Results | PROST

Summary

A8MYJ7

Homolog: Q8C0Q3.
Function: Tetratricopeptide repeat protein 34.

Statistics

Total GO Annotation: 69
Unique PROST Go: 53
Unique BLAST Go: 16

Total Homologs: 25
Unique PROST Homologs: 16
Unique BLAST Homologs: 6

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q8C0Q3 (Tetratricopeptide repeat protein 34) with a FATCAT P-Value: 0.0 and RMSD of 2.97 angstrom. The sequence alignment identity is 68.6%.
Structural alignment shown in left. Query protein A8MYJ7 colored as red in alignment, homolog Q8C0Q3 colored as blue. Query protein A8MYJ7 is also shown in right top, homolog Q8C0Q3 showed in right bottom. They are colored based on secondary structures.

  A8MYJ7 MLQRSPRAGPSRAQGRREAAETGGPTTQEGVACGVHQLATLLMELDSEDEASRLLAADALYRLGRLEETHKALLVALSRRPQAAPVLARLALLQLRRGFF 100
  Q8C0Q3 MLLRS----PSYA-GK--AAQ-----AQEGDAYGVYQLATLLIGMDAEDETSCLLAADALYRLGRLDDAHKSLLVALSQRPQAAPVLVRLALLQLRRGFC 88

  A8MYJ7 YDANQLVKKLVQSGDTACLQPTLDVFCHEDRQLLQGHCHARALAILRARPGGADGRVHTKEAIAYLSLAIFAAGSQASESLLARARCYGFLGQKKTAMFD 200
  Q8C0Q3 YDANQLVKKVAQSGDTACLQHMLDIFHHEDLQLLQDHCHTRALSILRARPGGSDSEAHTREAIAYLSLAIFAAGSGGSESLLVRARCYGLLGQKKTAMFD 188

  A8MYJ7 FNTVLRAEPGNVQALCGRALVHLALDQLQEAVDDIVSALKLGPGTVVPELRSLKPEAQALITQGLYSHCRALLSQLPDTGAPLEDKDTQGLLAVGEALIK 300
  Q8C0Q3 FNAILREEPGNVKALCGRALVHLALDQLQEAVDDMVSALKLDPGTVIPEILSLKTEVQLPLTQGLYTRCRVLLNQCLHTGVPLREEDTQGLLAMGKALIR 288

  A8MYJ7 IDSGQPHWHLLLADILMAQGSYEEAGTHLEKALHRAPTSEAARARLGLLQLKKGDVPGAARDLQSLAEVDAPDLSCLLHLLEASERQSLAQAAAQEAGTL 400
  Q8C0Q3 INATQPSWRLLLTDILTGLGKYQEAGTHLQEALHLTPSSEAAQARQGLLQLKKGDVSAAVHGLQCLAERDTQDLGFLLCLLDSPERQSLVQTAAKEASNI 388

  A8MYJ7 LDAGQPRQALGYCSLSVLASGSSACHLRLRATCLAELQEFGRALRDLDHVLQEALGDGDLPRRAEDFCRQGRLLLSLGDEAAAAGAFAQALKLAPSLAQN 500
  Q8C0Q3 LDLGNPGQALSYCSLAILAGGNNPYHLRLRVACLTQLQEYDRALRDLDRVLQHPAEDSDLPRQSEDFCTRGRLLLSLGDKDGAAGAFTQALALAPAQAQN 488

  A8MYJ7 SLCRQPGRAPTARMFLLRGQCCLEEQRHAEAWTAVESGLLVDPDHRGLKRLKARIRREASSGCWLQ 566
  Q8C0Q3 SLLEQPGQAMTASVFLIHGQRCLEEEHFEEAWTAVQNGLLVDPSHSGLKKLKLRTRKVATSGCRLH 554

