Summary

B1ANS9

Homolog: Q9D565.
Function: WD repeat-containing protein 64.

Statistics

Total GO Annotation: 447
Unique PROST Go: 71
Unique BLAST Go: 357

Total Homologs: 376
Unique PROST Homologs: 36
Unique BLAST Homologs: 323

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q9D565 (WD repeat-containing protein 64) with a FATCAT P-Value: 0.0 and RMSD of 3.87 angstrom. The sequence alignment identity is 80.0%.
Structural alignment shown in left. Query protein B1ANS9 colored as red in alignment, homolog Q9D565 colored as blue. Query protein B1ANS9 is also shown in right top, homolog Q9D565 showed in right bottom. They are colored based on secondary structures. 

  B1ANS9 MDIRKEKRLNMALQMSNFKKALNRFEKLVEQTAAQKRDERAGLFIHKEDAIGYDKFYASVQKLFGPDVKNQDVKRFYRKLCNNTDASADWCEIFGYFSSE 100
  Q9D565 MDAKDEKRFNLALQINNFKASLVEFNKLVEQTTAQKKEERAGIFIPKEDSIDYDKFYTSVQQIFGPEVKNQDVKCFYRKLCNNPDAAFDWCEIFGYFSTD 100

  B1ANS9 EDPIASQLDEENLVFFVSRKRRILISGSRRRDVIKSIVKIPHLDLLITATQKGLITVFNNQDTSWITGCDYLLQLKRIVATTERTIIVWDYKAQGSSQEN 200
  Q9D565 EDSLTSQMDEENLVFLVSRKQRIVIAGSRRRDVIKCIVKVPQLDLLITASQKGLITVFNSQDTSWITGCDYLGQLKRIVATTERTIIVWDYKAQGSSQEH 200

  B1ANS9 YFVIKPMDHCLLCVCVVPLPDHLCRDDILLGDDGGFVNRFTVNSDDFGIKQAKSKRKLQNQVLDSKNFKSVKRKLHNDWVMKIRYISALNCFGSCSLDSN 300
  Q9D565 YFVIKPMDHCLLCVCVVPLPDQLCRDDILLGDDGGFVNKFTVSSDDFGLKQAKTKKKLQTQVLDSKNFKSVKRKLHNDWVMKIRYIPALNCFGSCSLDSV 300

  B1ANS9 HSLVLESLKRLEDNLPVREFSMPRGANTFCYCVKANVIVTGGDDKVIRLWHPNISTKPVGKLVGHMFSIAEIVTNEKDQHVVSLSSAKVFRVWDIQTLSL 400
  Q9D565 HSLVLESLKRLEDNLPVREFAMPRGANSFCYCGKANVIVTGGDDKVLRLWHPNISTKPVGKLVGHMFSITEIVSNEKEQHVISLSSAKVFRVWDIQTLSV 400

  B1ANS9 LQVFHDSQGGPGDMQIYSMIYDANHGMLITGSSVMDMYPLTRMIQDTKQVPHTHEREINVMLYNKYFHQVLTICSESIIRVWELETGLQVYQILEPHGFN 500
  Q9D565 LQVFHDSQGGPGDMQIYSMVYDANHGMLITGSGVIDMYPLTRMIQDTKQVPHTHEREVNVTLYNKYFHQVLTVCSESVIKVWELETGLQIYQILDPHGLS 500

  B1ANS9 TEVTSAAVDESGFLFATGAYNGTVRIWDFGSGQEMKVLPEGKDWKEDEHCLRRLIFLKAQEKHQQLVLALERNGTIKMIQGKEDDIYLMVIWELPDVVPF 600
  Q9D565 IELTCAAIDESGYLFATGAYNGTVKIWDFGSGQEMKMMPEGKDWVEEEHGLMRLFFLKPQVKQQHLILALERNGTIKIIQGKEDDIFLTVIWELPDAMPY 600

  B1ANS9 LQDGKHAVHLRMSTRDRNMAIPFPDVELIVERNFSQPTD-NPTMDLLRVNCIDLLQVEGYNLIAAGTLNGVIILWNFVTSTVKKVYRPEDCFTVNPDLHP 699
  Q9D565 LQYGSHIVHLKMSTKERTMAIPFPDVELIVQKT-SQQTNYSPIVD-VDVNCIDVFQTEGYNLIACGTTNGMIILWNFIAASVKEIYRPEDCFSTDPELDP 698

  B1ANS9 KHFKINDILFLFRTPECARRSSQDSICSSSQCESSKGPQSSKGSKQSIHDSEVKGEQTDVMVGKQQPMDKKHPGIANLP----EAQPPILVTAHEDGHLR 795
  Q9D565 KRFRINDIMFLFRSPECVRRSSQDSICSSTQCDSSKGPQSSKGSKQSIHDADVKGEHTD-MVGEQQSASRKQP----VPISFVEPQPPLLVSAHEDGHLR 793

  B1ANS9 LWTLEGRLLKDMLPFTKHSAISLTSLYTDSCTRILLAGNVEGHVILCNISSFLDPPHDEKKFKQLLSWRAHSLEIIQVIYVEEKQVVLTASIDGSVRLWH 895
  Q9D565 LWTLEGKLIKDMLPFTKHSAISLTSLYTDSCCRVLLAGNVEGHVILCSISSFMDPPHDEKKFKQLLSWRAHSLEIIQVIYVEEKQLVLTASIDGSVRIWN 893

  B1ANS9 ALNGHYCGYFGQRRLFELSQTRDFILPCDVTEYPIEIKEESKFTEK-QKYEYPLIFDREKWRKMSSVSLLFKRTPP-KAFEVEQDFKFFKSLSSPKIRRY 993
  Q9D565 STSGHYCGYFGQRRMFDLSQTSDFILPCDVNEYPIEIKEESKFTEKTQKYEYPLIFDRERWKKMSSMSLLFKR-PPLSPFEVQHDFKFFKSLSSPKIRRY 992

  B1ANS9 PLEGFVTENREAGIVFGSLPIYSISSPTSLRFLPLIGVEAQKDSSDGITGKKKGGH--VQREKAP------RRRSLKKNLVPQINLASSFFPAIPK 1081
  Q9D565 ALEGFLTENREAGIVFGSLPIYRVPSPTSLRFLPLIGSEVQRDSVEGVYMKKK--HDKVKREEAPEMTEGSRRKSLKRNLVPQINLASSFFPTTPK 1086

