Summary

A8MUU9

Homolog: P18165.
Function: Loricrin.

Statistics

Total GO Annotation: 117
Unique PROST Go: 90
Unique BLAST Go: 26

Total Homologs: 160
Unique PROST Homologs: 154
Unique BLAST Homologs: 4

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was P18165 (Loricrin) with a FATCAT P-Value: 0.043 and RMSD of 4.22 angstrom. The sequence alignment identity is 0.2%.
Structural alignment shown in left. Query protein A8MUU9 colored as red in alignment, homolog P18165 colored as blue. Query protein A8MUU9 is also shown in right top, homolog P18165 showed in right bottom. They are colored based on secondary structures. 

  A8MUU9 MPPTASLTRSPPTASQTRTLPRASRTRTPPRASLTRSPPTASLRRTPSRASRTRTPPRASLKRTPSRASLTRTLSRASLTRLKSRASHTRTPSRASLTRT 100
  P18165 ---------------------------------------------------------------------------------------------------- 0

  A8MUU9 PPTASRTRSLPRASRTRTPPRTSQRRMPPRTSQTRTPPRASLRRTPSRASRTRTPPRASLRRTPSRASLTRTPSRASLTRLKSRASHTRTPSRASLTRTP 200
  P18165 ---------------------------------------------------------------------------------------------------- 0

  A8MUU9 PTASLTRASRTRTPPRTSQTRTPPRASLRRTPSRASLTRTPSRASLTRTPSRASLTRLKSRASHTRTPSRASLTRTPPTASLTRTPPTASLTRTPPRASL 300
  P18165 ---------------------------------------------------------------------------------------------------- 0

  A8MUU9 TRSPPRASLTRTPPTASLTRSPPTASLTRTPPRASLTRSPPRASLTRTPSTASLTRTPSRASLTRSKSRASHTRTPSRASLTRTPPRASLTRTPPRASLT 400
  P18165 ---------------------------------------------------------------------------------------------------- 0

  A8MUU9 RSPPTASLTRMPPTASLTRSPPRASLTRTPPRASLTRSPSTASLTRTPPGTWLRRTPPRTSLTRTPPTASLTRTPYTASLTRTPYTASLMRMPYMTSLMT 500
  P18165 --------------------------------------------------------------------------------------------------MS 2

  A8MUU9 PYKAR----------------------------------------------------------------------------------------------- 505
  P18165 HQKKQPTPCPPVGCGKTSGGGGGGGGGGGGGYYSGGGSGCGGGSSGGGSSCGGGGGGSYGGGSSCGGGGGSGGGVKYSGGGGGSSCGGGYSGGGGGSSCG 102

  A8MUU9 ---------------------------------------------------------------------------------------------------- 505
  P18165 GGYSGGGGGSSCGGGYSGGGGGSSCGGGSYSGGGSSCGGGGGSGGGVKYSGGGGGGGSSCGGGSSGGGGGGSSCGGGSGGGGSYCGGSSGGGSSGGCGGG 202

  A8MUU9 ---------------------------------------------------------------------------------------------------- 505
  P18165 SGGGKYSGGGGGSSCGGGYSGGGGSSGGSSCGGGYSGGGGSSCGGGGGYSGGGGSSCGGGSSGGGGGGSSQQYQCQSYGGGSSGGSSCGGRYSGGGGSSC 302

  A8MUU9 ---------------------------------------------------------------------------------------------------- 505
  P18165 GGGYSGGGGSSCGGGSSGGGSSCGGSGGGGYSGGGGGSCGGGSSGGGGGYYSSQQTSQTSCAPQQSYGGGSSGGGGSCGGGSSGGGGGGGCYSSGGGGSS 402

  A8MUU9 ------------------------------------------------------------------------------------ 505
  P18165 GGCGGGYSGGGGGCGGGSSGGSGGGCGGGSSGGSGGGCGGGYSGGGGGGSSCGGGSSGGGSGGGKGVPVCHQTQQKQAPTWPCK 486