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
2. P	GO:0035082	axoneme assembly
2. P	GO:1905799	regulation of intraciliary retrograde transport
2. P	GO:0001541	ovarian follicle development
2. P	GO:0061512	protein localization to cilium
2. P	GO:0000245	spliceosomal complex assembly
2. P	GO:0007091	metaphase/anaphase transition of mitotic cell cycle
2. P	GO:0021549	cerebellum development
2. P	GO:0007005	mitochondrion organization
2. P	GO:0021798	forebrain dorsal/ventral pattern formation
2. P	GO:0030992	intraciliary transport particle B
2. P	GO:0035720	intraciliary anterograde transport
2. P	GO:0035721	intraciliary retrograde transport
2. P	GO:0008589	regulation of smoothened signaling pathway
2. P	GO:0007286	spermatid development
2. P	GO:0071014	post-mRNA release spliceosomal complex
2. P	GO:0045292	mRNA cis splicing, via spliceosome
2. P	GO:0021591	ventricular system development
2. P	GO:0060271	cilium assembly
2. P	GO:0030991	intraciliary transport particle A
2. P	GO:0097546	ciliary base
2. P	GO:0071007	U2-type catalytic step 2 spliceosome
2. P	GO:0097499	protein localization to non-motile cilium
2. P	GO:0031514	motile cilium
2. P	GO:1905198	manchette assembly
2. P	GO:0005813	centrosome
2. P	GO:0120170	intraciliary transport particle B binding
2. P	GO:0039023	pronephric duct morphogenesis
2. P	GO:0035845	photoreceptor cell outer segment organization
2. P	GO:0042073	intraciliary transport
2. P	GO:0015031	protein transport
2. P	GO:0009314	response to radiation
2. P	GO:0060020	Bergmann glial cell differentiation
2. P	GO:0030990	intraciliary transport particle
2. P	GO:0045842	positive regulation of mitotic metaphase/anaphase transition
2. P	GO:0043240	Fanconi anaemia nuclear complex
2. P	GO:0035735	intraciliary transport involved in cilium assembly
2. P	GO:0005680	anaphase-promoting complex
2. P	GO:0006974	cellular response to DNA damage stimulus
2. P	GO:0036064	ciliary basal body
2. P	GO:0007224	smoothened signaling pathway
2. P	GO:0031145	anaphase-promoting complex-dependent catabolic process
2. P	GO:0005929	cilium
2. P	GO:0097542	ciliary tip
2. P	GO:1903999	negative regulation of eating behavior
2. P	GO:0005721	pericentric heterochromatin
2. P	GO:0000974	Prp19 complex
2. P	GO:0046530	photoreceptor cell differentiation
2. P	GO:0036297	interstrand cross-link repair
2. P	GO:0030900	forebrain development
2. P	GO:0021702	cerebellar Purkinje cell differentiation
2. P	GO:0005516	calmodulin binding
2. P	GO:0071004	U2-type prespliceosome
2. P	GO:0008594	photoreceptor cell morphogenesis
3. B	GO:0030433	ubiquitin-dependent ERAD pathway
3. B	GO:0031072	heat shock protein binding
3. B	GO:0005829	cytosol
3. B	GO:0016020	membrane
3. B	GO:0060090	molecular adaptor activity
3. B	GO:0016787	hydrolase activity
3. B	GO:0072380	TRC complex
3. B	GO:0007338	single fertilization
3. B	GO:0070286	axonemal dynein complex assembly
3. B	GO:0006620	posttranslational protein targeting to endoplasmic reticulum membrane
3. B	GO:0006626	protein targeting to mitochondrion
3. B	GO:0005788	endoplasmic reticulum lumen
3. B	GO:0006986	response to unfolded protein
3. B	GO:0005741	mitochondrial outer membrane
3. B	GO:0045335	phagocytic vesicle
3. B	GO:1903646	positive regulation of chaperone-mediated protein folding

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	A8MYJ7	Tetratricopeptide repeat protein 34	0	8.84e-133	0.0
1. PB	Q8C0Q3	Tetratricopeptide repeat protein 34	0.00e+00	8.66e-33	0.0
1. PB	Q5PPS5	Tetratricopeptide repeat protein 34	0.00e+00	1.11e-24	2.23e-166
2. P	Q5PR66	Intraflagellar transport protein 56	2.40e-09	6.53e-04	NA
2. P	P87312	Pre-mRNA-splicing factor cwf4	5.46e-08	2.10e-02	NA
2. P	Q8BS45	Intraflagellar transport protein 56	9.64e-10	2.96e-04	NA
2. P	Q5U2N8	Intraflagellar transport protein 56	8.55e-10	3.54e-04	NA
2. P	Q9EQR6	Fanconi anemia group G protein homolog	5.86e-08	2.89e-03	NA
2. P	Q8C159	Tetratricopeptide repeat protein 22	2.49e-08	1.13e-02	NA
2. P	Q66GN3	Protein NPGR2	1.72e-07	5.59e-04	NA
2. P	A4III8	Intraflagellar transport protein 56	1.58e-09	6.66e-04	NA
2. P	A0AVF1	Intraflagellar transport protein 56	1.38e-09	1.84e-04	NA
2. P	Q57ZL2	Intraflagellar transport protein 56 homolog	5.22e-07	1.40e-02	NA
2. P	P41889	Anaphase-promoting complex subunit cut9	2.57e-08	1.40e-02	NA
2. P	Q0HA38	Tetratricopeptide repeat protein 21B	8.40e-07	1.04e-02	NA
2. P	O15287	Fanconi anemia group G protein	1.45e-08	9.26e-04	NA
2. P	A8JA42	Intraflagellar transport protein 56	1.26e-09	1.38e-04	NA
2. P	Q9CB03	Protein NPGR1	3.74e-07	2.75e-02	NA
2. P	Q4R7Z9	Intraflagellar transport protein 56	1.95e-09	7.60e-05	NA
3. B	Q15785	Mitochondrial import receptor subunit TOM34	1.51e-06	NA	0.013
3. B	Q07617	Sperm-associated antigen 1	1.96e-05	NA	0.035
3. B	Q54VG4	Small glutamine-rich tetratricopeptide repeat-containing protein	1.49e-03	NA	0.001
3. B	Q54M21	DnaJ homolog subfamily C member 3 homolog	2.48e-09	NA	0.022
3. B	A4K2V0	Mitochondrial import receptor subunit TOM34	7.50e-07	NA	0.010
3. B	Q80ZX8	Sperm-associated antigen 1	7.24e-05	NA	0.020