Summary

A8MZA4

Homolog: Q8N7Z2.
Function: Golgin subfamily A member 6-like protein 1.

Statistics

Total GO Annotation: 155
Unique PROST Go: 55
Unique BLAST Go: 85

Total Homologs: 100
Unique PROST Homologs: 65
Unique BLAST Homologs: 23

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q8N7Z2 (Golgin subfamily A member 6-like protein 1) with a FATCAT P-Value: 0.0 and RMSD of 5.61 angstrom. The sequence alignment identity is 85.1%.
Structural alignment shown in left. Query protein A8MZA4 colored as red in alignment, homolog Q8N7Z2 colored as blue. Query protein A8MZA4 is also shown in right top, homolog Q8N7Z2 showed in right bottom. They are colored based on secondary structures. 

  A8MZA4 MLMWPQ------------PHLPTHPHLPTHPHLPTHPHLPTHPHLPTHPMMSKETRQSKLAEAKEQLTDHHPQTNPSVGTAASDTKKKKINNGTNPETTT 88
  Q8N7Z2 MLMWPQPHLPTHPHLPTHPHLPTHPHLPTHPHLPTHPHLPTHPHLPTHPMMSKETRQSKLAEAKEQLTDHHPQTNPSVGTAASDTKKKKINNGTNPETTT 100

  A8MZA4 SGGCHSPEDEQKASHQHQEALRRELEAQVHTIRILTCQKTELQMALYYSQHAVKQLEGEARDLISRLHDSWKFAGELEQALSAVATQKKKADRYIEELTK 188
  Q8N7Z2 SGGCHSPEDEQKASHQHQEALRRELEAQVHTIRILTCQKTELQMALYYSQHAVKQLEGEARDLISRLHDSWKFAGELEQALSAVATQKKKADRYIEELTK 200

  A8MZA4 ERDALSLELYRNTITDEELKEKNAELQEKLQLVESEKSEIQLNVKELKRKLERAKLLLPQQQLQAEADHLGKELQSVSAKLQAQVEENELWNRLNQQQEE 288
  Q8N7Z2 ERDALSLELYRNTITDEELKEKNAKLQEKLQLVESEKSEIQLNVKELKRKLERAKLLLPQQQLQAEADHLGKELQSVSAKLQAQVEENELWNRLNQQQEE 300

  A8MZA4 KMWRQEEKIQEWEEKIQEQEEKIREQEEKIREQEEKMRRQEEMMWEKEEKMRRQEEMMWEKEEKMRRQEEMMWEKEEKIRELEEKMHEQEKIREQEEKRQ 388
  Q8N7Z2 KMWRQEEKIQEWEEKIQEQEEKIREQEEKIREQEEKMRRQEEMMWEKEEKMRRQEEMMWEKEEKMRRLEEMMWEKEEKIRELEEKMHEQEKIREQEEKRQ 400

  A8MZA4 EEEKIREQEKRQEQEAKMWRQEEKIREQEEKIREQEKKMWRQEEKIHEQEKIREEEKRQEQEEMWRQEEKIREQEEIWRQKEKMHEQEEKIRKQEEKVWR 488
  Q8N7Z2 EEEKIREQEKRQEQEAKMWRQEEKIREQEEKIREQEKKMWRQEEKIHEQEKIREEEKRQEQEEMWRQEEKIREQEEIWRQKEKMHEQ-EKIRKQEEKVWR 499

  A8MZA4 QEEKIREQEEKIREQEEKMWRQEEKIREQEEMWREEEKMHEQEKIWEEEKRQEQEDKMWRQEEKIREQEEKVWRQEEKIREQEEKRQEQEEKMWKQEEKI 588
  Q8N7Z2 QEEKMHDQEEKIREQEEKMWRQEEKIRE--------------------------------QEEKIRE-------QEEKIREQEEMMQEQEEKMGEQEEKM 560

  A8MZA4 REQEEKIREQEEKIREQEEKIREQEEMTQEQEEKMGEQEEKMCEQEEKMQEQEETMWRQEEKIREQEKKIREQEEKIREQEEMMQEQEEKMWEQEEKMCE 688
  Q8N7Z2 QEQ-EKMRRQEEKIREQEEKIREQ---------K--------------------------EKIREQEEKIWEQEEKIREQEEMMQEQEEKMWEQEEKMCE 624