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0031625 ubiquitin protein ligase binding
2. P GO:0033621 nuclear-transcribed mRNA catabolic process, meiosis-specific transcripts
2. P GO:0030216 keratinocyte differentiation
2. P GO:0022627 cytosolic small ribosomal subunit
2. P GO:0021888 hypothalamus gonadotrophin-releasing hormone neuron development
2. P GO:0045095 keratin filament
2. P GO:0006511 ubiquitin-dependent protein catabolic process
2. P GO:0005796 Golgi lumen
2. P GO:0009631 cold acclimation
2. P GO:1902255 positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator
2. P GO:0042633 hair cycle
2. P GO:0009611 response to wounding
2. P GO:0047497 mitochondrion transport along microtubule
2. P GO:0043209 myelin sheath
2. P GO:0005773 vacuole
2. P GO:0019229 regulation of vasoconstriction
2. P GO:0000128 flocculation
2. P GO:0007141 male meiosis I
2. P GO:0016567 protein ubiquitination
2. P GO:0048012 hepatocyte growth factor receptor signaling pathway
2. P GO:0035096 larval midgut cell programmed cell death
2. P GO:0033150 cytoskeletal calyx
2. P GO:0005576 extracellular region
2. P GO:0090240 positive regulation of histone H4 acetylation
2. P GO:0005634 nucleus
2. P GO:0009753 response to jasmonic acid
2. P GO:0051881 regulation of mitochondrial membrane potential
2. P GO:0009530 primary cell wall
2. P GO:1900190 regulation of single-species biofilm formation
2. P GO:0005186 pheromone activity
2. P GO:1901214 regulation of neuron death
2. P GO:1902166 negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
2. P GO:0001942 hair follicle development
2. P GO:1902527 positive regulation of protein monoubiquitination
2. P GO:0007144 female meiosis I
2. P GO:0075341 host cell PML body
2. P GO:0005199 structural constituent of cell wall
2. P GO:0009414 response to water deprivation
2. P GO:0110148 biomineralization
2. P GO:0001533 cornified envelope
2. P GO:0005737 cytoplasm
2. P GO:0009751 response to salicylic acid
2. P GO:0008585 female gonad development
2. P GO:0018149 peptide cross-linking
2. P GO:0060613 fat pad development
2. P GO:0043480 pigment accumulation in tissues
2. P GO:0039695 DNA-templated viral transcription
2. P GO:0006977 DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest
2. P GO:0043618 regulation of transcription from RNA polymerase II promoter in response to stress
2. P GO:0070062 extracellular exosome
2. P GO:0004857 enzyme inhibitor activity
2. P GO:0002020 protease binding
2. P GO:0030277 maintenance of gastrointestinal epithelium
2. P GO:0097009 energy homeostasis
2. P GO:0033629 negative regulation of cell adhesion mediated by integrin
2. P GO:0048812 neuron projection morphogenesis
2. P GO:0075342 disruption by symbiont of host cell PML body
2. P GO:0022405 hair cycle process
2. P GO:0010944 negative regulation of transcription by competitive promoter binding
2. P GO:0031424 keratinization
2. P GO:0031386 protein tag
2. P GO:0009664 plant-type cell wall organization
2. P GO:0003729 mRNA binding
2. P GO:0009737 response to abscisic acid
2. P GO:0022408 negative regulation of cell-cell adhesion
2. P GO:0018153 isopeptide cross-linking via N6-(L-isoglutamyl)-L-lysine
2. P GO:0031077 post-embryonic camera-type eye development
2. P GO:0020016 ciliary pocket
2. P GO:0009827 plant-type cell wall modification
2. P GO:0039503 suppression by virus of host innate immune response
2. P GO:0020003 symbiont-containing vacuole
2. P GO:0061136 regulation of proteasomal protein catabolic process
2. P GO:0001520 outer dense fiber
2. P GO:0072520 seminiferous tubule development
2. P GO:0110143 magnetosome
2. P GO:0005829 cytosol
2. P GO:0019941 modification-dependent protein catabolic process
2. P GO:0030280 structural constituent of skin epidermis
2. P GO:0010224 response to UV-B
2. P GO:0005882 intermediate filament
2. P GO:0031982 vesicle
2. P GO:0010227 floral organ abscission
2. P GO:0060612 adipose tissue development
2. P GO:0033147 negative regulation of intracellular estrogen receptor signaling pathway
2. P GO:0030197 extracellular matrix constituent, lubricant activity
2. P GO:0042310 vasoconstriction
2. P GO:1990393 3M complex
2. P GO:0036003 positive regulation of transcription from RNA polymerase II promoter in response to stress
2. P GO:0005176 ErbB-2 class receptor binding
2. P GO:0006978 DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator
2. P GO:0008584 male gonad development
3. B GO:0051015 actin filament binding
3. B GO:0007015 actin filament organization
3. B GO:0007605 sensory perception of sound
3. B GO:0016192 vesicle-mediated transport
3. B GO:0005815 microtubule organizing center
3. B GO:0048193 Golgi vesicle transport
3. B GO:1900026 positive regulation of substrate adhesion-dependent cell spreading
3. B GO:0051016 barbed-end actin filament capping
3. B GO:0051020 GTPase binding
3. B GO:0030496 midbody
3. B GO:0006357 regulation of transcription by RNA polymerase II
3. B GO:0043001 Golgi to plasma membrane protein transport
3. B GO:0015629 actin cytoskeleton
3. B GO:0032968 positive regulation of transcription elongation from RNA polymerase II promoter
3. B GO:0120044 stereocilium base
3. B GO:0030047 actin modification
3. B GO:0006368 transcription elongation from RNA polymerase II promoter
3. B GO:0060195 negative regulation of antisense RNA transcription
3. B GO:0045159 myosin II binding
3. B GO:0032044 DSIF complex
3. B GO:0005802 trans-Golgi network
3. B GO:0031267 small GTPase binding
3. B GO:0005925 focal adhesion
3. B GO:0060088 auditory receptor cell stereocilium organization
3. B GO:0003711 transcription elongation regulator activity
3. B GO:0045773 positive regulation of axon extension