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0034388 Pwp2p-containing subcomplex of 90S preribosome
1. PB GO:0005815 microtubule organizing center
1. PB GO:0032040 small-subunit processome
1. PB GO:0005874 microtubule
1. PB GO:0015030 Cajal body
1. PB GO:0005764 lysosome
1. PB GO:0007026 negative regulation of microtubule depolymerization
1. PB GO:0035861 site of double-strand break
1. PB GO:0016567 protein ubiquitination
1. PB GO:1905168 positive regulation of double-strand break repair via homologous recombination
1. PB GO:0007212 dopamine receptor signaling pathway
1. PB GO:0070034 telomerase RNA binding
1. PB GO:0030496 midbody
1. PB GO:0005697 telomerase holoenzyme complex
1. PB GO:0031682 G-protein gamma-subunit binding
1. PB GO:0008017 microtubule binding
1. PB GO:0080008 Cul4-RING E3 ubiquitin ligase complex
1. PB GO:0000974 Prp19 complex
1. PB GO:0005730 nucleolus
2. P GO:0036126 sperm flagellum
2. P GO:0008277 regulation of G protein-coupled receptor signaling pathway
2. P GO:2000781 positive regulation of double-strand break repair
2. P GO:0098789 pre-mRNA cleavage required for polyadenylation
2. P GO:0008608 attachment of spindle microtubules to kinetochore
2. P GO:0051260 protein homooligomerization
2. P GO:0043614 multi-eIF complex
2. P GO:0007080 mitotic metaphase plate congression
2. P GO:0003824 catalytic activity
2. P GO:0046662 regulation of oviposition
2. P GO:0032203 telomere formation via telomerase
2. P GO:0071541 eukaryotic translation initiation factor 3 complex, eIF3m
2. P GO:0006378 mRNA polyadenylation
2. P GO:0003743 translation initiation factor activity
2. P GO:0032045 guanyl-nucleotide exchange factor complex
2. P GO:0005732 sno(s)RNA-containing ribonucleoprotein complex
2. P GO:0030688 preribosome, small subunit precursor
2. P GO:0033290 eukaryotic 48S preinitiation complex
2. P GO:0072686 mitotic spindle
2. P GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
2. P GO:1904851 positive regulation of establishment of protein localization to telomere
2. P GO:2001034 positive regulation of double-strand break repair via nonhomologous end joining
2. P GO:0031369 translation initiation factor binding
2. P GO:1903775 regulation of DNA double-strand break processing
2. P GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
2. P GO:0000472 endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
2. P GO:0009968 negative regulation of signal transduction
2. P GO:0001164 RNA polymerase I core promoter sequence-specific DNA binding
2. P GO:0000226 microtubule cytoskeleton organization
2. P GO:2001173 regulation of histone H2B conserved C-terminal lysine ubiquitination
2. P GO:0030686 90S preribosome
2. P GO:0005930 axoneme
2. P GO:0030515 snoRNA binding
2. P GO:0090666 scaRNA localization to Cajal body
2. P GO:0040012 regulation of locomotion
2. P GO:0045742 positive regulation of epidermal growth factor receptor signaling pathway
2. P GO:0000480 endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
2. P GO:0048487 beta-tubulin binding
2. P GO:1904867 protein localization to Cajal body
2. P GO:0007213 G protein-coupled acetylcholine receptor signaling pathway
2. P GO:0006413 translational initiation
2. P GO:0007059 chromosome segregation
2. P GO:0043014 alpha-tubulin binding
2. P GO:0071540 eukaryotic translation initiation factor 3 complex, eIF3e
2. P GO:0005852 eukaryotic translation initiation factor 3 complex
2. P GO:0005847 mRNA cleavage and polyadenylation specificity factor complex
2. P GO:0051973 positive regulation of telomerase activity
2. P GO:0030042 actin filament depolymerization
2. P GO:0003341 cilium movement
2. P GO:0032094 response to food
2. P GO:0016282 eukaryotic 43S preinitiation complex
2. P GO:0001181 RNA polymerase I general transcription initiation factor activity
2. P GO:0001732 formation of cytoplasmic translation initiation complex
2. P GO:0045739 positive regulation of DNA repair
2. P GO:0030317 flagellated sperm motility
2. P GO:0031514 motile cilium
2. P GO:0007004 telomere maintenance via telomerase
2. P GO:0030576 Cajal body organization
2. P GO:0007631 feeding behavior
2. P GO:0000028 ribosomal small subunit assembly
2. P GO:0043051 regulation of pharyngeal pumping
2. P GO:0010224 response to UV-B
2. P GO:0006360 transcription by RNA polymerase I
2. P GO:0030864 cortical actin cytoskeleton
2. P GO:0034337 RNA folding
2. P GO:0006361 transcription initiation from RNA polymerase I promoter
2. P GO:0050790 regulation of catalytic activity
2. P GO:0030836 positive regulation of actin filament depolymerization
2. P GO:0042802 identical protein binding
2. P GO:0006446 regulation of translational initiation
2. P GO:0090671 telomerase RNA localization to Cajal body
3. B GO:0048364 root development
3. B GO:1902510 regulation of apoptotic DNA fragmentation
3. B GO:0001570 vasculogenesis
3. B GO:0031932 TORC2 complex
3. B GO:0005770 late endosome
3. B GO:0090141 positive regulation of mitochondrial fission
3. B GO:0034450 ubiquitin-ubiquitin ligase activity
3. B GO:0045571 negative regulation of imaginal disc growth
3. B GO:0000244 spliceosomal tri-snRNP complex assembly
3. B GO:0008610 lipid biosynthetic process
3. B GO:0045862 positive regulation of proteolysis
3. B GO:0032794 GTPase activating protein binding
3. B GO:0005080 protein kinase C binding
3. B GO:0042800 histone methyltransferase activity (H3-K4 specific)
3. B GO:0047496 vesicle transport along microtubule
3. B GO:1901800 positive regulation of proteasomal protein catabolic process
3. B GO:2000543 positive regulation of gastrulation
3. B GO:0006884 cell volume homeostasis
3. B GO:0051013 microtubule severing
3. B GO:0046843 dorsal appendage formation
3. B GO:0030426 growth cone
3. B GO:0044877 protein-containing complex binding
3. B GO:0008340 determination of adult lifespan
3. B GO:0005576 extracellular region
3. B GO:0019903 protein phosphatase binding
3. B GO:0003431 growth plate cartilage chondrocyte development
3. B GO:0051343 positive regulation of cyclic-nucleotide phosphodiesterase activity
3. B GO:0009553 embryo sac development
3. B GO:0004842 ubiquitin-protein transferase activity
3. B GO:0016319 mushroom body development
3. B GO:1903467 negative regulation of mitotic DNA replication initiation
3. B GO:0007405 neuroblast proliferation
3. B GO:1990757 ubiquitin ligase activator activity
3. B GO:0043022 ribosome binding
3. B GO:0070016 armadillo repeat domain binding
3. B GO:0045722 positive regulation of gluconeogenesis
3. B GO:0035264 multicellular organism growth
3. B GO:1904668 positive regulation of ubiquitin protein ligase activity
3. B GO:0000185 obsolete activation of MAPKKK activity
3. B GO:0005869 dynactin complex
3. B GO:0043224 nuclear SCF ubiquitin ligase complex
3. B GO:0051301 cell division
3. B GO:0005524 ATP binding
3. B GO:0008247 1-alkyl-2-acetylglycerophosphocholine esterase complex
3. B GO:0007303 cytoplasmic transport, nurse cell to oocyte
3. B GO:0060256 regulation of flocculation
3. B GO:0016579 protein deubiquitination
3. B GO:0007634 optokinetic behavior
3. B GO:0034511 U3 snoRNA binding
3. B GO:0007283 spermatogenesis
3. B GO:0003735 structural constituent of ribosome
3. B GO:0019005 SCF ubiquitin ligase complex
3. B GO:0001650 fibrillar center
3. B GO:0043025 neuronal cell body
3. B GO:2000114 regulation of establishment of cell polarity
3. B GO:0061883 clathrin-dependent endocytosis involved in vitellogenesis
3. B GO:0070840 dynein complex binding
3. B GO:0046540 U4/U6 x U5 tri-snRNP complex
3. B GO:0005198 structural molecule activity
3. B GO:0005886 plasma membrane