  A8MZA4 QEEKMQEQEEKMRRQEEKMWEQEVRLRQQEEKMQEH-------- 724
  Q8N7Z2 QEEKMQEQEEKMRRQEEKMWEQEVRLRQQEEKMQEHQEHLEAAI 668

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0061676 importin-alpha family protein binding
1. PB GO:0007020 microtubule nucleation
1. PB GO:0051645 Golgi localization
1. PB GO:0050772 positive regulation of axonogenesis
1. PB GO:0060050 positive regulation of protein glycosylation
1. PB GO:0032580 Golgi cisterna membrane
1. PB GO:0090161 Golgi ribbon formation
1. PB GO:0008356 asymmetric cell division
1. PB GO:0031514 motile cilium
1. PB GO:0090306 meiotic spindle assembly
1. PB GO:0090166 Golgi disassembly
1. PB GO:0007030 Golgi organization
1. PB GO:0000137 Golgi cis cisterna
1. PB GO:0005801 cis-Golgi network
1. PB GO:0020016 ciliary pocket
2. P GO:0001227 DNA-binding transcription repressor activity, RNA polymerase II-specific
2. P GO:0035082 axoneme assembly
2. P GO:0001515 opioid peptide activity
2. P GO:0030216 keratinocyte differentiation
2. P GO:0000122 negative regulation of transcription by RNA polymerase II
2. P GO:0030430 host cell cytoplasm
2. P GO:0007530 sex determination
2. P GO:0044162 host cell cytoplasmic vesicle membrane
2. P GO:0045948 positive regulation of translational initiation
2. P GO:0006325 chromatin organization
2. P GO:0030238 male sex determination
2. P GO:0030016 myofibril
2. P GO:0045109 intermediate filament organization
2. P GO:0033150 cytoskeletal calyx
2. P GO:0005540 hyaluronic acid binding
2. P GO:0005576 extracellular region
2. P GO:0005634 nucleus
2. P GO:0009653 anatomical structure morphogenesis
2. P GO:0031012 extracellular matrix
2. P GO:0070935 3'-UTR-mediated mRNA stabilization
2. P GO:1901098 positive regulation of autophagosome maturation
2. P GO:0032982 myosin filament
2. P GO:0042461 photoreceptor cell development
2. P GO:0005516 calmodulin binding
2. P GO:0016459 myosin complex
2. P GO:0042255 ribosome assembly
2. P GO:0000785 chromatin
2. P GO:0003730 mRNA 3'-UTR binding
2. P GO:0008301 DNA binding, bending
2. P GO:0001533 cornified envelope
2. P GO:0018149 peptide cross-linking
2. P GO:0003682 chromatin binding
2. P GO:0007420 brain development
2. P GO:0030154 cell differentiation
2. P GO:0006357 regulation of transcription by RNA polymerase II
2. P GO:0031492 nucleosomal DNA binding
2. P GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
2. P GO:0005200 structural constituent of cytoskeleton
2. P GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
2. P GO:0007283 spermatogenesis
2. P GO:0031424 keratinization
2. P GO:0016298 lipase activity
2. P GO:0098792 xenophagy
2. P GO:0032391 photoreceptor connecting cilium
2. P GO:0044164 host cell cytosol
2. P GO:0007288 sperm axoneme assembly
2. P GO:0010628 positive regulation of gene expression
2. P GO:0032991 protein-containing complex
2. P GO:0051092 positive regulation of NF-kappaB transcription factor activity
2. P GO:0097228 sperm principal piece
2. P GO:0008494 translation activator activity
2. P GO:0010224 response to UV-B
2. P GO:0016607 nuclear speck
2. P GO:0007548 sex differentiation
2. P GO:0070307 lens fiber cell development
3. B GO:1990535 neuron projection maintenance
3. B GO:0016234 inclusion body
3. B GO:0046007 negative regulation of activated T cell proliferation
3. B GO:0010737 protein kinase A signaling
3. B GO:0035584 calcium-mediated signaling using intracellular calcium source
3. B GO:0005874 microtubule
3. B GO:0090314 positive regulation of protein targeting to membrane
3. B GO:0071280 cellular response to copper ion
3. B GO:0150001 primary dendrite
3. B GO:1901588 dendritic microtubule
3. B GO:0045859 regulation of protein kinase activity
3. B GO:0031674 I band