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q9UF83 Uncharacterized protein DKFZp434B061 3.14e-01 4.87e-15 2.52e-113
1. PB A8MUU9 Putative uncharacterized protein ENSP00000383309 0 3.79e-168 0.0
2. P A1X158 Foot protein 1 variant 1 9.42e-01 4.31e-07 NA
2. P P0CG66 Polyubiquitin-C 9.97e-01 1.73e-08 NA
2. P P18899 Stress protein DDR48 5.49e-01 6.90e-06 NA
2. P A6NKU9 Speedy protein E3 1.35e-01 3.97e-05 NA
2. P Q7T3L1 Kininogen-1a 9.76e-01 1.64e-02 NA
2. P Q1EC66 Polyubiquitin 3 9.94e-01 1.25e-02 NA
2. P Q06666 Octapeptide-repeat protein T2 NA 5.88e-04 NA
2. P O88492 Perilipin-4 9.67e-01 2.96e-03 NA
2. P P69325 Polyubiquitin 9.94e-01 4.86e-02 NA
2. P Q03650 Cysteine-rich, acidic integral membrane protein 9.59e-01 2.95e-06 NA
2. P O08884 Keratin-associated protein 6-2 8.75e-01 7.65e-08 NA
2. P P17941 Involucrin 8.64e-01 4.24e-08 NA
2. P Q63429 Polyubiquitin-C 9.96e-01 6.52e-08 NA
2. P Q95JC9 Basic proline-rich protein 3.96e-01 1.21e-04 NA
2. P P46526 Cold shock protein CS66 3.60e-01 1.25e-07 NA
2. P P07476 Involucrin 9.31e-01 1.18e-06 NA
2. P P0CG14 Decreased expression in renal and prostate cancer protein 2.83e-01 1.47e-02 NA
2. P P0CG62 Polyubiquitin-B 9.93e-01 1.40e-02 NA
2. P Q4ZJY7 Mucin-like protein Glc1.8b NA 9.47e-06 NA
2. P Q9BYR4 Keratin-associated protein 4-3 8.60e-01 4.49e-02 NA
2. P P10751 Zinc finger protein 11 9.83e-01 3.28e-03 NA
2. P P20465 Rhodotorucin-A peptides type 2 9.77e-01 2.41e-04 NA
2. P Q03400 S-antigen protein 9.27e-01 9.61e-09 NA
2. P P0CG50 Polyubiquitin-C 9.97e-01 5.98e-11 NA
2. P Q00130 Uncharacterized protein ORF50 NA 2.58e-03 NA
2. P Q6L8H4 Keratin-associated protein 5-1 3.95e-01 3.12e-04 NA
2. P P62976 Polyubiquitin 9.97e-01 2.53e-15 NA
2. P Q9URU4 Putative cell agglutination protein pfl5 6.77e-01 1.00e-03 NA
2. P Q25460 Adhesive plaque matrix protein (Fragment) 4.79e-01 1.00e-04 NA
2. P E5AV36 Burkholderia TALE-like protein 1 1.00e+00 3.56e-06 NA
2. P Q6RY98 Long-sarafotoxin (Fragment) 9.82e-01 2.13e-09 NA
2. P O70559 Small proline-rich protein 2H 5.42e-01 7.64e-04 NA
2. P Q5GC92 Maximins-S type B/C 9.96e-01 5.42e-03 NA
2. P Q28092 Cylicin-2 1.09e-01 8.26e-03 NA
2. P P12027 Polysialoglycoprotein 9.83e-01 1.08e-02 NA
2. P Q8CIT9 Suprabasin 9.76e-01 1.69e-05 NA
2. P P24708 Involucrin 8.93e-01 3.83e-06 NA
2. P P24711 Involucrin 6.13e-01 7.69e-03 NA
