Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
P0C881
(Radial spoke head 10 homolog B) with a FATCAT P-Value: 2.22e-16 and RMSD of 4.53 angstrom. The sequence alignment identity is 99.7%.
Structural alignment shown in left. Query protein B2RC85 colored as red in alignment, homolog P0C881 colored as blue.
Query protein B2RC85 is also shown in right top, homolog P0C881 showed in right bottom. They are colored based on secondary structures.
B2RC85 MVKEKKKADKKGEKSARSPSSLSDNLDFSKQDGNTTRQEMSPAGVPLLGMQLNEVKPKKDRQNVQQNEDASQYEESILTKLIVESYEGEKVRGLYEGEGF 100 P0C881 MVKEKKKADKKGEKSARSPSSLSDNLDFSKQDGNTTRQEMSPAGVPLLGMQLNEVKPKKDRQNVQQNEDATQYEESILTKLIVESYEGEKVRGLYEGEGF 100 B2RC85 AAFQGGCTYRGMFSEGLMHGQGTYIWADGLKYEGDFVKNVPMNHGVYTWPDGSMYEGEVVNGMRNGFGMFKCSTQPVSYIGHWCNGKRHGKGSIYYNQEG 200 P0C881 AAFQGGCTYRGMFSEGLMHGQGTYIWADGLKYEGDFVKNVPMNHGVYTWPDGSMYEGEVVNGMRNGFGMFKCSTQPVSYIGHWCNGKRHGKGSIYYNQEG 200 B2RC85 TCWYEGDWVQNIKKGWGIRCYKSGNIYEGQWEDNMRHGEGRMRWLTTNEEYTGRWERGIQNGFGTHTWFLKRIRSSQYPLRNEYIGEFVNGYRHGRGKFY 300 P0C881 TCWYEGDWVQNIKKGWGIRCYKSGNIYEGQWEDNMRHGEGRMRWLTTNEEYTGRWERGIQNGFGTHTWFLKRIRSSQYPLRNEYIGEFVNGYRHGRGKFY 300 B2RC85 YASGAMYDGEWVSNKKHGMGRLTFKNGRVYEGAFSNDHIAGFPDLEVEFISCLDLSSGVAPRLSRSAELIRKLDGSESHSVLGSSIELDLNLLLDMYPET 400 P0C881 YASGAMYDGEWVSNKKHGMGRLTFKNGRVYEGAFSNDHIAGFPDLEVEFISCLDLSSGVAPRLSRSAELIRKLDGSESHSVLGSSIELDLNLLLDMYPET 400 B2RC85 VQPEEKKQVEYAVLRNITELRRIYSFYSSLGCGHSLDNTFLMTKLHFWRFLKDCKFHHHKLTLADMDRILSANNDIPVEEIHSPFTTILLRTFLNYLLHL 500 P0C881 VQPEEKKQVEYAVLRNITELRRIYSFYSSLGCGHSLDNTFLMTKLHFWRFLKDCKFHHHKLTLADMDRILSANNDIPVEEIHSPFTTILLRTFLNYLLHL 500 B2RC85 AYHIYHEEFQKRSPSLFLCFTKLMTENIRPNACQIKGNLFREQQRTLYSMSYMNKCWEIYLAYCRPSAAPPHEPTMKMRHFLWMLKDFKMINKELTAATF 600 P0C881 AYHIYHEEFQKRSPSLFLCFTKLMTENIRPNAFQIKGNLFREQQRTLYSMSYMNKCWEIYLAYCRPSAAPPHEPTMKMRHFLWMLKDFKMINKELTAATF 600 B2RC85 MEVIAEDNRFIYDGIDSNFEPELVFLEFFEALLSFAFICVTDQMTKSYTNVPADDVSGNKHETIYTILNQDAQNKSPSAVMSHESDAAHSDSARSSSSKL 700 P0C881 MEVIAEDNRFIYDGIDSNFEPELVFLEFFEALLSFAFICVTDQMTKSYTNVPADDVSGNKHETIYTILNQDAQNKSPSAVMSHESDAAHSDSARSSSSKL 700 B2RC85 ELSPDVNKIRKSEPKIKKSVSHERVSKMNFKLTGKGITFFSSESKKYERPKDDREEEFNTWVNNTYVFFVNTLFHAYKREEAIKEKIRADRLRSTAQAQQ 800 P0C881 ELSPDVNKIRKSEPKIKKSVSHERVSKMNFKLTGKGITFFSSESKKYERPKDDREEEFNTWVNNMYVFFVNTLFHAYKREEAIKEKIRADRLRSTAQAQQ 800 B2RC85 RKMEDDELEARLNIFILREEEAKRHDYEVDITVLKEPADVSSSHLILDPPKEDVTVSPSSKTITSKKKKK 870 P0C881 RKMEDDELEARLNIFILREEEAKRHDYEVDITVLKEPADVSSSHLILDPPKEDVTVSPSSKTITSKKKKK 870
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0048767 | root hair elongation |
| 1. PB | GO:0035082 | axoneme assembly |
| 1. PB | GO:0043198 | dendritic shaft |
| 1. PB | GO:0007612 | learning |
| 1. PB | GO:0001786 | phosphatidylserine binding |
| 1. PB | GO:0016324 | apical plasma membrane |
| 1. PB | GO:0070273 | phosphatidylinositol-4-phosphate binding |
| 1. PB | GO:0080025 | phosphatidylinositol-3,5-bisphosphate binding |
| 1. PB | GO:0072687 | meiotic spindle |