3. B GO:0071005 U2-type precatalytic spliceosome
3. B GO:0000348 mRNA branch site recognition
3. B GO:0045879 negative regulation of smoothened signaling pathway
3. B GO:0005826 actomyosin contractile ring
3. B GO:0007482 haltere development
3. B GO:0072520 seminiferous tubule development
3. B GO:0031931 TORC1 complex
3. B GO:2001235 positive regulation of apoptotic signaling pathway
3. B GO:2001268 negative regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway
3. B GO:0051649 establishment of localization in cell
3. B GO:0002039 p53 binding
3. B GO:2000639 negative regulation of SREBP signaling pathway
3. B GO:0033147 negative regulation of intracellular estrogen receptor signaling pathway
3. B GO:0090181 regulation of cholesterol metabolic process
3. B GO:0051571 positive regulation of histone H3-K4 methylation
3. B GO:0005671 obsolete Ada2/Gcn5/Ada3 transcription activator complex
3. B GO:0033598 mammary gland epithelial cell proliferation
3. B GO:0008656 cysteine-type endopeptidase activator activity involved in apoptotic process
3. B GO:0006412 translation
3. B GO:0050765 negative regulation of phagocytosis
3. B GO:0035097 histone methyltransferase complex
3. B GO:0042753 positive regulation of circadian rhythm
3. B GO:0043547 positive regulation of GTPase activity
3. B GO:2000280 regulation of root development
3. B GO:0001198 negative regulation of mating-type specific transcription from RNA polymerase II promoter
3. B GO:0044665 MLL1/2 complex
3. B GO:0006367 transcription initiation from RNA polymerase II promoter
3. B GO:0008298 intracellular mRNA localization
3. B GO:0005654 nucleoplasm
3. B GO:0006886 intracellular protein transport
3. B GO:0016358 dendrite development
3. B GO:0048711 positive regulation of astrocyte differentiation
3. B GO:0000349 generation of catalytic spliceosome for first transesterification step
3. B GO:0005819 spindle
3. B GO:0036158 outer dynein arm assembly
3. B GO:0043130 ubiquitin binding
3. B GO:0030331 estrogen receptor binding
3. B GO:0010154 fruit development
3. B GO:0048814 regulation of dendrite morphogenesis
3. B GO:0048511 rhythmic process
3. B GO:0051383 kinetochore organization
3. B GO:0048142 germarium-derived cystoblast division
3. B GO:0005078 MAP-kinase scaffold activity
3. B GO:0071215 cellular response to abscisic acid stimulus
3. B GO:0019827 stem cell population maintenance
3. B GO:0031037 myosin II filament disassembly
3. B GO:0000209 protein polyubiquitination
3. B GO:0005834 heterotrimeric G-protein complex
3. B GO:0050679 positive regulation of epithelial cell proliferation
3. B GO:0048367 shoot system development
3. B GO:0030425 dendrite
3. B GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum
3. B GO:0006303 double-strand break repair via nonhomologous end joining
3. B GO:0003720 telomerase activity
3. B GO:0000375 RNA splicing, via transesterification reactions
3. B GO:0005634 nucleus
3. B GO:0000123 histone acetyltransferase complex
3. B GO:2000217 regulation of invasive growth in response to glucose limitation
3. B GO:0030473 nuclear migration along microtubule
3. B GO:0036064 ciliary basal body
3. B GO:0048527 lateral root development
3. B GO:0010629 negative regulation of gene expression
3. B GO:0010868 negative regulation of triglyceride biosynthetic process
3. B GO:0042052 rhabdomere development
3. B GO:0048383 mesectoderm development
3. B GO:0043143 regulation of translation by machinery localization
3. B GO:0001891 phagocytic cup
3. B GO:0007010 cytoskeleton organization
3. B GO:1903026 negative regulation of RNA polymerase II regulatory region sequence-specific DNA binding
3. B GO:0031592 centrosomal corona
3. B GO:0035064 methylated histone binding
3. B GO:0045014 carbon catabolite repression of transcription by glucose
3. B GO:0030335 positive regulation of cell migration
3. B GO:0005681 spliceosomal complex
3. B GO:0034504 protein localization to nucleus
3. B GO:0005516 calmodulin binding
3. B GO:0044114 development of symbiont in host
3. B GO:0003677 DNA binding
3. B GO:0048471 perinuclear region of cytoplasm
3. B GO:0051012 microtubule sliding
3. B GO:0030971 receptor tyrosine kinase binding
3. B GO:0043473 pigmentation
3. B GO:0070577 lysine-acetylated histone binding
3. B GO:0030157 pancreatic juice secretion
3. B GO:0008270 zinc ion binding
3. B GO:0097027 ubiquitin-protein transferase activator activity
3. B GO:0016905 myosin heavy chain kinase activity
3. B GO:0000722 telomere maintenance via recombination
3. B GO:0030507 spectrin binding
3. B GO:0000398 mRNA splicing, via spliceosome
3. B GO:0030178 negative regulation of Wnt signaling pathway
3. B GO:0071339 MLL1 complex
3. B GO:0005814 centriole
3. B GO:0007312 oocyte nucleus migration involved in oocyte dorsal/ventral axis specification
3. B GO:0007079 mitotic chromosome movement towards spindle pole
3. B GO:0032350 regulation of hormone metabolic process
3. B GO:2000574 obsolete regulation of microtubule motor activity
3. B GO:0030706 germarium-derived oocyte differentiation
3. B GO:0006278 RNA-dependent DNA biosynthetic process
3. B GO:0090049 regulation of cell migration involved in sprouting angiogenesis
3. B GO:0010826 negative regulation of centrosome duplication
3. B GO:0046716 muscle cell cellular homeostasis
3. B GO:0038026 reelin-mediated signaling pathway
3. B GO:1903378 positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway
3. B GO:1904115 axon cytoplasm
3. B GO:0010992 ubiquitin recycling
3. B GO:1903955 positive regulation of protein targeting to mitochondrion
3. B GO:0007294 germarium-derived oocyte fate determination
3. B GO:0071007 U2-type catalytic step 2 spliceosome
3. B GO:1903146 regulation of autophagy of mitochondrion
3. B GO:1900087 positive regulation of G1/S transition of mitotic cell cycle
3. B GO:0015630 microtubule cytoskeleton
3. B GO:0010118 stomatal movement
3. B GO:0005811 lipid droplet
3. B GO:0008352 katanin complex
3. B GO:0045827 negative regulation of isoprenoid metabolic process
3. B GO:0051299 centrosome separation
3. B GO:0016607 nuclear speck
3. B GO:0051726 regulation of cell cycle
3. B GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process
3. B GO:0010906 regulation of glucose metabolic process
3. B GO:0000776 kinetochore
3. B GO:0000077 DNA damage checkpoint signaling
3. B GO:0051443 positive regulation of ubiquitin-protein transferase activity
3. B GO:0043588 skin development
3. B GO:0005662 DNA replication factor A complex
3. B GO:0008013 beta-catenin binding
3. B GO:0005635 nuclear envelope
3. B GO:0042752 regulation of circadian rhythm
3. B GO:0071333 cellular response to glucose stimulus
3. B GO:0000002 mitochondrial genome maintenance
3. B GO:0043982 histone H4-K8 acetylation
3. B GO:0035591 signaling adaptor activity
3. B GO:0050772 positive regulation of axonogenesis
3. B GO:0008090 retrograde axonal transport
3. B GO:0016055 Wnt signaling pathway
3. B GO:0007369 gastrulation
3. B GO:0051434 BH3 domain binding
3. B GO:0005881 cytoplasmic microtubule
3. B GO:0003380 establishment or maintenance of cytoskeleton polarity involved in gastrulation
3. B GO:0001934 positive regulation of protein phosphorylation
3. B GO:0000245 spliceosomal complex assembly
3. B GO:0051898 negative regulation of protein kinase B signaling
3. B GO:0048705 skeletal system morphogenesis
3. B GO:0000132 establishment of mitotic spindle orientation
3. B GO:0051510 regulation of unidimensional cell growth
3. B GO:0043966 histone H3 acetylation
3. B GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
3. B GO:0048568 embryonic organ development
3. B GO:0030424 axon
