1 9.71e-01 4.21e-03 NA
2. P B5LYJ9 Mannose-specific lectin 1 9.18e-01 7.26e-03 NA
2. P E1ZVK3 Orcokinin peptides 3.00e-02 2.10e-02 NA
2. P Q08728 Putative uncharacterized protein YOR263C 8.82e-01 3.77e-02 NA
2. P P08685 Uncharacterized 8.4 kDa protein NA 1.50e-03 NA
2. P Q7M3P2 Gastrolith matrix protein (Fragment) 7.32e-01 3.21e-02 NA
2. P A6QNZ4 Proline-rich protein 9 1.52e-04 2.18e-02 NA
2. P Q9WU11 SNRPN upstream reading frame protein 8.07e-02 3.46e-04 NA
2. P Q55DU1 Actobindin-B/C 3.27e-01 3.15e-03 NA
2. P Q5UQF2 Putative ankyrin repeat protein L482 (Fragment) NA 5.19e-03 NA
2. P P86784 Gigasin-1 (Fragment) 8.93e-01 1.49e-02 NA
2. P O13512 Uncharacterized membrane protein YAL064W-B 8.99e-01 2.74e-02 NA
2. P P0CL29 Putative uncharacterized protein YML133W-A 9.00e-02 4.18e-02 NA
2. P Q55DU3 Actobindin-A 1.92e-01 9.38e-06 NA
2. P Q9WU12 SNRPN upstream reading frame protein 5.56e-02 9.36e-07 NA
2. P P0CL31 Putative uncharacterized protein YPL283W-A 8.99e-02 4.18e-02 NA
2. P R9RL27 Mannose-specific lectin CEA 9.52e-01 5.24e-03 NA
2. P P0CL30 Putative uncharacterized protein YNL339W-A 9.40e-02 4.18e-02 NA
2. P O97388 Metallothionein-1 9.29e-01 1.00e-02 NA
2. P Q8BV84 Proline-rich protein 9 5.59e-03 3.34e-02 NA
2. P P22528 Cornifin-B 2.70e-01 4.74e-03 NA
2. P P07785 Small, acid-soluble spore protein gamma-type 1.96e-03 4.79e-03 NA
2. P P80394 Metallothionein-1 9.65e-01 6.71e-03 NA
2. P Q9XS97 SNRPN upstream reading frame protein 2.89e-01 1.60e-09 NA
2. P P35322 Cornifin 3.76e-01 1.66e-02 NA
2. P P20473 23 kDa calcium-binding protein 4.02e-02 4.93e-02 NA
2. P Q8WY50 Placenta-specific protein 4 9.10e-01 6.74e-04 NA
2. P Q9Y675 SNRPN upstream reading frame protein 5.31e-01 1.60e-09 NA
2. P P0C751 Protein VP5 NA 2.93e-02 NA
2. P P35753 Ice-structuring protein RD3 9.36e-01 3.01e-02 NA
2. P A8MTY7 Keratin-associated protein 9-7 6.62e-01 1.08e-02 NA
2. P Q9XS96 SNRPN upstream reading frame protein 1.08e-03 1.06e-03 NA
2. P P84585 Small, acid-soluble spore protein gamma-type 2.71e-03 4.79e-03 NA
2. P A5A6K1 SNRPN upstream reading frame protein 1.65e-01 1.60e-09 NA
2. P Q9BYQ0 Keratin-associated protein 9-8 4.86e-01 1.28e-02 NA
2. P Q9BYQ3 Keratin-associated protein 9-3 5.72e-01 9.03e-04 NA
2. P Q5UPA3 Putative ankyrin repeat protein L22 NA 2.25e-03 NA
2. P Q9JM54 Phorbol-12-myristate-13-acetate-induced protein 1 6.76e-04 3.47e-02 NA
2. P A3DRP9 Protein PB1-F2 NA 3.15e-03 NA
2. P Q3LHN0 Keratin-associated protein 25-1 7.88e-01 3.56e-02 NA
2. P Q4KL71 Small proline-rich protein 2A3 4.76e-01 2.93e-03 NA
2. P P08041 Gas vesicle protein C 3.89e-06 4.18e-06 NA
2. P P15481 Protein VP5 NA 3.25e-02 NA
2. P P20465 Rhodotorucin-A peptides type 2 9.53e-01 2.27e-07 NA
2. P Q2EEQ3 Putative uncharacterized protein YahH 8.28e-01 2.55e-03 NA
2. P P81302 Uncharacterized protein MJ0047.1 4.10e-02 4.42e-02 NA
2. P P0CL28 Putative uncharacterized protein YGR296C-A 7.06e-02 4.18e-02 NA
2. P P18281 Actobindin 3.55e-01 1.17e-03 NA
2. P P25221 Protein VP5 NA 5.24e-03 NA
2. P Q39487 Mannose-specific lectin 1 9.31e-01 3.28e-03 NA
2. P P0CL27 Putative uncharacterized protein YER190C-A 7.12e-02 4.18e-02 NA
3. B P33202 Ubiquitin fusion degradation protein 4 8.32e-01 NA 0.017