2. P P60412 Keratin-associated protein 10-11 8.86e-01 9.06e-03 NA
2. P P24712 Involucrin 9.20e-01 8.60e-06 NA
2. P P0CG51 Polyubiquitin-B 9.93e-01 1.40e-02 NA
2. P P0CG80 Polyubiquitin-I 9.94e-01 1.61e-03 NA
2. P A6QQF6 Suprabasin 7.99e-01 2.37e-08 NA
2. P P0CG82 Polyubiquitin 9.93e-01 1.37e-03 NA
2. P P69322 Polyubiquitin 9.94e-01 4.27e-03 NA
2. P E5AW45 Burkholderia TALE-like protein 2 9.99e-01 6.00e-09 NA
2. P Q3E7T8 Polyubiquitin 14 9.93e-01 4.86e-02 NA
2. P P59669 Polyubiquitin 9.97e-01 3.69e-06 NA
2. P P15305 Dynein heavy chain (Fragment) 1.00e+00 5.37e-09 NA
2. P P14708 Involucrin 8.88e-01 1.04e-05 NA
2. P P0CG81 Polyubiquitin-H 9.97e-01 2.88e-06 NA
2. P P15276 Transcriptional regulatory protein AlgP 2.43e-01 1.22e-02 NA
2. P Q6L8H1 Keratin-associated protein 5-4 9.34e-01 2.29e-03 NA
2. P P18729 Gastrula zinc finger protein XlCGF57.1 (Fragment) 9.99e-01 6.07e-04 NA
2. P Q4UL00 Putative ankyrin repeat protein RF_0922 9.99e-01 1.73e-02 NA
2. P P81592 Acaloleptin A 8.69e-01 2.34e-03 NA
2. P P0CG68 Polyubiquitin-C 9.96e-01 7.88e-12 NA
2. P P0CG64 Polyubiquitin-C 9.99e-01 1.67e-07 NA
2. P P0CG55 Polyubiquitin-B 9.94e-01 2.33e-02 NA
2. P P0CG49 Polyubiquitin-B 9.92e-01 1.40e-02 NA
2. P P0CG12 Decreased expression in renal and prostate cancer protein 8.51e-02 4.08e-02 NA
2. P P42740 Polyubiquitin 9.97e-01 1.01e-05 NA
2. P Q8N1N5 Putative protein CRIPAK 5.03e-01 7.41e-10 NA
2. P P59991 Keratin-associated protein 12-2 7.75e-01 3.07e-02 NA
2. P Q6P902 Thioredoxin domain-containing protein 2 1.91e-01 2.31e-04 NA
2. P Q1HVI8 Epstein-Barr nuclear antigen leader protein NA 2.36e-11 NA
2. P Q925H4 Keratin-associated protein 21-1 8.72e-01 4.00e-02 NA
2. P P0CG76 Polyubiquitin-A 9.98e-01 4.90e-06 NA
2. P Q9BYQ6 Keratin-associated protein 4-11 9.91e-01 4.72e-02 NA
2. P Q8H159 Polyubiquitin 10 9.94e-01 8.40e-07 NA
2. P Q3V4U7 Structural protein ORF567 NA 1.19e-02 NA
2. P Q9BYQ5 Keratin-associated protein 4-6 9.72e-01 2.17e-02 NA
2. P Q8N7P7 Uncharacterized protein FLJ40521 8.84e-01 2.97e-18 NA
2. P P0CG75 Polyubiquitin 9.94e-01 3.07e-02 NA
2. P Q8MKD1 Polyubiquitin-B 9.94e-01 2.92e-03 NA
2. P Q2KI51 Protein phosphatase 1 regulatory subunit 15A 8.11e-02 1.32e-02 NA
2. P P42739 Polyubiquitin (Fragment) 9.97e-01 1.17e-09 NA
2. P Q16992 LWamide neuropeptides 4.54e-01 2.92e-04 NA