3. B GO:0003690 double-stranded DNA binding
3. B GO:0048872 homeostasis of number of cells
3. B GO:1990716 axonemal central apparatus
3. B GO:0032091 negative regulation of protein binding
3. B GO:1901386 negative regulation of voltage-gated calcium channel activity
3. B GO:0016251 RNA polymerase II general transcription initiation factor activity
3. B GO:0036269 swimming behavior
3. B GO:0043519 regulation of myosin II filament organization
3. B GO:0044666 MLL3/4 complex
3. B GO:0030723 ovarian fusome organization
3. B GO:0042998 positive regulation of Golgi to plasma membrane protein transport
3. B GO:0007298 border follicle cell migration
3. B GO:0045741 positive regulation of epidermal growth factor-activated receptor activity
3. B GO:0007062 sister chromatid cohesion
3. B GO:0009991 response to extracellular stimulus
3. B GO:0031117 positive regulation of microtubule depolymerization
3. B GO:0006974 cellular response to DNA damage stimulus
3. B GO:0016559 peroxisome fission
3. B GO:0007338 single fertilization
3. B GO:0005929 cilium
3. B GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport
3. B GO:0061484 hematopoietic stem cell homeostasis
3. B GO:0072593 reactive oxygen species metabolic process
3. B GO:0001826 inner cell mass cell differentiation
3. B GO:0034396 negative regulation of transcription from RNA polymerase II promoter in response to iron
3. B GO:0005246 calcium channel regulator activity
3. B GO:0006891 intra-Golgi vesicle-mediated transport
3. B GO:1902525 regulation of protein monoubiquitination
3. B GO:0007165 signal transduction
3. B GO:0009867 jasmonic acid mediated signaling pathway
3. B GO:0005669 transcription factor TFIID complex
3. B GO:0007097 nuclear migration
3. B GO:0033276 transcription factor TFTC complex
3. B GO:0007019 microtubule depolymerization
3. B GO:0005737 cytoplasm
3. B GO:0001895 retina homeostasis
3. B GO:0007281 germ cell development
3. B GO:0070534 protein K63-linked ubiquitination
3. B GO:2001244 positive regulation of intrinsic apoptotic signaling pathway
3. B GO:0061630 ubiquitin protein ligase activity
3. B GO:0051642 centrosome localization
3. B GO:0043981 histone H4-K5 acetylation
3. B GO:0043005 neuron projection
3. B GO:0031616 spindle pole centrosome
3. B GO:0043568 positive regulation of insulin-like growth factor receptor signaling pathway
3. B GO:0030308 negative regulation of cell growth
3. B GO:0048854 brain morphogenesis
3. B GO:0031023 microtubule organizing center organization
3. B GO:0072499 photoreceptor cell axon guidance
3. B GO:0032880 regulation of protein localization
3. B GO:0000922 spindle pole
3. B GO:0007219 Notch signaling pathway
3. B GO:1900102 negative regulation of endoplasmic reticulum unfolded protein response
3. B GO:0061136 regulation of proteasomal protein catabolic process
3. B GO:1905392 plant organ morphogenesis
3. B GO:0030030 cell projection organization
3. B GO:2001205 negative regulation of osteoclast development
3. B GO:0048813 dendrite morphogenesis
3. B GO:0071013 catalytic step 2 spliceosome
3. B GO:0060590 ATPase regulator activity
3. B GO:0009845 seed germination
3. B GO:0045159 myosin II binding
3. B GO:0098930 axonal transport
3. B GO:0048188 Set1C/COMPASS complex
3. B GO:0044297 cell body
3. B GO:0008635 activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c
3. B GO:0071006 U2-type catalytic step 1 spliceosome
3. B GO:0005741 mitochondrial outer membrane
3. B GO:0048026 positive regulation of mRNA splicing, via spliceosome
3. B GO:0051225 spindle assembly
3. B GO:1902773 GTPase activator complex
3. B GO:0043984 histone H4-K16 acetylation
3. B GO:0051010 microtubule plus-end binding
3. B GO:0051020 GTPase binding
3. B GO:0051901 positive regulation of mitochondrial depolarization
3. B GO:1903341 regulation of meiotic DNA double-strand break formation
3. B GO:0030126 COPI vesicle coat
3. B GO:0034501 protein localization to kinetochore
3. B GO:0009967 positive regulation of signal transduction
3. B GO:0000437 carbon catabolite repression of transcription from RNA polymerase II promoter
3. B GO:1905803 negative regulation of cellular response to manganese ion
3. B GO:0090660 cerebrospinal fluid circulation
3. B GO:0051721 protein phosphatase 2A binding
3. B GO:0051568 histone H3-K4 methylation
3. B GO:0048920 posterior lateral line neuromast primordium migration
3. B GO:1903003 positive regulation of protein deubiquitination
3. B GO:0033137 negative regulation of peptidyl-serine phosphorylation
3. B GO:1990630 IRE1-RACK1-PP2A complex
3. B GO:0045309 protein phosphorylated amino acid binding
3. B GO:1900429 negative regulation of filamentous growth of a population of unicellular organisms
3. B GO:0000266 mitochondrial fission
3. B GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
3. B GO:0007099 centriole replication
3. B GO:0017070 U6 snRNA binding
3. B GO:0048135 female germ-line cyst formation
3. B GO:0010619 adenylate cyclase-activating glucose-activated G protein-coupled receptor signaling pathway
3. B GO:0043204 perikaryon
3. B GO:1990756 ubiquitin ligase-substrate adaptor activity
3. B GO:0071363 cellular response to growth factor stimulus
3. B GO:0045478 fusome organization
3. B GO:0042393 histone binding
3. B GO:0030332 cyclin binding
3. B GO:0060444 branching involved in mammary gland duct morphogenesis
3. B GO:0034613 cellular protein localization
3. B GO:0030286 dynein complex
3. B GO:0071001 U4/U6 snRNP
3. B GO:1903725 regulation of phospholipid metabolic process
3. B GO:0045598 regulation of fat cell differentiation
3. B GO:0005828 kinetochore microtubule
3. B GO:0060027 convergent extension involved in gastrulation
3. B GO:0006919 activation of cysteine-type endopeptidase activity involved in apoptotic process
3. B GO:0009723 response to ethylene
3. B GO:1902624 positive regulation of neutrophil migration
3. B GO:0031334 positive regulation of protein-containing complex assembly
3. B GO:0016021 integral component of membrane
3. B GO:0060290 transdifferentiation
3. B GO:0060271 cilium assembly
3. B GO:0000393 spliceosomal conformational changes to generate catalytic conformation
3. B GO:0008380 RNA splicing
3. B GO:0010659 cardiac muscle cell apoptotic process
3. B GO:0051302 regulation of cell division
3. B GO:0005875 microtubule associated complex
3. B GO:0030513 positive regulation of BMP signaling pathway
3. B GO:1990452 Parkin-FBXW7-Cul1 ubiquitin ligase complex
3. B GO:0005813 centrosome
3. B GO:0032991 protein-containing complex
3. B GO:0043293 apoptosome
3. B GO:0030381 chorion-containing eggshell pattern formation
3. B GO:0007186 G protein-coupled receptor signaling pathway
3. B GO:0005829 cytosol
3. B GO:0097525 spliceosomal snRNP complex
3. B GO:0030621 U4 snRNA binding
3. B GO:0090207 regulation of triglyceride metabolic process
3. B GO:0050816 phosphothreonine residue binding
3. B GO:0045842 positive regulation of mitotic metaphase/anaphase transition
3. B GO:0000139 Golgi membrane
3. B GO:0031648 protein destabilization
3. B GO:2000060 positive regulation of ubiquitin-dependent protein catabolic process
3. B GO:0042169 SH2 domain binding
3. B GO:1903208 negative regulation of hydrogen peroxide-induced neuron death
3. B GO:0030292 protein tyrosine kinase inhibitor activity
3. B GO:0090443 FAR/SIN/STRIPAK complex
3. B GO:0051572 negative regulation of histone H3-K4 methylation
3. B GO:0072344 rescue of stalled ribosome
3. B GO:0005938 cell cortex
3. B GO:0000433 carbon catabolite repression of transcription from RNA polymerase II promoter by glucose
3. B GO:0030674 protein-macromolecule adaptor activity

