Summary

A8MY62

Homolog: P0AD71.
Function: D-alanyl-D-alanine-carboxypeptidase/endopeptidase AmpH.

Statistics

Total GO Annotation: 34
Unique PROST Go: 15
Unique BLAST Go: 6

Total Homologs: 90
Unique PROST Homologs: 63
Unique BLAST Homologs: 5

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was P0AD71 (D-alanyl-D-alanine-carboxypeptidase/endopeptidase AmpH) with a FATCAT P-Value: 0.0 and RMSD of 3.08 angstrom. The sequence alignment identity is 20.4%.
Structural alignment shown in left. Query protein A8MY62 colored as red in alignment, homolog P0AD71 colored as blue. Query protein A8MY62 is also shown in right top, homolog P0AD71 showed in right bottom. They are colored based on secondary structures. 

  A8MY62 ----------MC-----PRHPEPVPLAHPLPVLKEALEK-VDQILRQAMSAPGVAAMSAVVIHNDTVLWTGN---FGKKNG-SDPASGA-PNEYTMYRIS 79
  P0AD71 MKRSLLFSAVLCAASLTSVHAAQ-PITEP-EFASDIVDRYADHI----FYGSGATGMALVVI--D-----GNQRVF-RSYGETRPGNNVRPQLDSVVRIA 86

  A8MY62 SISKIFPVLMLYRLWEEGIVASLDDPLERYASTFTINNPLGLASAE-QQG--LILRRMASQLSGLPRR-----LRSTSLLWKGSTQEA----LNLLKDDV 167
  P0AD71 SLTKLMTSEMLVKLLDQGTV-KLNDPLSKYA-------PPG-ARVPTYNGTPITLVNLATHTSALPREQPGGAAHRPVFVW--PTREQRWKYLSTAK--- 172

  A8MY62 LVVDPGTRCHYSTLAFSLLAHVLAAHTAQG-DYQRWVSENVLEPLGMADTGFDLTPD-VRARLAAGFYGSGRPA--PLYDLGWYRPSGQMYSTAADLAKL 263
  P0AD71 LKAAPGSQAAYSNLAFDLLADALA--NASGKPYTQLFEEQITRPLGMKDTTYTPSPDQCR-RLMVAERGA-SPCNNTLAAIG----SGGVYSTPGDMMRW 264

  A8MY62 AVALLGGG-PRRLLRPDAAKTLL------APLLA--CPGAYFANETGTPWEFHA-QRGYR--VVRKDGDLDGYAATF-SLVPPLRLGLVLLLAGPRPPGP 350
  P0AD71 MQQYLSSDFYQRSNQADRMQTLIYQRAQFTKVIGMDVPGK--ADALGLGWVYMAPKEG-RPGIIQKTGGGGGF-ITYMAMIPQKNIGAFVVVT--RSP-- 356

  A8MY62 DLVAR---AYD---ELLPALERALREAEPGPAP---PPTAHPFAGYFTFANLTFYEVRAGPAGELRLRQFGPRVEALVPPAFRTLALRHLHGRVFQLHVA 441
  P0AD71 --LTRFKNMSDGINDLVTEL--------SGNKPLVIPAS------------------------------------------------------------- 385

  A8MY62 HEFPCALPLGDAWLSLEAQHGQLVNFYPLDHHGLSPGFDVPGLNTYRVLRLRGKPVFKT 500
  P0AD71 ----------------------------------------------------------- 385

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0017000 antibiotic biosynthetic process
1. PB GO:0008658 penicillin binding
1. PB GO:0005886 plasma membrane
1. PB GO:0004180 carboxypeptidase activity
1. PB GO:0017001 antibiotic catabolic process
1. PB GO:0008800 beta-lactamase activity
1. PB GO:0005576 extracellular region
1. PB GO:0009253 peptidoglycan catabolic process
1. PB GO:0016021 integral component of membrane
1. PB GO:0030288 outer membrane-bounded periplasmic space
1. PB GO:0004175 endopeptidase activity
1. PB GO:0016787 hydrolase activity
1. PB GO:0008360 regulation of cell shape
2. P GO:0004359 glutaminase activity
2. P GO:0008126 acetylesterase activity
2. P GO:0004177 aminopeptidase activity
2. P GO:0009252 peptidoglycan biosynthetic process
2. P GO:1990914 integral component of periplasmic side of plasma membrane
2. P GO:0031226 intrinsic component of plasma membrane
2. P GO:0046503 glycerolipid catabolic process
2. P GO:0071555 cell wall organization
2. P GO:0009002 serine-type D-Ala-D-Ala carboxypeptidase activity
2. P GO:0016746 acyltransferase activity
2. P GO:0008745 N-acetylmuramoyl-L-alanine amidase activity
2. P GO:0033252 regulation of beta-lactamase activity
2. P GO:0030639 polyketide biosynthetic process
2. P GO:0000270 peptidoglycan metabolic process
2. P GO:0046677 response to antibiotic
3. B GO:0019216 regulation of lipid metabolic process
3. B GO:0006508 proteolysis
3. B GO:0005739 mitochondrion
3. B GO:0006629 lipid metabolic process
3. B GO:0042802 identical protein binding
3. B GO:0008233 peptidase activity

