Summary

B3KS81

Homolog: Q5T749.
Function: Keratinocyte proline-rich protein.

Statistics

Total GO Annotation: 115
Unique PROST Go: 32
Unique BLAST Go: 83

Total Homologs: 43
Unique PROST Homologs: 32
Unique BLAST Homologs: 10

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was Q5T749 (Keratinocyte proline-rich protein) with a FATCAT P-Value: 0.00201 and RMSD of 4.51 angstrom. The sequence alignment identity is 22.7%.
Structural alignment shown in left. Query protein B3KS81 colored as red in alignment, homolog Q5T749 colored as blue. Query protein B3KS81 is also shown in right top, homolog Q5T749 showed in right bottom. They are colored based on secondary structures. 

  B3KS81 -------------------------MSSPKRSSK-----P-SMSL--APSGSSMP-----TADPKPPASLKST--K--SATPN---RSLVPTKPATSRNS 55
  Q5T749 MCDQQQIQCRLPLQQCCVKGPSFCSSQSPFAQSQVVVQAPCEMQIVDCP--ASCPVQVCQVSD-QAPCQSQTTQVKCQSKTKQVKGQAQCQSK--TTQ-- 93

  B3KS81 VMSPSSSKS-TKSTSTKRAPSNRPSSRSRVRSKARTPSRVST---D------TRTS--KASKASDVRCHQRRGTH-SRGR----TP-GR-------RGSR 130
  Q5T749 VKGQAASQSQTSSVQS-QAPCQ--SEVSYVQCEASQP--VQTCFVECAPVCYTETCYVECPVQNYVPCPAPQPVQMYRGRPAVCQPQGRFSTQCQYQGSY 188

  B3KS81 SSKRSP---SRAS----TPGRIRTHGARPGMAS-----RVRT---PTSQQKGSRGKSYGRPRTSNRERSDSQPRNLSKKSYRPPGGSGIGRSSELAVTPS 215
  Q5T749 SSC-GPQFQSRATCNNYTP-QFQ---LRPSYSSCFPQYRSRTSFSPCVPQCQTQG-SYGS-FTEQH-RSRSTSRCLP-----PP------R--RLQLFPR 267

  B3KS81 TAKCQTPTGIPSK-EKSDNPSPSSSRKVKSYGQMIIPSREKSYSPTEMSSRVKSYNQASTRSRPQSHSQSRSPRRS-RSGSQKR-THSR--VRSHSWKRN 310
  Q5T749 S--C-SP---PRRFE------PCSS----SY----LPLR-----PSE---GFPNYCTPPRRSEP--IYNSRCPRRPISSCSQRRGPKCRIEISSPCCPRQ 337

  B3KS81 HSRARSRTRKGILSQMGRHSQSRSHSKGKSQNQSRTPRRGRSHNWSRNPSKERSHSHSRSSSKE-RDHRGSSSPRKESGRSQSGSPNKQRDHSRSRSPNK 409
  Q5T749 VPPQRCPVE---IPPIRR----RSQSCG--------PQ----PSWG-------------ASCPELRPH---VEPRP----LPSFCPPRRLD----QCP-- 392

  B3KS81 ARDRSRSRSPYKARDRSRSRSPNKARDCSRSRSPYKARDRSRSRS-PNKARDHSRSRSPNKA-RDRSRSRSPSKERDHSQLGSPSKERDHRRSRSPSKER 507
  Q5T749 --ESPLQRCPPPA-PRPRLR-P---EPCI-SLEP-------RPRPLPRQLSEPCLYPEPLPALRPTPR---P------VPLPRPG------QCEIP-EPR 461

  B3KS81 QCRQSRSSSKERDHRRSRSPSKERQRRQSRSPNKERDRSQSRSPSEEREHRQSRSPSKERDRRRWRSPSKERERRQSRSSSEERDHSRSRSPNKQSGYSR 607
  Q5T749 PCLQ------PCEH-----P--EPCPRPEPIP----------LPAP--------CPSPEPCRETWRSPSP------------------CWGPNPVP-Y-- 509

  B3KS81 PRASSKEKAHSRSRTPSKEGNHSQSRTSSKESDPSQ-STVPRSPDWKRSPTRTSSLSQNRTPSKTSSHSP-STFP-SGGQTLSQDDSQADATTSKATLPG 704
  Q5T749 ---------------PGDLGCH--------ESSPHRLDT--EAPYC--GPS-----SYNQGQESGAGCGPGDVFPERRGQ-----DGHGDQGNAFAGVKG 572