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB A8XEN7 DDB1- and CUL4-associated factor 11 homolog 4.31e-03 4.00e-02 0.029
1. PB B7FF09 WD repeat-containing protein on Y chromosome 1.24e-04 3.38e-28 6.26e-21
1. PB B7FF08 WD repeat-containing protein on Y chromosome 2.32e-04 4.81e-10 1.10e-19
1. PB B7FF12 WD repeat-containing protein on Y chromosome 1.22e-05 4.19e-26 3.34e-22
1. PB Q8IV35 WD repeat-containing protein 49 1.20e-03 2.54e-02 6.77e-24
1. PB Q5TTP0 WD repeat-containing protein on Y chromosome 1.33e-07 1.09e-24 2.87e-19
1. PB Q17I16 WD repeat-containing protein on Y chromosome 1.43e-05 7.08e-22 3.24e-21
1. PB B4F7L9 WD repeat-containing protein on Y chromosome 1.17e-05 1.11e-24 1.23e-20
1. PB B1ANS9 WD repeat-containing protein 64 0 1.36e-144 0.0
1. PB Q9D565 WD repeat-containing protein 64 0.00e+00 1.85e-73 0.0
1. PB B0WYR6 WD repeat-containing protein on Y chromosome 4.13e-07 1.90e-15 7.22e-20
1. PB B5DHW4 WD repeat-containing protein on Y chromosome 1.37e-06 5.16e-27 6.18e-24
1. PB B7FF06 WD repeat-containing protein on Y chromosome 2.33e-06 1.25e-11 1.25e-19
1. PB B7FF07 WD repeat-containing protein on Y chromosome 2.16e-04 2.59e-09 2.25e-20
1. PB Q5A7Q3 Pre-mRNA-splicing factor PRP46 6.52e-04 2.63e-02 0.006
1. PB B0FXQ5 WD repeat-containing protein on Y chromosome 2.56e-04 3.72e-26 5.19e-20
1. PB B4GQJ7 WD repeat-containing protein on Y chromosome 8.07e-07 1.37e-27 5.77e-24
2. P Q9C1X1 Periodic tryptophan protein 2 homolog 4.80e-07 4.99e-02 NA
2. P Q8NA23 WD repeat-containing protein 31 7.82e-05 6.19e-03 NA
2. P Q6P7W2 SH3KBP1-binding protein 1 2.64e-02 1.28e-06 NA
2. P Q8VC51 Telomerase Cajal body protein 1 9.41e-04 4.55e-02 NA
2. P Q9C270 Periodic tryptophan protein 2 homolog 1.31e-06 6.19e-03 NA
2. P Q6NQ88 Protein DAMAGED DNA-BINDING 2 1.72e-02 1.55e-02 NA
2. P E9Q743 Cilia- and flagella-associated protein 251 1.48e-02 8.22e-03 NA
2. P Q7ZYQ6 DDB1- and CUL4-associated factor 13 9.52e-06 2.86e-02 NA
2. P Q8TBY9 Cilia- and flagella-associated protein 251 1.33e-05 3.04e-03 NA
2. P Q3UMY5 Echinoderm microtubule-associated protein-like 4 7.03e-03 3.58e-02 NA
2. P Q6CP71 Polyadenylation factor subunit 2 4.67e-03 4.99e-02 NA
2. P P0C5J9 SH3KBP1-binding protein 1 8.30e-03 7.15e-06 NA
2. P Q9XWI6 Eukaryotic translation initiation factor 3 subunit B 9.01e-03 1.64e-02 NA
2. P O94394 Uncharacterized WD repeat-containing protein C126.01c 6.08e-05 5.61e-03 NA
2. P A7TKF2 Eukaryotic translation initiation factor 3 subunit B 4.59e-03 2.12e-03 NA
2. P Q6TNS2 p21-activated protein kinase-interacting protein 1-like 1.71e-03 1.44e-02 NA
2. P Q8BFX3 BTB/POZ domain-containing protein KCTD3 6.71e-03 2.14e-05 NA
2. P Q5XX13 F-box/WD repeat-containing protein 10 8.36e-03 8.25e-04 NA
2. P Q9UT73 Uncharacterized WD repeat-containing protein C343.17c 4.07e-03 6.19e-03 NA
2. P A8WX15 Eukaryotic translation initiation factor 3 subunit B 1.12e-02 7.10e-03 NA
2. P Q5SUS0 F-box/WD repeat-containing protein 10 1.00e-02 2.33e-02 NA
2. P Q9JHB4 WD repeat-containing protein 31 1.98e-05 1.71e-02 NA
2. P Q15572 TATA box-binding protein-associated factor RNA polymerase I subunit C 2.74e-02 4.47e-02 NA
2. P A3KMV1 SH3KBP1-binding protein 1 1.00e-02 6.06e-05 NA
2. P Q75AI1 Protein DSE1 5.93e-03 5.56e-04 NA
2. P A5DNK9 Pre-rRNA-processing protein IPI3 4.08e-03 7.90e-03 NA
2. P Q5RE88 Cilia- and flagella-associated protein 251 1.80e-04 1.55e-02 NA
2. P P40055 U3 small nucleolar RNA-associated protein 7 2.83e-03 4.86e-02 NA
2. P Q6FJS0 Polyadenylation factor subunit 2 8.93e-04 1.63e-02 NA
2. P Q6NVS5 DDB1- and CUL4-associated factor 13 9.05e-06 1.29e-02 NA
2. P Q8TBC3 SH3KBP1-binding protein 1 1.26e-02 6.41e-05 NA
2. P Q2TAF3 Echinoderm microtubule-associated protein-like 4 1.59e-05 1.06e-04 NA
2. P Q3UDP0 WD repeat-containing protein 41 3.10e-04 2.68e-02 NA
2. P Q6DIP5 Echinoderm microtubule-associated protein-like 4 9.23e-05 2.27e-03 NA
2. P Q20636 Guanine nucleotide-binding protein subunit beta-2 2.16e-05 1.17e-02 NA
2. P Q9Y597 BTB/POZ domain-containing protein KCTD3 6.68e-03 3.08e-06 NA
3. B Q5BE22 Pre-mRNA-splicing factor prp46 3.15e-04 NA 5.47e-05
3. B G8SD34 NAD(+) hydrolase ApTIR 1.50e-03 NA 6.12e-04
3. B Q8YRI1 Uncharacterized WD repeat-containing protein alr3466 1.50e-04 NA 1.41e-10
3. B Q5BK30 Dynein assembly factor with WDR repeat domains 1 8.79e-06 NA 1.04e-07
3. B G4MQX3 MST50-interacting protein 11 4.07e-06 NA 0.002
3. B B4JWA1 Lissencephaly-1 homolog 8.11e-05 NA 0.003
3. B D5GBI7 Nuclear distribution protein PAC1 6.89e-05 NA 0.045
3. B P38129 Transcription initiation factor TFIID subunit 5 1.49e-03 NA 2.25e-06
3. B P23232 Guanine nucleotide-binding protein subunit beta 3.34e-04 NA 0.014
3. B A1L271 Guanine nucleotide-binding protein subunit beta-5a 3.16e-05 NA 0.001
3. B O43172 U4/U6 small nuclear ribonucleoprotein Prp4 1.11e-03 NA 1.69e-04
3. B Q13033 Striatin-3 1.50e-02 NA 0.011
3. B P0CS49 Pre-mRNA-splicing factor PRP46 7.44e-05 NA 7.85e-06
3. B Q5RHI5 Denticleless protein homolog 1.71e-02 NA 0.035
3. B P0CY34 Transcriptional repressor TUP1 9.32e-05 NA 0.002
3. B O14170 WD repeat-containing protein pop2 5.24e-04 NA 8.20e-06
3. B P61964 WD repeat-containing protein 5 1.30e-04 NA 0.002
3. B O43815 Striatin 4.41e-03 NA 4.75e-06
3. B P74442 Uncharacterized WD repeat-containing protein slr0143 1.71e-04 NA 3.42e-07
3. B P93563 Guanine nucleotide-binding protein subunit beta 3.13e-05 NA 1.35e-05
3. B P0CS42 Nuclear distribution protein PAC1 6.33e-04 NA 0.044
3. B Q9C827 Coatomer subunit beta'-2 1.19e-07 NA 0.022
3. B B3NPW0 Lissencephaly-1 homolog 3.69e-05 NA 0.001
3. B P90648 Myosin heavy chain kinase B 1.51e-03 NA 9.98e-08
3. B Q9NYS7 WD repeat and SOCS box-containing protein 2 3.34e-04 NA 0.033
3. B Q54ZP5 WD repeat-containing protein 48 homolog 6.70e-02 NA 0.005
3. B Q75BY3 Pre-mRNA-splicing factor PRP46 2.95e-04 NA 2.41e-04
3. B P62881 Guanine nucleotide-binding protein subunit beta-5 1.60e-04 NA 0.004
3. B Q5NVD0 U4/U6 small nuclear ribonucleoprotein Prp4 1.28e-03 NA 1.78e-04
3. B Q3MHE2 U4/U6 small nuclear ribonucleoprotein Prp4 9.57e-04 NA 2.20e-04
3. B A0A1P8AW69 Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.1 1.68e-02 NA 1.85e-08
3. B Q4R7Y4 Guanine nucleotide-binding protein subunit beta-2-like 1 3.85e-06 NA 0.015
3. B Q6P2Y2 Dynein assembly factor with WDR repeat domains 1 7.63e-06 NA 1.53e-05
3. B Q12788 Transducin beta-like protein 3 4.38e-06 NA 0.003
3. B A5D7H2 Striatin-3 1.37e-01 NA 0.017
3. B Q7T0P4 POC1 centriolar protein homolog A 3.10e-04 NA 8.30e-04
3. B C5FP68 Probable E3 ubiquitin ligase complex SCF subunit sconB 2.22e-03 NA 0.009
