Results | PROST

Summary

B4E2M5

Homolog: Q6P1S6.
Function: Myotrophin.

Statistics

Total GO Annotation: 713
Unique PROST Go: 56
Unique BLAST Go: 581

Total Homologs: 691
Unique PROST Homologs: 32
Unique BLAST Homologs: 604

Structures and Sequence Alignment

The best structural homolog that predicted by 3. B was Q6P1S6 (Myotrophin) with a FATCAT P-Value: 8.22e-15 and RMSD of 1.45 angstrom. The sequence alignment identity is 16.0%.
Structural alignment shown in left. Query protein B4E2M5 colored as red in alignment, homolog Q6P1S6 colored as blue. Query protein B4E2M5 is also shown in right top, homolog Q6P1S6 showed in right bottom. They are colored based on secondary structures.

  B4E2M5 MDTTLRMVRTACQHRAPQISHKTGCSHISMHSPGGLTTTKMAGPLPRVSDSLFSAMELAKMSDMTK-LHQAVAAGDYSLVKK-ILKKGLCDPNYKDVDWN 98
  Q6P1S6 ------------------------------------------------------------MGD--KEFVWAIKNGDLDAVKEFVL--GGEDVN-RTLD-G 34

  B4E2M5 DRTPLHWAAIKGQMEVIRLLIEYGARPCLVTSV---GWTPAHFAAEAGHLNILKTLHALHAAID----APDFFGDTPKRIAQIYGQKACVAFLEKAEPEC 191
  Q6P1S6 GRKPMHYAADCGQDEVLEFLLSKGAN---INAADKHGITPLLSACYEGHRKCVELL--LSKGADKTVKGPD-------------GLNA----LESTDNQA 112

  B4E2M5 -QD--HRCAAQQKGLPLDERDEDWDAKKRELELSLPSLNQNMNKKNKKSRGPTRPSNTKGRRV 251
  Q6P1S6 IKDLLH--------------------------------------------------------- 118