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q2FVH6 Protein flp 3.54e-10 1.50e-13 3.21e-14
1. PB Q7A3Q5 Protein flp 4.38e-10 9.92e-14 8.30e-15
1. PB Q54SB5 Beta-lactamase-like protein 4 5.55e-15 1.92e-43 3.25e-41
1. PB Q6GDZ1 Protein flp 2.65e-12 3.12e-14 1.33e-14
1. PB Q9KJ74 Protein flp 2.81e-10 1.50e-13 3.21e-14
1. PB Q5HDB2 Protein flp 2.20e-10 2.35e-13 1.90e-14
1. PB D4AXL1 Beta-lactamase-like protein ARB_00930 2.39e-13 2.81e-29 1.52e-09
1. PB P9WLZ2 Uncharacterized protein MT1414 2.00e-12 3.93e-06 2.39e-05
1. PB A8MY62 Putative beta-lactamase-like 1 0 1.95e-122 0.0
1. PB Q7KWX1 Beta-lactamase-like protein 1 0.00e+00 1.56e-22 1.38e-29
1. PB P0AD71 D-alanyl-D-alanine-carboxypeptidase/endopeptidase AmpH 0.00e+00 3.72e-04 1.91e-14
1. PB Q6G6M9 Protein flp 2.76e-09 3.94e-13 9.90e-14
1. PB P9WLZ3 Uncharacterized protein Rv1367c 3.40e-12 3.93e-06 2.39e-05
1. PB P0AD70 D-alanyl-D-alanine-carboxypeptidase/endopeptidase AmpH 1.11e-16 3.72e-04 1.91e-14
1. PB A0A1B4XBI2 Beta-lactamase-like protein sdnR 3.23e-09 1.70e-34 1.58e-04
1. PB A0A3G1DJI3 Probable hydrolase M10 1.36e-13 2.87e-35 2.11e-07
1. PB P85302 Beta-lactamase 0.00e+00 2.36e-06 0.033
1. PB A0A345BJP5 Probable hydrolase clz13 7.60e-13 3.54e-36 1.56e-05
1. PB Q8NUZ4 Protein flp 6.38e-10 5.35e-13 1.30e-13
1. PB Q54VJ1 Beta-lactamase-like protein 2 0.00e+00 8.98e-40 8.74e-47
1. PB Q99RJ0 Protein flp 3.22e-10 9.92e-14 8.30e-15
1. PB Q54SB6 Beta-lactamase-like protein 3 5.55e-16 4.39e-41 2.06e-45
2. P Q5FRJ7 D-aminopeptidase 3.93e-12 2.98e-25 NA
2. P Q8NMT3 Glutaminase 2.49e-02 9.77e-05 NA
2. P Q8ZN80 Putative D-alanyl-D-alanine carboxypeptidase 1.29e-10 4.72e-06 NA
2. P Q9KX40 Esterase EstB 1.11e-16 1.10e-04 NA
2. P A9MCM7 D-aminopeptidase 2.94e-12 7.76e-25 NA
2. P P77619 Putative D-alanyl-D-alanine carboxypeptidase 9.42e-09 3.24e-06 NA
2. P Q8YD27 D-aminopeptidase 2.56e-12 9.64e-25 NA
2. P O05213 N-acetylmuramyl-L-alanine amidase 1.20e-14 2.06e-04 NA
2. P Q0C8M0 Monacolin J acid methylbutanoyltransferase 1.01e-13 3.85e-06 NA
2. P B5F0K5 Putative D-alanyl-D-alanine carboxypeptidase 1.16e-10 7.73e-06 NA
2. P P71778 Esterase/beta-lactamase LipL 2.35e-13 5.83e-05 NA
2. P A1IHE7 Methyl acetate hydrolase NA 1.63e-06 NA
2. P P24735 Beta-lactamase 0.00e+00 2.75e-03 NA
2. P P38422 D-alanyl-D-alanine carboxypeptidase DacF 1.61e-03 2.61e-02 NA
2. P A6WYS5 D-aminopeptidase 3.91e-12 7.85e-26 NA
2. P Q5PCQ2 Putative D-alanyl-D-alanine carboxypeptidase 9.90e-11 4.29e-06 NA
2. P Q06317 Penicillin-binding protein 4 0.00e+00 4.10e-14 NA
2. P P08750 D-alanyl-D-alanine carboxypeptidase DacA 1.08e-03 2.10e-03 NA
2. P Q2YLB4 D-aminopeptidase 3.08e-12 7.76e-25 NA
2. P P44466 D-alanyl-D-alanine carboxypeptidase DacA 3.64e-04 3.98e-02 NA
2. P C0PZ64 Putative D-alanyl-D-alanine carboxypeptidase 1.01e-10 4.33e-06 NA
2. P C0RM93 D-aminopeptidase 2.90e-12 4.94e-25 NA
2. P Q8FMX4 Glutaminase 2.82e-02 4.34e-04 NA
2. P P05193 Beta-lactamase 0.00e+00 1.09e-02 NA