3. B B4J8H6 WD repeat-containing protein 48 homolog 3.30e-04 NA 6.32e-05
3. B B3RQN1 Ribosome biogenesis protein WDR12 homolog 1.89e-06 NA 2.20e-04
3. B Q9AUR8 Coatomer subunit alpha-1 6.93e-07 NA 0.002
3. B B8PD53 Nuclear distribution protein PAC1-2 NA NA 0.020
3. B Q8JZX3 POC1 centriolar protein homolog A 6.20e-04 NA 0.001
3. B P40968 Pre-mRNA-processing factor 17 2.63e-03 NA 0.004
3. B Q6ZMY6 WD repeat-containing protein 88 1.44e-03 NA 1.08e-06
3. B P41318 Target of rapamycin complex subunit LST8 2.90e-07 NA 0.003
3. B Q40507 Guanine nucleotide-binding protein subunit beta 2.86e-05 NA 6.02e-06
3. B A6ZQL5 Mitochondrial division protein 1 2.21e-01 NA 3.93e-05
3. B P47025 Mitochondrial division protein 1 2.28e-02 NA 3.34e-05
3. B Q9UTC7 Uncharacterized WD repeat-containing protein C227.12 7.66e-04 NA 8.00e-07
3. B O24076 Guanine nucleotide-binding protein subunit beta-like protein 4.48e-06 NA 7.29e-06
3. B Q8NBT0 POC1 centriolar protein homolog A 2.23e-04 NA 0.003
3. B P49695 Probable serine/threonine-protein kinase PkwA 4.22e-02 NA 7.05e-05
3. B A8X8C6 WD repeat-containing protein tag-125 7.32e-04 NA 1.08e-07
3. B Q61FW2 F-box/WD repeat-containing protein sel-10 7.02e-04 NA 3.33e-04
3. B Q3ULA2 F-box/WD repeat-containing protein 1A 1.11e-03 NA 2.17e-05
3. B P39014 F-box protein MET30 7.63e-02 NA 1.87e-08
3. B Q9P7I3 Mitochondrial division protein 1 2.25e-03 NA 1.88e-04
3. B Q05B17 WD repeat-containing protein 48 9.48e-04 NA 0.001
3. B Q4R8E7 Dynein assembly factor with WDR repeat domains 1 8.71e-06 NA 2.80e-08
3. B P0CS48 Pre-mRNA-splicing factor PRP46 8.20e-05 NA 1.75e-05
3. B Q8YV57 Uncharacterized WD repeat-containing protein all2124 3.42e-04 NA 1.74e-07
3. B Q6CB13 Mitochondrial division protein 1 7.97e-04 NA 4.49e-04
3. B Q39190 Protein pleiotropic regulator PRL2 2.80e-03 NA 6.41e-04
3. B B4KRQ4 WD repeat-containing protein 48 homolog 3.97e-04 NA 3.66e-05
3. B P61965 WD repeat-containing protein 5 5.34e-04 NA 0.002
3. B Q8I0F4 Lissencephaly-1 homolog 1.21e-04 NA 0.001
3. B Q498M4 WD repeat-containing protein 5 5.41e-04 NA 0.002
3. B Q17GR9 Probable cytosolic iron-sulfur protein assembly protein Ciao1 1.65e-05 NA 0.004
3. B Q5M9G8 DDB1- and CUL4-associated factor 11 1.48e-03 NA 0.006
3. B F6ZT52 POC1 centriolar protein homolog B 1.01e-03 NA 6.46e-06
3. B Q8TC44 POC1 centriolar protein homolog B 6.71e-04 NA 0.008
3. B P29829 Guanine nucleotide-binding protein subunit beta-2 2.99e-05 NA 0.022
3. B P49178 Guanine nucleotide-binding protein subunit beta 1.30e-05 NA 5.02e-05
3. B Q86TI4 WD repeat-containing protein 86 1.34e-05 NA 1.04e-04
3. B Q5U2W5 Transducin beta-like protein 3 3.66e-06 NA 0.031
3. B Q32PG3 WD repeat-containing protein 48 7.23e-04 NA 0.002
3. B P63244 Receptor of activated protein C kinase 1 3.82e-06 NA 0.015
3. B Q0V8J1 WD repeat and SOCS box-containing protein 2 2.70e-04 NA 0.028
3. B B4QHG6 Lissencephaly-1 homolog 1.56e-03 NA 0.001
3. B Q00808 Vegetative incompatibility protein HET-E-1 1.65e-04 NA 9.96e-10
3. B Q9VZF4 F-box/WD repeat-containing protein 7 4.95e-03 NA 1.94e-05
3. B P63246 Receptor of activated protein C kinase 1 6.04e-07 NA 0.015
3. B Q23256 WD repeat-containing protein wdr-5.3 2.62e-03 NA 1.15e-05
3. B Q17963 WD repeat-containing protein wdr-5.1 6.55e-04 NA 1.27e-05
3. B A2AHJ4 Bromodomain and WD repeat-containing protein 3 1.99e-02 NA 6.65e-04
3. B B7FNU7 Lissencephaly-1 homolog 1.63e-05 NA 0.012
3. B Q8N136 Dynein assembly factor with WDR repeat domains 1 8.44e-06 NA 8.59e-09
3. B B3NSK1 WD repeat-containing protein 48 homolog 4.51e-04 NA 5.65e-05
3. B Q4R2Z6 WD repeat-containing protein 48 2.36e-03 NA 0.002
3. B Q7ZVF0 POC1 centriolar protein homolog A 2.14e-04 NA 2.00e-06
3. B Q8H0T9 Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.4 3.24e-03 NA 6.27e-07
3. B P63245 Receptor of activated protein C kinase 1 5.73e-07 NA 0.015
3. B C4YFX2 Transcriptional repressor TUP1 2.41e-04 NA 0.002
3. B Q8YTC2 Uncharacterized WD repeat-containing protein alr2800 1.32e-05 NA 8.55e-09
3. B Q9DAW6 U4/U6 small nuclear ribonucleoprotein Prp4 9.72e-04 NA 2.02e-04
3. B Q4V7Y7 Katanin p80 WD40 repeat-containing subunit B1 4.34e-03 NA 9.26e-06
3. B P62882 Guanine nucleotide-binding protein subunit beta-5 6.78e-06 NA 0.004
3. B A8XZJ9 Lissencephaly-1 homolog 1.76e-04 NA 7.44e-04
3. B P0CS43 Nuclear distribution protein PAC1 6.64e-04 NA 0.044
3. B B4HND9 WD repeat-containing protein 48 homolog 7.14e-04 NA 5.65e-05
3. B Q5GIS3 Guanine nucleotide-binding protein subunit beta 3.41e-04 NA 5.26e-04
3. B D3BUN1 Lissencephaly-1 homolog 2.28e-04 NA 0.018
3. B Q922B6 E3 ubiquitin-protein ligase TRAF7 2.63e-04 NA 0.021
3. B Q99973 Telomerase protein component 1 7.72e-03 NA 5.39e-06
3. B Q9CAA0 Coatomer subunit beta'-1 8.82e-08 NA 0.018
3. B Q54LT8 Serine-threonine kinase receptor-associated protein 3.41e-06 NA 0.007
3. B P78706 Transcriptional repressor rco-1 2.01e-02 NA 4.47e-04
3. B Q6RI45 Bromodomain and WD repeat-containing protein 3 4.34e-02 NA 1.27e-04
3. B Q94A40 Coatomer subunit alpha-1 1.96e-05 NA 2.11e-04
3. B Q8K450 Sperm-associated antigen 16 protein 9.42e-04 NA 0.035
3. B Q8TEB1 DDB1- and CUL4-associated factor 11 2.72e-03 NA 0.002
3. B Q0J3D9 Coatomer subunit alpha-3 2.71e-05 NA 0.001
3. B P70483 Striatin 1.33e-02 NA 4.51e-06
3. B Q8TAF3 WD repeat-containing protein 48 8.23e-04 NA 0.002
3. B B4KT48 Lissencephaly-1 homolog 1.07e-04 NA 0.004
3. B Q21215 Guanine nucleotide-binding protein subunit beta-2-like 1 6.00e-06 NA 2.21e-04
3. B P54313 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 3.73e-05 NA 0.002
3. B Q9EPV5 Apoptotic protease-activating factor 1 1.42e-05 NA 0.003
3. B Q5F3K4 WD repeat-containing protein 48 3.89e-04 NA 0.003
3. B Q4V7Z1 POC1 centriolar protein homolog B 1.89e-03 NA 2.67e-04
3. B Q6FJZ9 Pre-mRNA-splicing factor PRP46 3.20e-04 NA 9.18e-05
3. B Q15542 Transcription initiation factor TFIID subunit 5 3.12e-03 NA 2.53e-04
3. B Q01369 Guanine nucleotide-binding protein subunit beta-like protein 4.47e-06 NA 5.63e-04
3. B A0A2R8RWN9 F-box and WD repeat domain-containing 11-B 4.15e-04 NA 1.16e-04
3. B Q5RFF8 Notchless protein homolog 1 2.15e-04 NA 2.47e-04
3. B P46800 Guanine nucleotide-binding protein subunit beta-like protein 6.42e-05 NA 2.25e-04
3. B B4GIJ0 WD repeat-containing protein 48 homolog 1.67e-03 NA 2.37e-05
3. B Q6CKE8 Pre-mRNA-splicing factor PRP46 1.95e-04 NA 7.05e-05
3. B Q6CJ50 Mitochondrial division protein 1 9.96e-04 NA 0.037
3. B O88879 Apoptotic protease-activating factor 1 1.04e-05 NA 0.002
3. B Q12417 Pre-mRNA-splicing factor PRP46 3.03e-05 NA 4.41e-04