3. B GO:0006941 striated muscle contraction
3. B GO:0048156 tau protein binding
3. B GO:1903136 cuprous ion binding
3. B GO:0032700 negative regulation of interleukin-17 production
3. B GO:1900449 regulation of glutamate receptor signaling pathway
3. B GO:0043083 synaptic cleft
3. B GO:0050860 negative regulation of T cell receptor signaling pathway
3. B GO:0008307 structural constituent of muscle
3. B GO:0007076 mitotic chromosome condensation
3. B GO:0072686 mitotic spindle
3. B GO:0030134 COPII-coated ER to Golgi transport vesicle
3. B GO:0051371 muscle alpha-actinin binding
3. B GO:0019828 aspartic-type endopeptidase inhibitor activity
3. B GO:0006486 protein glycosylation
3. B GO:1905664 regulation of calcium ion import across plasma membrane
3. B GO:0032091 negative regulation of protein binding
3. B GO:0008306 associative learning
3. B GO:0031430 M band
3. B GO:0044877 protein-containing complex binding
3. B GO:0055008 cardiac muscle tissue morphogenesis
3. B GO:0032435 negative regulation of proteasomal ubiquitin-dependent protein catabolic process
3. B GO:0008017 microtubule binding
3. B GO:0043194 axon initial segment
3. B GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport
3. B GO:0031114 regulation of microtubule depolymerization
3. B GO:0005539 glycosaminoglycan binding
3. B GO:0030240 skeletal muscle thin filament assembly
3. B GO:0090307 mitotic spindle assembly
3. B GO:0042805 actinin binding
3. B GO:1902951 negative regulation of dendritic spine maintenance
3. B GO:0033116 endoplasmic reticulum-Golgi intermediate compartment membrane
3. B GO:0003300 cardiac muscle hypertrophy
3. B GO:0099642 retrograde axonal protein transport
3. B GO:0098737 protein insertion into plasma membrane
3. B GO:0097493 structural molecule activity conferring elasticity
3. B GO:0050882 voluntary musculoskeletal movement
3. B GO:0031433 telethonin binding
3. B GO:1904646 cellular response to amyloid-beta
3. B GO:0055013 cardiac muscle cell development
3. B GO:0032689 negative regulation of interferon-gamma production
3. B GO:0070050 neuron cellular homeostasis
3. B GO:0032703 negative regulation of interleukin-2 production
3. B GO:0051289 protein homotetramerization
3. B GO:0044307 dendritic branch
3. B GO:0099641 anterograde axonal protein transport
3. B GO:0031802 type 5 metabotropic glutamate receptor binding
3. B GO:0048769 sarcomerogenesis
3. B GO:0010507 negative regulation of autophagy
3. B GO:0070885 negative regulation of calcineurin-NFAT signaling cascade
3. B GO:0002020 protease binding
3. B GO:0007098 centrosome cycle
3. B GO:0019901 protein kinase binding
3. B GO:0060048 cardiac muscle contraction
3. B GO:0000922 spindle pole
3. B GO:0005794 Golgi apparatus
3. B GO:0055003 cardiac myofibril assembly
3. B GO:0043025 neuronal cell body
3. B GO:2000010 positive regulation of protein localization to cell surface
3. B GO:1903135 cupric ion binding
3. B GO:0030241 skeletal muscle myosin thick filament assembly
3. B GO:0005865 striated muscle thin filament
3. B GO:0090647 modulation of age-related behavioral decline
3. B GO:1901379 regulation of potassium ion transmembrane transport
3. B GO:0061098 positive regulation of protein tyrosine kinase activity
3. B GO:1902938 regulation of intracellular calcium activated chloride channel activity
3. B GO:0035995 detection of muscle stretch
3. B GO:1903829 positive regulation of protein localization
3. B GO:1902817 negative regulation of protein localization to microtubule
3. B GO:0008093 cytoskeletal anchor activity
3. B GO:0019905 syntaxin binding
3. B GO:1902430 negative regulation of amyloid-beta formation
3. B GO:0042802 identical protein binding
3. B GO:0051225 spindle assembly