  B3KS81 ERSSSSSSKLA 715
  Q5T749 EAKSAYF---- 579

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0048029 monosaccharide binding
2. P GO:0045735 nutrient reservoir activity
2. P GO:0018149 peptide cross-linking
2. P GO:0030216 keratinocyte differentiation
2. P GO:0006357 regulation of transcription by RNA polymerase II
2. P GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
2. P GO:0070062 extracellular exosome
2. P GO:0048240 sperm capacitation
2. P GO:0002020 protease binding
2. P GO:0033234 negative regulation of protein sumoylation
2. P GO:0045948 positive regulation of translational initiation
2. P GO:0043036 starch grain
2. P GO:0031424 keratinization
2. P GO:0005184 neuropeptide hormone activity
2. P GO:0052576 carbohydrate storage
2. P GO:0070300 phosphatidic acid binding
2. P GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific
2. P GO:2001070 starch binding
2. P GO:0031514 motile cilium
2. P GO:1901318 negative regulation of flagellated sperm motility
2. P GO:0007218 neuropeptide signaling pathway
2. P GO:0043484 regulation of RNA splicing
2. P GO:0019731 antibacterial humoral response
2. P GO:0005576 extracellular region
2. P GO:0008494 translation activator activity
2. P GO:0070935 3'-UTR-mediated mRNA stabilization
2. P GO:1900005 positive regulation of serine-type endopeptidase activity
2. P GO:0010224 response to UV-B
2. P GO:0007338 single fertilization
2. P GO:0050817 coagulation
2. P GO:0003730 mRNA 3'-UTR binding
2. P GO:0001533 cornified envelope
3. B GO:1990414 replication-born double-strand break repair via sister chromatid exchange
3. B GO:0099184 structural constituent of postsynaptic intermediate filament cytoskeleton
3. B GO:0021766 hippocampus development
3. B GO:0007015 actin filament organization
3. B GO:1990830 cellular response to leukemia inhibitory factor
3. B GO:2000781 positive regulation of double-strand break repair
3. B GO:0051656 establishment of organelle localization
3. B GO:0007094 mitotic spindle assembly checkpoint signaling
3. B GO:0097418 neurofibrillary tangle
3. B GO:0015629 actin cytoskeleton
3. B GO:0097440 apical dendrite
3. B GO:0071169 establishment of protein localization to chromatin
3. B GO:1900006 positive regulation of dendrite development
3. B GO:0033693 neurofilament bundle assembly
3. B GO:1905406 positive regulation of mitotic cohesin loading
3. B GO:0035118 embryonic pectoral fin morphogenesis
3. B GO:0031625 ubiquitin protein ligase binding
3. B GO:1902513 regulation of organelle transport along microtubule
3. B GO:0030424 axon
3. B GO:0031297 replication fork processing
3. B GO:0071392 cellular response to estradiol stimulus
3. B GO:0045110 intermediate filament bundle assembly
3. B GO:0007605 sensory perception of sound
3. B GO:0019894 kinesin binding
3. B GO:0150017 basal proximal dendrite
3. B GO:0044877 protein-containing complex binding
3. B GO:0048589 developmental growth
3. B GO:0030496 midbody
3. B GO:0031103 axon regeneration
3. B GO:0120044 stereocilium base
3. B GO:0045179 apical cortex
3. B GO:0001552 ovarian follicle atresia
3. B GO:0000226 microtubule cytoskeleton organization
3. B GO:0098685 Schaffer collateral - CA1 synapse
3. B GO:0003146 heart jogging
3. B GO:0043204 perikaryon
3. B GO:0090307 mitotic spindle assembly
3. B GO:0007620 copulation
3. B GO:0050769 positive regulation of neurogenesis
3. B GO:0042220 response to cocaine
3. B GO:1900026 positive regulation of substrate adhesion-dependent cell spreading
3. B GO:1903935 response to sodium arsenite
3. B GO:0048936 peripheral nervous system neuron axonogenesis
3. B GO:0061564 axon development
3. B GO:0051015 actin filament binding
3. B GO:0015643 toxic substance binding
3. B GO:0005815 microtubule organizing center
3. B GO:0099160 postsynaptic intermediate filament cytoskeleton
3. B GO:0070050 neuron cellular homeostasis
3. B GO:1903937 response to acrylamide
3. B GO:0030031 cell projection assembly
3. B GO:0007420 brain development
3. B GO:0005200 structural constituent of cytoskeleton
3. B GO:0019901 protein kinase binding
3. B GO:0052795 exo-alpha-(2->6)-sialidase activity
3. B GO:0021510 spinal cord development
3. B GO:0090694 Scc2-Scc4 cohesin loading complex
3. B GO:0052796 exo-alpha-(2->8)-sialidase activity
3. B GO:0045104 intermediate filament cytoskeleton organization
3. B GO:0106333 subcortical maternal complex
3. B GO:0005883 neurofilament
3. B GO:0043025 neuronal cell body
3. B GO:0060088 auditory receptor cell stereocilium organization
3. B GO:0021987 cerebral cortex development
3. B GO:0070840 dynein complex binding
3. B GO:1905168 positive regulation of double-strand break repair via homologous recombination
3. B GO:0052794 exo-alpha-(2->3)-sialidase activity
3. B GO:0051016 barbed-end actin filament capping
3. B GO:0003007 heart morphogenesis
3. B GO:0014069 postsynaptic density
3. B GO:0048565 digestive tract development
3. B GO:0030047 actin modification
3. B GO:0071921 cohesin loading
3. B GO:0040019 positive regulation of embryonic development
3. B GO:0005882 intermediate filament
3. B GO:0048703 embryonic viscerocranium morphogenesis
3. B GO:0045159 myosin II binding
3. B GO:0005856 cytoskeleton
3. B GO:0034087 establishment of mitotic sister chromatid cohesion
3. B GO:0071447 cellular response to hydroperoxide
3. B GO:0060828 regulation of canonical Wnt signaling pathway
3. B GO:0060052 neurofilament cytoskeleton organization
3. B GO:0030674 protein-macromolecule adaptor activity