2. P O96530 Hyalin (Fragment) 8.02e-01 1.89e-02 NA
2. P Q9FS16 Extensin-3 7.59e-02 4.93e-04 NA
2. P P0CG61 Polyubiquitin-C 9.99e-01 1.67e-07 NA
2. P P60372 Keratin-associated protein 10-4 3.08e-01 7.48e-04 NA
2. P Q8AZK7 Epstein-Barr nuclear antigen leader protein NA 2.89e-12 NA
2. P P0CG79 Polyubiquitin-G 9.94e-01 1.21e-05 NA
2. P Q6XPR3 Repetin 3.18e-01 1.80e-02 NA
2. P O04309 Jacalin-related lectin 35 9.85e-01 3.81e-02 NA
2. P P15941 Mucin-1 9.67e-01 4.22e-03 NA
2. P P20481 Buccalin 9.90e-01 1.78e-04 NA
2. P P0CG88 Polyubiquitin-J 9.94e-01 1.61e-03 NA
2. P P04280 Basic salivary proline-rich protein 1 7.15e-01 1.83e-07 NA
2. P P46525 Cold-shock protein CS120 2.22e-01 5.30e-09 NA
2. P P0CG53 Polyubiquitin-B 9.93e-01 6.87e-03 NA
2. P Q86MA7 Protein PRQFV-amide 6.47e-01 3.08e-03 NA
2. P Q9ZQI0 Proline-rich extensin-like protein EPR1 3.16e-01 3.73e-02 NA
2. P P21787 Microtubule-associated protein P320 (Fragment) 7.94e-01 5.47e-03 NA
2. P V6F519 Magnetosome-associated protein MamJ 6.44e-01 3.70e-02 NA
2. P P0CG85 Polyubiquitin 9.95e-01 8.40e-07 NA
2. P Q6ZR52 Zinc finger protein 493 9.99e-01 9.02e-06 NA
2. P Q5SSG8 Mucin-21 9.63e-01 1.10e-06 NA
2. P Q58G87 Polyubiquitin 3 9.95e-01 1.13e-03 NA
2. P Q40375 Repetitive proline-rich cell wall protein 2 7.52e-01 8.09e-03 NA
2. P P13208 Sarafotoxin 9.97e-01 4.09e-03 NA
2. P Q8N307 Mucin-20 6.26e-01 8.26e-03 NA
2. P Q01456 Ovarian abundant message protein 3.02e-01 2.52e-02 NA
2. P A1X159 Foot protein 1 variant 2 9.05e-01 6.01e-03 NA
2. P P14591 Involucrin 8.74e-01 2.10e-08 NA
2. P Q6UWP8 Suprabasin 8.87e-01 1.40e-03 NA
2. P P0CG84 Polyubiquitin (Fragment) 9.97e-01 5.42e-03 NA
2. P Q99102 Mucin-4 9.00e-01 3.78e-05 NA
2. P P13821 S-antigen protein 3.38e-01 4.46e-04 NA
2. P Q9LF88 Late embryogenesis abundant protein At3g53040 9.59e-01 8.60e-03 NA
2. P P20075 Embryonic protein DC-8 9.50e-01 4.56e-04 NA
2. P P05227 Histidine-rich protein PFHRP-II 8.19e-01 2.89e-03 NA
2. P P0CH04 Polyubiquitin 9.97e-01 9.75e-09 NA
2. P P0CH32 Polyubiquitin 4 9.94e-01 3.99e-04 NA
2. P Q8TFG4 Uncharacterized protein PB18E9.04c 7.32e-01 1.12e-05 NA
2. P P0C728 Uncharacterized protein LF3 NA 6.06e-10 NA
2. P P0CG71 Polyubiquitin-A 9.99e-01 1.60e-02 NA
2. P P0C727 Uncharacterized protein LF3 NA 6.06e-10 NA