| 1. PB | GO:0000794 | condensed nuclear chromosome |
| 1. PB | GO:0003006 | developmental process involved in reproduction |
| 1. PB | GO:0005547 | phosphatidylinositol-3,4,5-trisphosphate binding |
| 1. PB | GO:0007286 | spermatid development |
| 1. PB | GO:0005790 | smooth endoplasmic reticulum |
| 1. PB | GO:2000114 | regulation of establishment of cell polarity |
| 1. PB | GO:0070300 | phosphatidic acid binding |
| 1. PB | GO:0009958 | positive gravitropism |
| 1. PB | GO:0009827 | plant-type cell wall modification |
| 1. PB | GO:0030314 | junctional membrane complex |
| 1. PB | GO:0048167 | regulation of synaptic plasticity |
| 1. PB | GO:0010311 | lateral root formation |
| 1. PB | GO:0090406 | pollen tube |
| 1. PB | GO:0033017 | sarcoplasmic reticulum membrane |
| 1. PB | GO:0010118 | stomatal movement |
| 1. PB | GO:0009860 | pollen tube growth |
| 1. PB | GO:0001520 | outer dense fiber |
| 1. PB | GO:0060402 | calcium ion transport into cytosol |
| 1. PB | GO:0016307 | phosphatidylinositol phosphate kinase activity |
| 1. PB | GO:2001256 | regulation of store-operated calcium entry |
| 1. PB | GO:0009846 | pollen germination |
| 1. PB | GO:0007164 | establishment of tissue polarity |
| 1. PB | GO:0060314 | regulation of ryanodine-sensitive calcium-release channel activity |
| 1. PB | GO:0005546 | phosphatidylinositol-4,5-bisphosphate binding |
| 1. PB | GO:0005789 | endoplasmic reticulum membrane |
| 1. PB | GO:0014701 | junctional sarcoplasmic reticulum membrane |
| 1. PB | GO:0001817 | regulation of cytokine production |
| 1. PB | GO:0001046 | core promoter sequence-specific DNA binding |
| 1. PB | GO:0032266 | phosphatidylinositol-3-phosphate binding |
| 1. PB | GO:0016308 | 1-phosphatidylinositol-4-phosphate 5-kinase activity |
| 1. PB | GO:0048766 | root hair initiation |
| 1. PB | GO:0048768 | root hair cell tip growth |
| 1. PB | GO:0010314 | phosphatidylinositol-5-phosphate binding |
| 1. PB | GO:0050885 | neuromuscular process controlling balance |
| 1. PB | GO:0046488 | phosphatidylinositol metabolic process |
| 2. P | GO:0005886 | plasma membrane |
| 2. P | GO:0072583 | clathrin-dependent endocytosis |
| 2. P | GO:0009908 | flower development |
| 2. P | GO:0003785 | actin monomer binding |
| 3. B | GO:0001227 | DNA-binding transcription repressor activity, RNA polymerase II-specific |
| 3. B | GO:0051260 | protein homooligomerization |
| 3. B | GO:0000122 | negative regulation of transcription by RNA polymerase II |
| 3. B | GO:0032483 | regulation of Rab protein signal transduction |
| 3. B | GO:0035249 | synaptic transmission, glutamatergic |
| 3. B | GO:0007204 | positive regulation of cytosolic calcium ion concentration |
| 3. B | GO:0008307 | structural constituent of muscle |
| 3. B | GO:0007626 | locomotory behavior |
| 3. B | GO:0001701 | in utero embryonic development |