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB B3KS81 Serine/arginine repetitive matrix protein 5 0 1.40e-139 0.0
2. P B2RUR4 Keratinocyte proline-rich protein 2.45e-01 2.67e-03 NA
2. P Q8ISH7 Feeding circuit activating peptides 6.64e-01 4.02e-02 NA
2. P P10388 Glutenin, high molecular weight subunit DX5 3.89e-01 4.94e-02 NA
2. P P24708 Involucrin 8.35e-01 4.88e-03 NA
2. P Q9PJT6 Uncharacterized protein TC_0741 7.32e-01 4.52e-02 NA
2. P H0YM25 Golgin subfamily A member 6-like protein 22 9.97e-01 6.36e-04 NA
2. P Q7TQM5 Keratinocyte proline-rich protein 1.95e-01 7.34e-04 NA
2. P P24712 Involucrin 9.39e-01 2.18e-02 NA
2. P P24856 Ice-structuring glycoprotein (Fragment) 9.99e-01 4.88e-03 NA
2. P Q62513 Zinc finger protein 260 9.92e-01 3.84e-02 NA
2. P Q13117 Deleted in azoospermia protein 2 9.84e-01 7.34e-04 NA
2. P Q5H9T9 Fibrous sheath CABYR-binding protein 6.00e-02 1.16e-04 NA
2. P P0C7A5 Semenogelin-2 2.09e-01 6.97e-04 NA
2. P Q02383 Semenogelin-2 2.34e-01 7.31e-03 NA
2. P O77733 Semenogelin-1 2.54e-01 6.76e-07 NA
2. P P17941 Involucrin 8.51e-01 4.74e-03 NA
2. P Q28658 Small proline-rich protein 3 9.92e-01 3.03e-03 NA
2. P Q2T9N0 Fibrous sheath CABYR-binding protein 1.33e-01 3.29e-02 NA
2. P Q9FKA5 Uncharacterized protein At5g39570 8.15e-02 1.26e-02 NA
2. P Q86MA7 Protein PRQFV-amide 6.85e-01 6.10e-03 NA
2. P Q4V348 Zinc finger protein 658B 8.64e-01 4.05e-02 NA
2. P Q5U7M9 Semenogelin-2 NA 8.41e-05 NA
2. P Q5U7M8 Semenogelin-2 2.41e-01 1.07e-03 NA
2. P P0C7A4 Semenogelin-2 5.04e-01 6.97e-04 NA
2. P P10751 Zinc finger protein 11 9.87e-01 1.06e-02 NA
2. P Q5U7N1 Semenogelin-2 8.74e-02 2.49e-03 NA
2. P Q5T749 Keratinocyte proline-rich protein 2.01e-03 1.36e-04 NA
2. P Q95196 Semenogelin-2 6.20e-01 7.32e-06 NA
2. P Q95P23 Enterin neuropeptides 7.66e-01 2.34e-02 NA
2. P Q5U7N0 Semenogelin-2 NA 5.83e-05 NA
2. P Q27409 Adhesive plaque matrix protein 9.30e-01 1.15e-07 NA
2. P Q8IXT5 RNA-binding protein 12B 2.46e-01 7.80e-04 NA
3. B P16225 Sodium/potassium ATPase inhibitor SPAI-2 4.82e-01 NA 0.021
3. B P16884 Neurofilament heavy polypeptide 2.48e-01 NA 1.26e-08
3. B P12036 Neurofilament heavy polypeptide 2.80e-01 NA 0.001
3. B Q99KW3 TRIO and F-actin-binding protein 5.80e-01 NA 1.37e-05
3. B P23253 Sialidase 9.79e-01 NA 5.76e-04
3. B F1QBY1 Nipped-B-like protein B NA NA 6.19e-08
3. B Q9H2D6 TRIO and F-actin-binding protein 7.95e-01 NA 4.01e-04
3. B D3ZVV1 KH domain-containing protein 3 9.74e-01 NA 8.66e-10
3. B Q5UPJ3 Uncharacterized protein L116 NA NA 1.30e-05
3. B P19246 Neurofilament heavy polypeptide 2.81e-01 NA 3.88e-08