2. P P24856 Ice-structuring glycoprotein (Fragment) 9.76e-01 2.52e-09 NA
2. P P48998 Involucrin 2.18e-01 1.61e-04 NA
2. P P0CG78 Polyubiquitin-F 9.97e-01 2.01e-10 NA
2. P P0CH05 Polyubiquitin 9.95e-01 9.75e-09 NA
2. P P02812 Basic salivary proline-rich protein 2 1.23e-01 2.92e-07 NA
2. P P14918 Extensin 3.05e-01 1.04e-07 NA
2. P P0CG72 Polyubiquitin 9.96e-01 4.03e-04 NA
2. P P05691 Circumsporozoite protein (Fragment) 8.55e-01 2.47e-03 NA
2. P P69315 Polyubiquitin (Fragment) 9.95e-01 3.85e-02 NA
2. P P0CG69 Polyubiquitin 9.99e-01 1.48e-07 NA
2. P P62521 Coiled-coil domain-containing protein 8 8.37e-01 3.77e-02 NA
2. P Q04118 Basic salivary proline-rich protein 3 3.24e-01 4.49e-03 NA
2. P Q27905 Probable antibacterial peptide polyprotein 6.09e-01 1.24e-15 NA
2. P B2RYL1 Decreased expression in renal and prostate cancer protein 6.94e-02 3.63e-02 NA
2. P Q9FKA5 Uncharacterized protein At5g39570 2.77e-01 2.95e-02 NA
2. P P0CG63 Polyubiquitin 9.95e-01 4.98e-04 NA
2. P P0CG48 Polyubiquitin-C 9.98e-01 1.42e-07 NA
2. P P51522 Zinc finger protein 83 9.25e-01 1.00e-03 NA
2. P A0A0U1RQI7 Kruppel-like factor 18 9.39e-01 6.13e-03 NA
2. P Q4ZJZ0 Mucin-like protein Glc1.8a NA 8.17e-05 NA
2. P Q9FHQ6 Polyubiquitin 9 9.95e-01 1.99e-02 NA
2. P P18715 Gastrula zinc finger protein XlCGF26.1 (Fragment) 9.99e-01 2.11e-06 NA
2. P Q08695 Axoneme-associated protein mst101(1) 9.62e-01 4.54e-02 NA
2. P Q9BYR2 Keratin-associated protein 4-5 9.88e-01 1.19e-02 NA
2. P P0CH28 Polyubiquitin-C 9.98e-01 3.87e-11 NA
2. P Q06841 Early nodulin-75 (Fragment) 6.32e-01 2.54e-08 NA
2. P P0CG54 Polyubiquitin-B 9.93e-01 2.76e-04 NA
2. P P08399 Putative per-hexamer repeat protein 5 9.92e-01 2.92e-03 NA
2. P Q5R5U3 Zinc finger protein 271 9.54e-01 1.50e-02 NA
2. P Q9M1G9 Extensin-2 9.05e-01 3.74e-06 NA
2. P P0C732 Epstein-Barr nuclear antigen leader protein NA 2.89e-12 NA
2. P Q38913 Extensin-1 5.06e-01 1.33e-03 NA
2. P Q9BQ66 Keratin-associated protein 4-12 8.87e-01 4.27e-04 NA
2. P P18165 Loricrin 4.30e-02 2.47e-04 NA
2. P A0A0U5GHH9 Austinoid biosynthesis cluster protein W NA 1.42e-03 NA
3. B O13936 Transcription elongation factor spt5 8.93e-01 NA 0.010
3. B Q6H236 Paternally-expressed gene 3 protein 8.52e-01 NA 2.02e-43
3. B Q9H2D6 TRIO and F-actin-binding protein 8.72e-01 NA 8.02e-05
3. B Q13439 Golgin subfamily A member 4 9.97e-01 NA 0.026