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q9NYA3 Golgin subfamily A member 6A 7.16e-06 4.57e-03 1.46e-29
1. PB A6NEY3 Putative golgin subfamily A member 6-like protein 3 2.72e-07 2.47e-09 2.60e-06
1. PB Q8N9W4 Golgin subfamily A member 6-like protein 2 2.01e-05 2.03e-14 1.15e-136
1. PB H0YM25 Golgin subfamily A member 6-like protein 22 2.39e-13 1.46e-50 0.0
1. PB Q62839 Golgin subfamily A member 2 4.17e-08 3.29e-02 1.77e-33
1. PB Q8N7Z2 Golgin subfamily A member 6-like protein 1 0.00e+00 1.12e-71 0.0
1. PB Q585H6 Flagellar attachment zone protein 1 4.32e-04 4.39e-03 1.51e-04
1. PB A0A1B0GV03 Golgin subfamily A member 6-like protein 7 1.08e-10 1.03e-13 1.38e-107
1. PB A6NEM1 Golgin subfamily A member 6-like protein 9 8.57e-07 8.56e-03 7.07e-08
1. PB A6NDN3 Golgin subfamily A member 6B 1.94e-06 5.49e-03 4.70e-28
1. PB A6NDK9 Golgin subfamily A member 6C 1.43e-06 1.59e-03 8.95e-29
1. PB A8MZA4 Golgin subfamily A member 6-like protein 6 0 7.25e-155 0.0
2. P Q05738 Sex-determining region Y protein 5.87e-04 1.39e-06 NA
2. P Q08696 Axoneme-associated protein mst101(2) 2.93e-06 2.02e-03 NA
2. P P02895 Glycophorin-binding protein 5.51e-01 1.16e-05 NA
2. P Q9JL35 High mobility group nucleosome-binding domain-containing protein 5 7.54e-01 4.79e-04 NA
2. P Q62563 Sex-determining region Y protein 1.01e-01 1.03e-04 NA
2. P Q02171 Paramyosin 9.64e-10 3.32e-02 NA
2. P P26371 Keratin-associated protein 5-9 9.94e-01 5.46e-04 NA
2. P Q9H321 Variable charge X-linked protein 3B 6.63e-01 1.78e-10 NA
2. P P21850 [D-Ala2]-deltorphins 8.93e-01 4.04e-03 NA
2. P Q5SRN2 Testis-expressed basic protein 1 2.58e-01 6.69e-05 NA
2. P Q8N4W9 Zinc finger protein 808 8.22e-01 7.00e-03 NA
2. P Q95WA4 Spore wall protein 2 1.50e-02 5.04e-07 NA
2. P Q9H320 Variable charge X-linked protein 1 7.85e-01 2.94e-06 NA
2. P P06680 Acidic proline-rich protein HP43A 6.39e-01 1.67e-03 NA
2. P P17941 Involucrin 4.22e-05 3.91e-02 NA
2. P Q4ZJZ3 Protease inhibitor Egf1.5a NA 4.55e-02 NA
2. P Q9H7R5 Zinc finger protein 665 7.71e-01 2.25e-02 NA
2. P Q26264 41 kDa spicule matrix protein 9.84e-01 4.30e-02 NA
2. P Q06002 Filensin 1.26e-06 2.01e-05 NA
2. P B4F777 High mobility group nucleosome-binding domain-containing protein 5 9.11e-01 2.25e-04 NA
2. P P0DJ89 Secreted effector protein EspF(U) 5.08e-01 2.44e-03 NA
2. P Q01202 Paramyosin 2.92e-09 3.13e-02 NA
2. P P82970 High mobility group nucleosome-binding domain-containing protein 5 8.13e-01 7.81e-06 NA
2. P Q27409 Adhesive plaque matrix protein 9.83e-01 3.03e-03 NA
2. P D3YU32 Testis-expressed protein 13C-1 3.12e-02 1.93e-04 NA
2. P P24709 Involucrin 1.50e-04 6.84e-05 NA
2. P Q28092 Cylicin-2 7.96e-01 3.80e-02 NA
2. P Q8N660 Neuroblastoma breakpoint family member 15 5.08e-03 2.94e-03 NA
2. P P0DJ88 Secreted effector protein EspF(U) 6.71e-01 2.44e-03 NA
2. P P24712 Involucrin 1.15e-05 1.28e-02 NA
2. P A2A6M5 Calcium-binding and coiled-coil domain-containing protein 2 4.53e-04 1.80e-03 NA
2. P Q01033 Uncharacterized gene 48 protein NA 1.19e-02 NA
2. P Q2GIB5 SUMOylated effector protein AmpA 9.33e-01 1.47e-03 NA
2. P Q68FX6 Calcium-binding and spermatid-specific protein 1 9.26e-01 3.98e-02 NA
2. P Q13117 Deleted in azoospermia protein 2 9.74e-01 9.61e-05 NA
2. P Q9H094 Neuroblastoma breakpoint family member 3 4.80e-03 4.91e-05 NA
2. P A0A0J9YY54 Testis-expressed protein 13D 4.54e-02 1.03e-04 NA