| 3. B | GO:0007409 | axonogenesis |
| 3. B | GO:0051321 | meiotic cell cycle |
| 3. B | GO:0035452 | extrinsic component of plastid membrane |
| 3. B | GO:0030426 | growth cone |
| 3. B | GO:0035022 | positive regulation of Rac protein signal transduction |
| 3. B | GO:0018024 | histone-lysine N-methyltransferase activity |
| 3. B | GO:0007517 | muscle organ development |
| 3. B | GO:0051036 | regulation of endosome size |
| 3. B | GO:0007032 | endosome organization |
| 3. B | GO:0001881 | receptor recycling |
| 3. B | GO:0030018 | Z disc |
| 3. B | GO:0008219 | cell death |
| 3. B | GO:0016279 | protein-lysine N-methyltransferase activity |
| 3. B | GO:0007613 | memory |
| 3. B | GO:0060316 | positive regulation of ryanodine-sensitive calcium-release channel activity |
| 3. B | GO:0045860 | positive regulation of protein kinase activity |
| 3. B | GO:0001726 | ruffle |
| 3. B | GO:0018027 | peptidyl-lysine dimethylation |
| 3. B | GO:0032433 | filopodium tip |
| 3. B | GO:0006479 | protein methylation |
| 3. B | GO:0007283 | spermatogenesis |
| 3. B | GO:0043025 | neuronal cell body |
| 3. B | GO:0007041 | lysosomal transport |
| 3. B | GO:0008104 | protein localization |
| 3. B | GO:0005694 | chromosome |
| 3. B | GO:0002039 | p53 binding |
| 3. B | GO:1901555 | response to paclitaxel |
| 3. B | GO:0006979 | response to oxidative stress |
| 3. B | GO:0009707 | chloroplast outer membrane |
| 3. B | GO:0040011 | locomotion |
| 3. B | GO:0016529 | sarcoplasmic reticulum |
| 3. B | GO:0048168 | regulation of neuronal synaptic plasticity |
| 3. B | GO:0043547 | positive regulation of GTPase activity |
| 3. B | GO:0018026 | peptidyl-lysine monomethylation |
| 3. B | GO:0005096 | GTPase activator activity |
| 3. B | GO:0032426 | stereocilium tip |
| 3. B | GO:0048678 | response to axon injury |
| 3. B | GO:0005085 | guanyl-nucleotide exchange factor activity |
| 3. B | GO:0043197 | dendritic spine |
| 3. B | GO:0035011 | melanotic encapsulation of foreign target |
| 3. B | GO:0070828 | heterochromatin organization |
| 3. B | GO:0016197 | endosomal transport |
| 3. B | GO:0030027 | lamellipodium |
| 3. B | GO:0010020 | chloroplast fission |
| 3. B | GO:0016601 | Rac protein signal transduction |
| 3. B | GO:0043539 | protein serine/threonine kinase activator activity |
| 3. B | GO:0045471 | response to ethanol |
| 3. B | GO:0016028 | rhabdomere |
| 3. B | GO:0030425 | dendrite |
| 3. B | GO:0055024 | regulation of cardiac muscle tissue development |
| 3. B | GO:0051570 | regulation of histone H3-K9 methylation |
| 3. B | GO:0001662 | behavioral fear response |
| 3. B | GO:0030154 | cell differentiation |
| 3. B | GO:0033583 | rhabdomere membrane |
| 3. B | GO:0018022 | peptidyl-lysine methylation |
| 3. B | GO:0048812 | neuron projection morphogenesis |
| 3. B | GO:0005769 | early endosome |