3. B Q28I85 POC1 centriolar protein homolog A 3.10e-04 NA 0.008
3. B Q291L9 Lissencephaly-1 homolog 6.51e-05 NA 0.004
3. B Q9UKB1 F-box/WD repeat-containing protein 11 1.40e-03 NA 7.41e-06
3. B Q96WV5 Putative coatomer subunit alpha 6.15e-05 NA 1.71e-04
3. B O14775 Guanine nucleotide-binding protein subunit beta-5 1.57e-04 NA 0.004
3. B Q9AUR7 Coatomer subunit alpha-2 5.60e-06 NA 0.004
3. B P25382 Ribosome assembly protein 4 6.19e-05 NA 0.008
3. B P49026 Guanine nucleotide-binding protein subunit beta-like protein 3.89e-06 NA 0.007
3. B Q5RF51 U5 small nuclear ribonucleoprotein 40 kDa protein 1.44e-04 NA 1.08e-04
3. B Q921C3 Bromodomain and WD repeat-containing protein 1 4.34e-02 NA 2.80e-06
3. B Q3Y8L7 Dynein assembly factor with WDR repeat domains 1 4.62e-05 NA 2.96e-09
3. B Q8BG40 Katanin p80 WD40 repeat-containing subunit B1 3.42e-02 NA 3.96e-05
3. B Q42384 Protein pleiotropic regulatory locus 1 1.61e-03 NA 0.004
3. B F1MNN4 F-box/WD repeat-containing protein 7 3.65e-04 NA 4.48e-07
3. B Q9SY00 COMPASS-like H3K4 histone methylase component WDR5B 1.12e-04 NA 0.032
3. B Q8BH57 WD repeat-containing protein 48 4.47e-04 NA 0.006
3. B Q9UMS4 Pre-mRNA-processing factor 19 5.02e-04 NA 9.00e-07
3. B O54929 WD repeat and SOCS box-containing protein 2 5.06e-04 NA 0.008
3. B P16649 General transcriptional corepressor TUP1 6.75e-02 NA 0.023
3. B Q55AR8 U5 small nuclear ribonucleoprotein 40 kDa protein 3.76e-04 NA 5.07e-04
3. B Q6PNB6 Guanine nucleotide-binding protein subunit beta-5 2.79e-05 NA 0.004
3. B O42248 Guanine nucleotide-binding protein subunit beta-2-like 1 3.04e-06 NA 0.011
3. B G5EEG7 Smu-1 suppressor of mec-8 and unc-52 protein 1.80e-03 NA 0.004
3. B Q6PE01 U5 small nuclear ribonucleoprotein 40 kDa protein 5.38e-04 NA 1.84e-05
3. B Q8W1K8 Protein Mut11 1.52e-05 NA 0.002
3. B A7EF03 Eukaryotic translation initiation factor 3 subunit I 5.07e-05 NA 0.043
3. B A2CEH0 POC1 centriolar protein homolog B 1.55e-03 NA 0.002
3. B Q2KIG2 WD repeat-containing protein 5 1.35e-04 NA 0.002
3. B P97499 Telomerase protein component 1 2.28e-03 NA 8.79e-04
3. B Q09990 F-box/WD repeat-containing protein lin-23 1.38e-03 NA 4.97e-05
3. B Q94BR4 Pre-mRNA-processing factor 19 homolog 1 7.28e-05 NA 7.75e-05
3. B P69104 Guanine nucleotide-binding protein subunit beta-like protein 7.34e-06 NA 0.001
3. B Q8VBV4 F-box/WD repeat-containing protein 7 4.08e-04 NA 3.72e-07
3. B Q9LV28 Receptor for activated C kinase 1C 3.68e-06 NA 6.40e-05
3. B P62880 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 3.77e-05 NA 0.002
3. B B4QB64 WD repeat-containing protein 48 homolog 5.61e-04 NA 5.71e-05
3. B O43017 Set1 complex component swd3 1.94e-03 NA 3.70e-05
3. B Q08E38 Pre-mRNA-processing factor 19 4.89e-05 NA 4.93e-07
3. B Q9NSI6 Bromodomain and WD repeat-containing protein 1 4.36e-02 NA 8.97e-07
3. B P63247 Receptor of activated protein C kinase 1 5.88e-07 NA 0.015
3. B B5X3C4 Lissencephaly-1 homolog B 1.37e-04 NA 0.034
3. B Q9D7H2 WD repeat-containing protein 5B 1.11e-04 NA 1.78e-05
3. B Q5R7H5 DDB1- and CUL4-associated factor 11 2.84e-03 NA 0.002
3. B Q8VEJ4 Notchless protein homolog 1 1.92e-04 NA 5.71e-05
3. B P93398 Guanine nucleotide-binding protein subunit beta-2 3.11e-05 NA 4.18e-07
3. B Q99KP6 Pre-mRNA-processing factor 19 2.06e-04 NA 1.08e-06
3. B Q9Y297 F-box/WD repeat-containing protein 1A 2.39e-03 NA 4.30e-05
3. B Q27954 Coatomer subunit alpha 1.97e-05 NA 0.005
3. B Q5RAW8 WD repeat-containing protein 48 6.91e-04 NA 0.002
3. B Q8WWQ0 PH-interacting protein 9.09e-03 NA 2.03e-08
3. B B8P4B0 Nuclear distribution protein PAC1-1 5.49e-04 NA 0.003
3. B Q38884 Eukaryotic translation initiation factor 3 subunit I 4.27e-06 NA 0.016
3. B Q25189 Guanine nucleotide-binding protein subunit beta-like protein 4.29e-06 NA 0.006
3. B Q10051 Pre-mRNA-processing factor 19 2.45e-04 NA 0.002
3. B Q9C4Z6 Receptor for activated C kinase 1B 4.28e-06 NA 9.28e-05
3. B Q7KNS3 Lissencephaly-1 homolog 3.70e-05 NA 0.001
3. B Q1DPU4 Eukaryotic translation initiation factor 3 subunit I 4.28e-05 NA 0.037
3. B C3XVT5 Lissencephaly-1 homolog 3.56e-05 NA 0.011
3. B Q54D08 Protein LST8 homolog 4.57e-07 NA 8.78e-04
3. B Q9NVX2 Notchless protein homolog 1 1.81e-04 NA 2.36e-04
3. B Q229Z6 POC1 centriolar protein homolog 2.50e-03 NA 1.67e-04
3. B Q9V3J8 Protein will die slowly 1.27e-04 NA 1.40e-04
3. B Q9SJT9 Coatomer subunit alpha-2 2.03e-05 NA 5.49e-04
3. B Q2KID6 Pleiotropic regulator 1 1.39e-04 NA 0.002
3. B Q96DI7 U5 small nuclear ribonucleoprotein 40 kDa protein 5.08e-04 NA 2.42e-05
3. B O14435 Guanine nucleotide-binding protein subunit beta 1.92e-05 NA 1.21e-04
3. B F4KB17 Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.3 7.63e-03 NA 1.14e-06
3. B P38123 COMPASS component SWD3 2.69e-06 NA 0.043
3. B Q9BVA0 Katanin p80 WD40 repeat-containing subunit B1 3.74e-03 NA 3.48e-05
3. B Q80ZD0 Guanine nucleotide-binding protein subunit beta-5 2.76e-05 NA 0.004
3. B O13282 Transcription initiation factor TFIID subunit 5 7.97e-04 NA 1.90e-05
3. B Q8BHD1 POC1 centriolar protein homolog B 2.03e-03 NA 0.002
3. B Q28YY2 WD repeat-containing protein 48 homolog 8.70e-04 NA 2.37e-05
3. B O43660 Pleiotropic regulator 1 2.06e-03 NA 0.005
3. B B4P6P9 Lissencephaly-1 homolog 1.14e-04 NA 0.001
3. B B3S4I5 Lissencephaly-1 homolog 6.48e-05 NA 0.002
3. B Q6CG48 Nuclear distribution protein PAC1 9.23e-05 NA 8.88e-06
3. B Q4P9P9 Nuclear distribution protein PAC1 1.65e-04 NA 6.30e-05
3. B P25387 Guanine nucleotide-binding protein subunit beta-like protein 3.91e-06 NA 1.09e-04
3. B P79147 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 3.28e-05 NA 7.84e-04
3. B B4LQ21 Lissencephaly-1 homolog 6.35e-05 NA 0.004
3. B Q0P593 Dynein assembly factor with WDR repeat domains 1 1.41e-04 NA 2.02e-10
3. B Q8VYZ5 Periodic tryptophan protein 2 5.68e-05 NA 0.017
3. B Q5ZMA2 Pre-mRNA-processing factor 19 6.87e-05 NA 2.01e-07
3. B C4Q0P6 Lissencephaly-1 homolog 1.71e-04 NA 0.002
3. B P53621 Coatomer subunit alpha 4.57e-05 NA 0.005
3. B P58405 Striatin-3 1.15e-02 NA 0.011
3. B B4MFM2 WD repeat-containing protein 48 homolog 9.28e-04 NA 3.25e-05
3. B Q6P5M2 WD repeat-containing protein 61 4.65e-06 NA 0.004
3. B Q9VU65 POC1 centriolar protein homolog 1.61e-03 NA 0.009
3. B Q91854 Beta-TrCP 1.51e-03 NA 4.01e-06
3. B Q08706 Guanine nucleotide-binding protein subunit beta 3.22e-05 NA 1.85e-04
3. B Q6Q0C0 E3 ubiquitin-protein ligase TRAF7 4.21e-04 NA 0.010
3. B Q6BU94 Pre-mRNA-splicing factor PRP46 2.18e-07 NA 0.011
3. B B3MET8 WD repeat-containing protein 48 homolog 8.54e-04 NA 1.77e-05
3. B Q5M786 WD repeat-containing protein 5 1.07e-04 NA 0.003