2. P F8W0I5 Nuclear pore complex-interacting protein family member B12 5.09e-01 8.22e-03 NA
2. P Q4A0V8 Uro-adherence factor A 9.94e-01 5.32e-06 NA
2. P Q14093 Cylicin-2 8.04e-01 5.72e-03 NA
2. P Q8X482 Secreted effector protein EspF(U) NA 1.35e-02 NA
2. P P07898 Aggrecan core protein 9.99e-01 3.23e-02 NA
2. P Q06RB0 30S ribosomal protein S18, chloroplastic 1.13e-03 7.22e-04 NA
2. P Q66HF9 Leucine-rich repeat flightless-interacting protein 1 5.67e-03 1.29e-03 NA
2. P P11994 50 kDa spicule matrix protein 9.81e-01 7.22e-03 NA
2. P Q26005 Ring-infected erythrocyte surface antigen (Fragment) 4.80e-05 2.18e-07 NA
2. P P51814 Zinc finger protein 41 3.01e-01 6.66e-03 NA
2. P Q8IWN7 Retinitis pigmentosa 1-like 1 protein 9.75e-01 1.89e-02 NA
2. P P13813 110 kDa antigen (Fragment) 2.67e-03 2.04e-04 NA
2. P Q9NNX9 Variable charge X-linked protein 3 5.69e-01 3.87e-02 NA
2. P Q49537 Variant surface antigen E 9.52e-01 1.01e-02 NA
2. P Q8N972 Zinc finger protein 709 9.44e-01 2.79e-03 NA
2. P Q4V348 Zinc finger protein 658B 9.27e-01 2.53e-02 NA
2. P Q62565 Sex-determining region Y protein 1.74e-02 6.54e-05 NA
2. P Q5MJ10 Sperm protein associated with the nucleus on the X chromosome N2 4.13e-01 4.09e-05 NA
2. P P05422 Dermorphin-1 7.41e-01 4.79e-04 NA
2. P Q54CY3 Putative uncharacterized protein DDB_G0292636 1.39e-01 3.57e-03 NA
2. P Q3UZ39 Leucine-rich repeat flightless-interacting protein 1 2.41e-03 8.31e-03 NA
2. P Q8I6U8 Glycophorin-binding protein 9.46e-01 4.84e-04 NA
2. P C6UYI3 Secreted effector protein EspF(U) 6.21e-01 2.44e-03 NA
2. P Q55EQ3 Uncharacterized abhydrolase domain-containing protein DDB_G0269086 1.42e-05 2.31e-03 NA
2. P Q9NR90 Deleted in azoospermia protein 3 9.84e-01 3.16e-03 NA
2. P Q8N823 Zinc finger protein 611 7.69e-01 3.35e-02 NA
2. P A0A1B0GUY1 MARCO-like protein 9.63e-01 8.68e-05 NA
2. P Q8IXT5 RNA-binding protein 12B 9.93e-01 4.62e-03 NA
3. B Q8WZ42 Titin NA NA 0.008
3. B I6L899 Golgin subfamily A member 8R 3.34e-07 NA 2.93e-07
3. B A6NEF3 Golgin subfamily A member 6-like protein 4 7.33e-07 NA 5.66e-07
3. B F8WBI6 Golgin subfamily A member 8N 2.25e-07 NA 2.11e-07
3. B Q08379 Golgin subfamily A member 2 3.59e-08 NA 3.81e-39
3. B A6NI86 Golgin subfamily A member 6-like protein 10 2.01e-08 NA 1.15e-07
3. B H3BV12 Golgin subfamily A member 8Q 2.40e-07 NA 2.30e-07
3. B P0CG33 Golgin subfamily A member 6D 4.35e-09 NA 2.31e-28
3. B H3BPF8 Golgin subfamily A member 8S 4.34e-08 NA 4.17e-15
3. B A6NN73 Golgin subfamily A member 8C 7.63e-08 NA 2.12e-15
3. B A8MQT2 Golgin subfamily A member 8B 1.60e-08 NA 1.79e-08
3. B C9ZN16 Flagellar attachment zone protein 1 1.66e-02 NA 0.002
3. B P27177 Major prion protein homolog 1.84e-01 NA 0.008
3. B D6RF30 Golgin subfamily A member 8K 1.56e-07 NA 5.76e-04
3. B H3BQL2 Golgin subfamily A member 8T 4.49e-08 NA 1.94e-05
3. B A6NCC3 Golgin subfamily A member 8O 1.19e-07 NA 2.19e-07
3. B P78559 Microtubule-associated protein 1A NA NA 4.48e-08
3. B A7E2F4 Golgin subfamily A member 8A 5.78e-08 NA 2.78e-05
3. B H0YKK7 Putative golgin subfamily A member 6-like protein 19 8.14e-09 NA 1.14e-07
3. B A6NC78 Putative golgin subfamily A member 8I 1.11e-08 NA 8.89e-06
3. B Q54G05 Putative leucine-rich repeat-containing protein DDB_G0290503 2.96e-06 NA 0.006
3. B Q921M4 Golgin subfamily A member 2 2.01e-09 NA 4.37e-33
3. B P0CJ92 Golgin subfamily A member 8H 1.22e-07 NA 0.005