| 3. B | GO:0043087 | regulation of GTPase activity |
| 3. B | GO:0055074 | calcium ion homeostasis |
| 3. B | GO:0031267 | small GTPase binding |
| 3. B | GO:0031514 | motile cilium |
| 3. B | GO:0005813 | centrosome |
| 3. B | GO:0032991 | protein-containing complex |
| 3. B | GO:0014069 | postsynaptic density |
| 3. B | GO:0007528 | neuromuscular junction development |
| 3. B | GO:0001669 | acrosomal vesicle |
| 3. B | GO:0031982 | vesicle |
| 3. B | GO:0016050 | vesicle organization |
| 3. B | GO:0042802 | identical protein binding |
| 3. B | GO:0035640 | exploration behavior |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | P0C881 | Radial spoke head 10 homolog B | 2.22e-16 | 7.18e-147 | 0.0 |
| 1. PB | Q6EX42 | Phosphatidylinositol 4-phosphate 5-kinase 1 | 2.35e-02 | 2.66e-02 | 2.26e-21 |
| 1. PB | Q9SUI2 | Phosphatidylinositol 4-phosphate 5-kinase 7 | 7.09e-04 | 2.05e-02 | 3.02e-20 |
| 1. PB | Q5T089 | MORN repeat-containing protein 1 | 3.32e-03 | 2.27e-08 | 2.43e-17 |
| 1. PB | Q96JJ6 | Junctophilin-4 | 3.43e-03 | 1.08e-03 | 8.18e-08 |
| 1. PB | Q56YP2 | Phosphatidylinositol 4-phosphate 5-kinase 1 | 1.22e-02 | 6.16e-03 | 3.15e-26 |
| 1. PB | Q69FB3 | Junctophilin-4 | 1.99e-02 | 1.10e-03 | 1.10e-07 |
| 1. PB | Q641X6 | MORN repeat-containing protein 1 | 2.62e-03 | 2.09e-08 | 1.26e-16 |
| 1. PB | B2RC85 | Radial spoke head 10 homolog B2 | 0 | 8.13e-159 | 0.0 |
| 1. PB | Q9GKY7 | Junctophilin-2 | 4.03e-03 | 3.61e-02 | 9.66e-11 |
| 1. PB | E9PYQ0 | Radial spoke head 10 homolog B | 6.52e-11 | 1.34e-89 | 0.0 |
| 1. PB | Q80WT0 | Junctophilin-4 | 1.86e-04 | 1.09e-03 | 1.25e-07 |
| 1. PB | Q8L796 | Phosphatidylinositol 4-phosphate 5-kinase 2 | 2.08e-02 | 4.50e-03 | 1.38e-24 |
| 1. PB | O48709 | Phosphatidylinositol 4-phosphate 5-kinase 3 | 1.97e-02 | 6.55e-04 | 8.45e-26 |
| 1. PB | Q08CH7 | Radial spoke head 10 homolog B | 3.33e-16 | 2.31e-40 | 0.0 |
| 1. PB | Q66HB5 | Radial spoke head 10 homolog B | 1.03e-10 | 5.74e-96 | 0.0 |
| 1. PB | Q9SLG9 | Phosphatidylinositol 4-phosphate 5-kinase 5 | 2.24e-03 | 1.60e-05 | 6.04e-22 |
| 1. PB | Q8WYR4 | Radial spoke head 1 homolog | 1.88e-03 | 1.19e-02 | 1.09e-15 |
| 1. PB | Q8L850 | Phosphatidylinositol 4-phosphate 5-kinase 9 | 1.97e-02 | 1.58e-04 | 6.81e-25 |
| 1. PB | Q9M1K2 | Phosphatidylinositol 4-phosphate 5-kinase 4 | 1.63e-02 | 1.53e-04 | 4.07e-22 |
| 1. PB | Q1JPG1 | Radial spoke head 10 homolog B | 5.36e-10 | 2.26e-87 | 0.0 |
| 1. PB | Q9SFB8 | Phosphatidylinositol 4-phosphate 5-kinase 6 | 5.21e-03 | 1.23e-02 | 7.47e-27 |
| 3. B | Q8VHL1 | Histone-lysine N-methyltransferase SETD7 | 2.27e-02 | NA | 5.58e-05 |
| 3. B | Q28FE4 | MORN repeat-containing protein 5 | 1.08e-01 | NA | 0.007 |
| 3. B | Q9ET78 | Junctophilin-2 | 5.00e-03 | NA | 1.58e-10 |
| 3. B | A6QP75 | ALS2 C-terminal-like protein | 1.89e-03 | NA | 1.13e-14 |
| 3. B | Q60I26 | ALS2 C-terminal-like protein | 9.32e-03 | NA | 3.26e-14 |
