Summary

B1ANH7

Homolog: P0DO92.
Function: Putative protein T-ENOL.

Statistics

Total GO Annotation: 16
Unique PROST Go: 16
Unique BLAST Go: 0

Total Homologs: 25
Unique PROST Homologs: 24
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was P0DO92 (Putative protein T-ENOL) with a FATCAT P-Value: 0.00821 and RMSD of 1.44 angstrom. The sequence alignment identity is 17.8%.
Structural alignment shown in left. Query protein B1ANH7 colored as red in alignment, homolog P0DO92 colored as blue. Query protein B1ANH7 is also shown in right top, homolog P0DO92 showed in right bottom. They are colored based on secondary structures. 

  B1ANH7 MTYPPHRAFSRSDVPYPLLSSPV-QWPLSLVVGDTSTRWPQQPSALESDCPGPSHPCLAGLLGPMHPVDIPLSTALHSKHQRRLTQ--CVLMVQSPSKQR 97
  P0DO92 -----------------MASTPMGN------EGEKKSSWPSQ-AA-------PS---LRG--GP---------ASL-SRSEEYLSQISAELM------EE 48

  B1ANH7 SL-----YL----LNKKIPHDA------------- 110
  P0DO92 ALCTACCHLNPVPIKKKQSQDQATQISKRAFFTKT 83

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0042025 host cell nucleus
2. P GO:0033650 host cell mitochondrion
2. P GO:0004402 histone acetyltransferase activity
2. P GO:0033644 host cell membrane
2. P GO:0050832 defense response to fungus
2. P GO:0030430 host cell cytoplasm
2. P GO:0031640 killing of cells of another organism
2. P GO:0000282 cellular bud site selection
2. P GO:0039652 induction by virus of host NF-kappaB cascade
2. P GO:0039592 suppression by virus of G2/M transition of host mitotic cell cycle
2. P GO:0010484 H3 histone acetyltransferase activity
2. P GO:0016573 histone acetylation
2. P GO:0019079 viral genome replication
2. P GO:0050830 defense response to Gram-positive bacterium
2. P GO:0050829 defense response to Gram-negative bacterium
2. P GO:0042393 histone binding

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB B1ANH7 Putative uncharacterized protein IBA57-DT 0 2.21e-156 1.31e-75
2. P Q2LKX9 Ixosin 2.41e-01 2.09e-02 NA
2. P P0C5R2 Putative uncharacterized protein YOR072W-A 4.08e-01 3.81e-03 NA
2. P Q64902 Protein X NA 4.84e-02 NA
2. P Q8N7H1 Putative uncharacterized protein encoded by LINC01465 2.32e-01 2.88e-03 NA
2. P P22440 Protein VP5 NA 1.63e-03 NA
2. P Q99339 Putative UPF0320 protein YLL065W 1.83e-01 4.13e-03 NA
2. P P14723 Uncharacterized 16 kDa protein in middle repetitive insertion sequence WIS1 2.41e-01 3.31e-05 NA
2. P P9WKY4 Histone acetyltransferase 7.40e-01 5.57e-03 NA
2. P Q89544 Uncharacterized protein DR5 NA 1.08e-03 NA
2. P Q494R0 Putative uncharacterized protein FBXL19-AS1 1.80e-01 7.74e-04 NA
2. P P36030 Putative UPF0320 protein YKL225W 2.86e-02 3.36e-03 NA
2. P P15973 Putative per-hexamer repeat protein 1 1.65e-01 1.57e-02 NA
2. P Q08922 Putative uncharacterized protein YPL182C 3.57e-01 1.99e-02 NA
2. P P19283 Uncharacterized 10.0 kDa protein NA 1.65e-02 NA
2. P O94143 Putative uncharacterized protein BUD19 2.84e-02 5.34e-03 NA
2. P P47188 Putative UPF0320 protein YJR162C 1.19e-01 2.91e-08 NA
2. P P56555 Down syndrome critical region protein 4 1.55e-01 1.38e-03 NA
2. P O13530 Putative uncharacterized protein YLR198C 5.50e-02 1.12e-04 NA
2. P Q9C111 Uncharacterized protein C343.20 2.25e-02 1.70e-02 NA
2. P O76042 Putative uncharacterized protein encoded by ERC2-IT1 4.96e-02 3.46e-02 NA
2. P P0DO92 Putative protein T-ENOL 8.21e-03 2.00e-03 NA
2. P P0C0V2 UPF0320 protein YER188C-A 1.16e-01 3.57e-04 NA
2. P P0C751 Protein VP5 NA 1.31e-04 NA
2. P P9WKY5 Histone acetyltransferase 7.01e-01 5.57e-03 NA