2. P P33013 D-alanyl-D-alanine carboxypeptidase DacD 3.57e-04 2.86e-04 NA
2. P P32959 Penicillin-binding protein 4* 4.55e-15 4.34e-33 NA
2. P Q48743 Beta-lactamase 0.00e+00 1.52e-05 NA
2. P P45460 Beta-lactamase 0.00e+00 2.97e-02 NA
2. P B2SD81 D-aminopeptidase 2.89e-12 7.76e-25 NA
2. P P0AEB3 D-alanyl-D-alanine carboxypeptidase DacA 4.66e-04 5.71e-03 NA
2. P B4TD53 Putative D-alanyl-D-alanine carboxypeptidase 1.12e-10 3.42e-06 NA
2. P B5FQG8 Putative D-alanyl-D-alanine carboxypeptidase 9.45e-11 4.33e-06 NA
2. P B9KTA6 D-aminopeptidase 6.07e-12 6.64e-24 NA
2. P P00811 Beta-lactamase 0.00e+00 2.51e-03 NA
2. P B4T0K5 Putative D-alanyl-D-alanine carboxypeptidase 1.03e-10 4.33e-06 NA
2. P P0CU81 Acyltransferase calJ 9.24e-14 1.95e-05 NA
2. P P37604 D-alanyl-D-alanine carboxypeptidase DacD 8.28e-04 3.37e-04 NA
2. P O69773 Beta-lactamase 0.00e+00 3.65e-04 NA
2. P Q8Z4S7 Putative D-alanyl-D-alanine carboxypeptidase 1.71e-10 3.81e-06 NA
2. P P18539 Beta-lactamase 0.00e+00 2.21e-04 NA
2. P B5R4I5 Putative D-alanyl-D-alanine carboxypeptidase 9.17e-11 4.77e-06 NA
2. P Q579G4 D-aminopeptidase 3.27e-12 7.76e-25 NA
2. P Q3IX78 D-aminopeptidase 3.82e-12 1.68e-24 NA
2. P P15555 D-alanyl-D-alanine carboxypeptidase 2.73e-11 1.27e-03 NA
2. P Q57LN2 Putative D-alanyl-D-alanine carboxypeptidase 1.33e-10 4.33e-06 NA
2. P P08506 D-alanyl-D-alanine carboxypeptidase DacC 3.93e-04 1.71e-03 NA
2. P B5RCU8 Putative D-alanyl-D-alanine carboxypeptidase 9.16e-11 5.09e-06 NA
2. P A9N307 Putative D-alanyl-D-alanine carboxypeptidase 9.95e-11 4.33e-06 NA
2. P B5BB26 Putative D-alanyl-D-alanine carboxypeptidase 9.31e-11 4.29e-06 NA
2. P A5VVL2 D-aminopeptidase 3.07e-12 5.71e-25 NA
2. P B6H6L7 Lovastatin esterase 3.06e-09 1.54e-08 NA
2. P Q8XBJ0 Putative D-alanyl-D-alanine carboxypeptidase 7.28e-09 2.75e-06 NA
2. P Q9Y7D1 Monacolin J acid methylbutanoyltransferase 9.47e-14 2.93e-06 NA
2. P B4TR50 Putative D-alanyl-D-alanine carboxypeptidase 9.95e-11 3.45e-06 NA
2. P P05364 Beta-lactamase 0.00e+00 9.12e-03 NA
2. P Q9ZBA9 D-aminopeptidase 3.34e-12 1.63e-25 NA
2. P P0AEB2 D-alanyl-D-alanine carboxypeptidase DacA 4.74e-04 5.71e-03 NA
2. P A9WVV8 D-aminopeptidase 3.29e-12 7.76e-25 NA
2. P Q45129 Uncharacterized protein BpOF4_21049 4.33e-15 2.44e-04 NA
2. P P0AEB4 D-alanyl-D-alanine carboxypeptidase DacA 4.75e-04 5.71e-03 NA
2. P Q8J0G0 ML-236A carboxylate methylbutanoyltransferase mlcH 4.69e-14 9.87e-05 NA
2. P Q8FV99 D-aminopeptidase 4.54e-12 7.76e-25 NA
2. P A3PRU3 D-aminopeptidase 3.65e-12 1.17e-23 NA
3. B Q9EP89 Serine beta-lactamase-like protein LACTB, mitochondrial 1.64e-13 NA 0.006
3. B P83095 Serine beta-lactamase-like protein LACTB, mitochondrial 1.07e-09 NA 0.004
3. B A0A3B1EFQ0 Beta-lactamase-like protein str5 1.07e-06 NA 8.62e-08
3. B P83111 Serine beta-lactamase-like protein LACTB, mitochondrial 9.31e-14 NA 3.60e-04
3. B O31773 Putative penicillin-binding protein PbpX 4.85e-10 NA 2.67e-05