| 3. B | Q60I27 | ALS2 C-terminal-like protein | 1.54e-03 | NA | 2.81e-15 |
| 3. B | Q4QQN5 | Histone-lysine N-methyltransferase SETD7 | 3.88e-02 | NA | 0.001 |
| 3. B | Q502X0 | MORN repeat-containing protein 2 | 4.46e-03 | NA | 0.004 |
| 3. B | P0C5Y8 | Alsin | 2.01e-02 | NA | 2.01e-18 |
| 3. B | Q8RY89 | Phosphatidylinositol 4-phosphate 5-kinase 8 | 4.70e-03 | NA | 1.11e-22 |
| 3. B | Q9BR39 | Junctophilin-2 | 2.28e-03 | NA | 1.23e-10 |
| 3. B | Q9VNZ8 | Alsin homolog | 1.02e-02 | NA | 4.85e-08 |
| 3. B | Q5R578 | MORN repeat-containing protein 4 | 2.18e-05 | NA | 5.96e-08 |
| 3. B | Q9ET77 | Junctophilin-3 | 3.10e-03 | NA | 5.21e-12 |
| 3. B | Q9HDC5 | Junctophilin-1 | 1.95e-03 | NA | 1.75e-12 |
| 3. B | Q5PPV3 | MORN repeat-containing protein 3 | 3.60e-05 | NA | 8.52e-15 |
| 3. B | Q8C5T4 | MORN repeat-containing protein 3 | 4.17e-05 | NA | 7.38e-15 |
| 3. B | Q27YU0 | Flagellar radial spoke protein 1 | 5.77e-02 | NA | 2.75e-13 |
| 3. B | Q9GKY8 | Junctophilin-1 | 4.65e-05 | NA | 1.97e-12 |
| 3. B | Q8WXH2 | Junctophilin-3 | 5.51e-03 | NA | 6.53e-12 |
| 3. B | Q6UL01 | MORN repeat-containing protein 2 | 4.24e-03 | NA | 0.037 |
| 3. B | Q9ET80 | Junctophilin-1 | 5.01e-03 | NA | 3.69e-13 |
| 3. B | Q0VD26 | MORN repeat-containing protein 4 | 2.51e-05 | NA | 4.26e-08 |
| 3. B | Q8WTS6 | Histone-lysine N-methyltransferase SETD7 | 2.18e-02 | NA | 5.43e-05 |
| 3. B | Q5BIW4 | Alsin | 3.77e-02 | NA | 9.65e-19 |
| 3. B | Q6PF18 | MORN repeat-containing protein 3 | 1.21e-05 | NA | 1.48e-16 |
| 3. B | Q96Q42 | Alsin | 2.06e-02 | NA | 9.02e-19 |
| 3. B | Q6DHG0 | Histone-lysine N-methyltransferase SETD7 | 1.80e-02 | NA | 0.002 |
| 3. B | Q8VIG3 | Radial spoke head 1 homolog | 4.98e-07 | NA | 2.96e-18 |
| 3. B | Q6VTH5 | Radial spoke head 1 homolog | 2.57e-05 | NA | 7.45e-14 |
| 3. B | Q920R0 | Alsin | 5.90e-02 | NA | 6.40e-19 |
| 3. B | Q6PGF2 | MORN repeat-containing protein 4 | 2.44e-05 | NA | 6.08e-08 |
| 3. B | Q6F6B5 | Protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 3 | 8.54e-02 | NA | 8.09e-05 |
| 3. B | Q5BJS9 | MORN repeat-containing protein 4 | 2.22e-05 | NA | 1.06e-07 |
| 3. B | Q8NDC4 | MORN repeat-containing protein 4 | 2.37e-05 | NA | 5.96e-08 |
| 3. B | Q4R842 | MORN repeat-containing protein 3 | 3.26e-05 | NA | 4.71e-16 |
| 3. B | Q9VN91 | MORN repeat-containing protein 4 homolog | 8.49e-05 | NA | 2.15e-08 |
| 3. B | Q8C0W1 | Ankyrin repeat and MYND domain-containing protein 1 | 2.69e-01 | NA | 0.002 |
| 3. B | Q9P2S6 | Ankyrin repeat and MYND domain-containing protein 1 | 5.20e-02 | NA | 4.97e-04 |
| 3. B | Q2PS20 | Junctophilin-2 | 8.76e-03 | NA | 1.70e-10 |
| 3. B | Q4VBJ9 | MORN repeat-containing protein 5 | 7.83e-02 | NA | 0.015 |
| 3. B | Q32KU3 | MORN repeat-containing protein 2 | 9.61e-04 | NA | 0.008 |
| 3. B | Q32KM6 | MORN repeat-containing protein 3 | 4.42e-05 | NA | 1.35e-17 |