3. B B0X2V9 WD repeat-containing protein 48 homolog 1.39e-03 NA 1.19e-04
3. B B6QC06 Nuclear distribution protein nudF 2 1.11e-03 NA 0.047
3. B Q54KL5 WD repeat-containing protein 5 homolog 3.79e-04 NA 2.86e-04
3. B Q5VQ78 Coatomer subunit beta'-1 1.16e-06 NA 0.038
3. B Q54S79 WD repeat-containing protein 3 homolog 1.44e-06 NA 0.006
3. B Q58D20 Notchless protein homolog 1 1.39e-04 NA 8.07e-05
3. B Q9M2Z2 COMPASS-like H3K4 histone methylase component WDR5A 1.16e-04 NA 9.50e-07
3. B Q16MY0 WD repeat-containing protein 48 homolog 9.62e-04 NA 8.38e-06
3. B Q9ERG2 Striatin-3 8.14e-02 NA 0.008
3. B B4HSL3 Lissencephaly-1 homolog 4.45e-05 NA 0.001
3. B P63243 Receptor of activated protein C kinase 1 4.05e-06 NA 0.015
3. B Q09855 F-box/WD repeat-containing protein pof11 8.09e-04 NA 9.90e-12
3. B Q8C092 Transcription initiation factor TFIID subunit 5 6.71e-03 NA 1.43e-04
3. B O13615 Pre-mRNA-splicing factor prp5 1.11e-03 NA 7.79e-06
3. B P93340 Guanine nucleotide-binding protein subunit beta-like protein 3.52e-06 NA 0.005
3. B Q922V4 Pleiotropic regulator 1 2.03e-04 NA 0.003
3. B Q10282 Guanine nucleotide-binding protein subunit beta 7.61e-05 NA 0.012
3. B Q8CIE6 Coatomer subunit alpha 2.46e-03 NA 0.004
3. B Q00659 Probable E3 ubiquitin ligase complex SCF subunit sconB 3.33e-03 NA 0.003
3. B P49177 Guanine nucleotide-binding protein subunit beta 1.81e-05 NA 1.81e-07
3. B Q9FLX9 Notchless protein homolog 3.91e-05 NA 5.19e-05
3. B Q6NVM2 Katanin p80 WD40 repeat-containing subunit B1 3.16e-03 NA 1.52e-05
3. B P53699 Cell division control protein 4 4.33e-04 NA 0.020
3. B Q5JTN6 WD repeat-containing protein 38 2.86e-06 NA 0.025
3. B Q5RD06 POC1 centriolar protein homolog B 6.97e-04 NA 0.014
3. B Q5ZIU8 Katanin p80 WD40 repeat-containing subunit B1 1.09e-03 NA 1.80e-06
3. B P62879 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 3.85e-05 NA 0.002
3. B F4HTH8 Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.2 1.07e-02 NA 8.52e-07
3. B Q55563 Uncharacterized WD repeat-containing protein sll0163 1.18e-05 NA 5.15e-05
3. B Q5E9I8 DDB1- and CUL4-associated factor 11 1.31e-03 NA 0.004
3. B Q9JMJ4 Pre-mRNA-processing factor 19 3.98e-05 NA 1.08e-06
3. B P93339 Guanine nucleotide-binding protein subunit beta NA NA 5.38e-05
3. B P93107 Flagellar WD repeat-containing protein Pf20 1.04e-03 NA 3.43e-04
3. B D3ZW91 POC1 centriolar protein homolog B 9.73e-04 NA 0.004
3. B O76734 General transcriptional corepressor tupA 2.14e-03 NA 6.44e-06
3. B O62471 Protein qui-1 5.37e-04 NA 0.004
3. B Q93847 WD repeat-containing protein wdr-5.2 2.49e-03 NA 0.007
3. B P68040 Receptor of activated protein C kinase 1 5.74e-07 NA 0.015
3. B D3TLL6 Lissencephaly-1 homolog 3.65e-05 NA 0.003
3. B Q40153 LEC14B protein 4.66e-03 NA 0.005
3. B Q7ZXK9 Notchless protein homolog 1 5.46e-05 NA 7.99e-04
3. B Q9WUC8 Pleiotropic regulator 1 2.84e-04 NA 0.003
3. B P26308 Guanine nucleotide-binding protein subunit beta-1 3.91e-05 NA 0.002
3. B D3Z902 F-box/WD repeat-containing protein 7 4.68e-04 NA 3.34e-07
3. B O08653 Telomerase protein component 1 4.38e-03 NA 1.02e-04
3. B Q9NDC9 Lissencephaly-1 homolog 1.14e-04 NA 1.55e-04
3. B O61585 Katanin p80 WD40 repeat-containing subunit B1 1.93e-03 NA 4.71e-06
3. B Q1LV15 Dynein assembly factor with WDR repeat domains 1 7.50e-06 NA 1.32e-05
3. B Q1LZ08 WD repeat-containing protein 48 homolog 1.09e-03 NA 7.31e-05
3. B Q2TBP4 POC1 centriolar protein homolog A 9.81e-05 NA 0.002
3. B A7TNS8 CCR4-associated factor 4 homolog 8.04e-04 NA 1.42e-04
3. B Q61011 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 3.36e-05 NA 0.002
3. B P93397 Guanine nucleotide-binding protein subunit beta-1 3.08e-05 NA 2.92e-05
3. B Q5RDY7 Guanine nucleotide-binding protein subunit beta-5 2.76e-05 NA 0.004
3. B Q09715 Transcriptional repressor tup11 1.30e-02 NA 0.017
3. B Q6PH57 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 4.05e-05 NA 0.017
3. B P20053 U4/U6 small nuclear ribonucleoprotein PRP4 6.15e-04 NA 0.031
3. B Q5RE95 WD repeat-containing protein 5B 5.18e-04 NA 7.50e-05
3. B Q39836 Guanine nucleotide-binding protein subunit beta-like protein 4.61e-06 NA 4.98e-06
3. B Q5SRY7 F-box/WD repeat-containing protein 11 1.19e-03 NA 6.74e-06
3. B Q4V8C4 WD repeat-containing protein 5B 1.02e-04 NA 2.30e-04
3. B Q86VZ2 WD repeat-containing protein 5B 3.09e-05 NA 9.18e-05
3. B B4MY65 Lissencephaly-1 homolog 3.79e-05 NA 0.001
3. B P90794 DDB1- and CUL4-associated factor 11 homolog 4.59e-03 NA 0.006
3. B Q6PBY0 Guanine nucleotide-binding protein subunit beta-5b 1.15e-04 NA 0.019
3. B A9V790 Lissencephaly-1 homolog 3.16e-04 NA 0.002
3. B Q5FWQ6 Dynein assembly factor with WDR repeat domains 1 8.00e-06 NA 1.29e-05
3. B Q17N69 Lissencephaly-1 homolog 1.74e-04 NA 0.040
3. B O55106 Striatin 6.41e-02 NA 4.31e-05
3. B P69103 Guanine nucleotide-binding protein subunit beta-like protein 1.00e-05 NA 0.001
3. B B4P7H8 WD repeat-containing protein 48 homolog 8.07e-04 NA 8.16e-05
3. B B7PS00 Lissencephaly-1 homolog 3.01e-05 NA 0.006
3. B Q7ZUV2 Katanin p80 WD40 repeat-containing subunit B1 1.51e-02 NA 1.64e-04
3. B Q6C709 Pre-mRNA-splicing factor PRP46 1.72e-04 NA 0.005
3. B P52287 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 3.41e-05 NA 7.80e-05
3. B Q758R7 Mitochondrial division protein 1 8.99e-04 NA 0.007
3. B P16520 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 3.24e-05 NA 0.002
3. B Q93794 F-box/WD repeat-containing protein sel-10 7.66e-04 NA 1.19e-06
3. B Q8VDD9 PH-interacting protein 2.38e-02 NA 2.04e-08
3. B P11017 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 3.55e-04 NA 0.002
3. B Q91VU6 DDB1- and CUL4-associated factor 11 1.46e-03 NA 0.006
3. B Q6FT96 Mitochondrial division protein 1 2.48e-03 NA 1.63e-04
3. B B4GAJ1 Lissencephaly-1 homolog 6.65e-05 NA 0.004
3. B A8PTE4 Mitochondrial division protein 1 1.20e-02 NA 7.79e-04
3. B P87053 F-box/WD repeat-containing protein pof1 5.17e-03 NA 0.002
3. B P42527 Myosin heavy chain kinase A 1.14e-02 NA 0.011
3. B Q4WT34 Pre-mRNA-splicing factor prp46 3.94e-04 NA 6.60e-06
3. B O15736 Protein tipD 5.47e-04 NA 1.71e-04
3. B B3MEY6 Lissencephaly-1 homolog 6.01e-05 NA 0.004
3. B Q969H0 F-box/WD repeat-containing protein 7 4.32e-04 NA 5.23e-07
3. B A7S338 Lissencephaly-1 homolog 2.18e-04 NA 0.009
3. B Q4RJN5 Lissencephaly-1 homolog 1.56e-04 NA 0.036
3. B Q2HJH6 U5 small nuclear ribonucleoprotein 40 kDa protein 1.55e-04 NA 1.85e-05
3. B A0A2R8QFQ6 F-box and WD repeat domain-containing 11-A 1.74e-03 NA 3.23e-04
3. B O45040 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 3.76e-05 NA 0.022
3. B Q6PFM9 WD repeat-containing protein 48 1.05e-03 NA 0.002