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
1. PB	GO:0051489	regulation of filopodium assembly
1. PB	GO:0001938	positive regulation of endothelial cell proliferation
1. PB	GO:0000082	G1/S transition of mitotic cell cycle
1. PB	GO:2000346	negative regulation of hepatocyte proliferation
1. PB	GO:0090398	cellular senescence
1. PB	GO:0061630	ubiquitin protein ligase activity
1. PB	GO:0090399	replicative senescence
1. PB	GO:0034587	piRNA metabolic process
1. PB	GO:0032695	negative regulation of interleukin-12 production
1. PB	GO:0030154	cell differentiation
1. PB	GO:0060058	positive regulation of apoptotic process involved in mammary gland involution
1. PB	GO:0035986	obsolete senescence-associated heterochromatin focus assembly
1. PB	GO:0046822	regulation of nucleocytoplasmic transport
1. PB	GO:1904385	cellular response to angiotensin
1. PB	GO:0045786	negative regulation of cell cycle
1. PB	GO:1900127	positive regulation of hyaluronan biosynthetic process
1. PB	GO:0035304	regulation of protein dephosphorylation
1. PB	GO:0030308	negative regulation of cell growth
1. PB	GO:0042995	cell projection
1. PB	GO:0071359	cellular response to dsRNA
1. PB	GO:0071546	pi-body
1. PB	GO:0071316	cellular response to nicotine
1. PB	GO:2000111	positive regulation of macrophage apoptotic process
1. PB	GO:0007283	spermatogenesis
1. PB	GO:0033600	negative regulation of mammary gland epithelial cell proliferation
1. PB	GO:0097371	MDM2/MDM4 family protein binding
1. PB	GO:0061028	establishment of endothelial barrier
1. PB	GO:0035307	positive regulation of protein dephosphorylation
1. PB	GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity
1. PB	GO:0010956	negative regulation of calcidiol 1-monooxygenase activity
1. PB	GO:0034393	positive regulation of smooth muscle cell apoptotic process
1. PB	GO:0035994	response to muscle stretch
1. PB	GO:0051865	protein autoubiquitination
1. PB	GO:0035985	senescence-associated heterochromatin focus
1. PB	GO:1904632	cellular response to glucoside
1. PB	GO:1903051	negative regulation of proteolysis involved in cellular protein catabolic process
1. PB	GO:0016567	protein ubiquitination
1. PB	GO:1903670	regulation of sprouting angiogenesis
1. PB	GO:0051059	NF-kappaB binding
1. PB	GO:0032091	negative regulation of protein binding
1. PB	GO:0032991	protein-containing complex
1. PB	GO:0071322	cellular response to carbohydrate stimulus
1. PB	GO:2000059	negative regulation of ubiquitin-dependent protein catabolic process
1. PB	GO:0043046	DNA methylation involved in gamete generation
1. PB	GO:1990416	cellular response to brain-derived neurotrophic factor stimulus
1. PB	GO:0035308	negative regulation of protein dephosphorylation
1. PB	GO:1904630	cellular response to diterpene
1. PB	GO:0004861	cyclin-dependent protein serine/threonine kinase inhibitor activity
1. PB	GO:0017020	myosin phosphatase regulator activity
1. PB	GO:0014066	regulation of phosphatidylinositol 3-kinase signaling
1. PB	GO:2000630	positive regulation of miRNA metabolic process
1. PB	GO:0007569	cell aging
1. PB	GO:0045736	negative regulation of cyclin-dependent protein serine/threonine kinase activity
1. PB	GO:0019888	protein phosphatase regulator activity
1. PB	GO:0010366	negative regulation of ethylene biosynthetic process
1. PB	GO:2000774	positive regulation of cellular senescence
1. PB	GO:0001953	negative regulation of cell-matrix adhesion
1. PB	GO:0004842	ubiquitin-protein transferase activity
1. PB	GO:0031047	gene silencing by RNA
1. PB	GO:0060236	regulation of mitotic spindle organization
1. PB	GO:0035556	intracellular signal transduction
1. PB	GO:1903589	positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis
1. PB	GO:0007140	male meiotic nuclear division
1. PB	GO:0071354	cellular response to interleukin-6
1. PB	GO:0035914	skeletal muscle cell differentiation
1. PB	GO:0042805	actinin binding
1. PB	GO:0008157	protein phosphatase 1 binding
1. PB	GO:0042326	negative regulation of phosphorylation
1. PB	GO:1901653	cellular response to peptide
1. PB	GO:1902309	negative regulation of peptidyl-serine dephosphorylation
1. PB	GO:0014070	response to organic cyclic compound
1. PB	GO:0031462	Cul2-RING ubiquitin ligase complex
1. PB	GO:0043517	positive regulation of DNA damage response, signal transduction by p53 class mediator
1. PB	GO:1902412	regulation of mitotic cytokinesis
1. PB	GO:0032088	negative regulation of NF-kappaB transcription factor activity
1. PB	GO:0005654	nucleoplasm
2. P	GO:0061771	response to caloric restriction
2. P	GO:1902510	regulation of apoptotic DNA fragmentation
2. P	GO:0033088	negative regulation of immature T cell proliferation in thymus
2. P	GO:0010389	regulation of G2/M transition of mitotic cell cycle
2. P	GO:1902554	serine/threonine protein kinase complex
2. P	GO:0008637	apoptotic mitochondrial changes
2. P	GO:0031466	Cul5-RING ubiquitin ligase complex
2. P	GO:1902911	protein kinase complex
2. P	GO:0019789	SUMO transferase activity
2. P	GO:0030430	host cell cytoplasm
2. P	GO:1900017	positive regulation of cytokine production involved in inflammatory response
2. P	GO:1903214	regulation of protein targeting to mitochondrion
2. P	GO:0051882	mitochondrial depolarization
2. P	GO:1904667	negative regulation of ubiquitin protein ligase activity
2. P	GO:0039517	modulation by virus of host protein serine/threonine phosphatase activity
2. P	GO:0010243	response to organonitrogen compound
2. P	GO:0000056	ribosomal small subunit export from nucleus
2. P	GO:1990948	ubiquitin ligase inhibitor activity
2. P	GO:0030907	MBF transcription complex
2. P	GO:0008156	negative regulation of DNA replication
2. P	GO:0042493
2. P	GO:2000637	positive regulation of gene silencing by miRNA
2. P	GO:2000678	negative regulation of transcription regulatory region DNA binding
2. P	GO:2001214	positive regulation of vasculogenesis
2. P	GO:0030539	male genitalia development
2. P	GO:0070301	cellular response to hydrogen peroxide
2. P	GO:0007343	egg activation
2. P	GO:0055105	ubiquitin-protein transferase inhibitor activity
2. P	GO:0071931	positive regulation of transcription involved in G1/S transition of mitotic cell cycle
2. P	GO:0042025	host cell nucleus
2. P	GO:0010311	lateral root formation
2. P	GO:0033235	positive regulation of protein sumoylation
2. P	GO:0051090	regulation of DNA-binding transcription factor activity
2. P	GO:0047485	protein N-terminus binding
2. P	GO:1990000	amyloid fibril formation
2. P	GO:0042281	dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase activity
2. P	GO:0030889	negative regulation of B cell proliferation
2. P	GO:0039513	suppression by virus of host catalytic activity
2. P	GO:0016607	nuclear speck
2. P	GO:0046825	regulation of protein export from nucleus
2. P	GO:0008544	epidermis development
2. P	GO:1901798	positive regulation of signal transduction by p53 class mediator
2. P	GO:0007568	aging
2. P	GO:0039644	suppression by virus of host NF-kappaB cascade
2. P	GO:0033309	SBF transcription complex
2. P	GO:2000435	negative regulation of protein neddylation
2. P	GO:0016740	transferase activity
2. P	GO:0042593	glucose homeostasis
2. P	GO:0006490	oligosaccharide-lipid intermediate biosynthetic process
2. P	GO:0035019	somatic stem cell population maintenance
2. P	GO:0001652	granular component
2. P	GO:0009303	rRNA transcription
2. P	GO:0051444	negative regulation of ubiquitin-protein transferase activity
2. P	GO:0048103	somatic stem cell division
2. P	GO:0002523	leukocyte migration involved in inflammatory response
2. P	GO:0051091	positive regulation of DNA-binding transcription factor activity
3. B	GO:0005770	late endosome
3. B	GO:0008277	regulation of G protein-coupled receptor signaling pathway
3. B	GO:0034765	regulation of ion transmembrane transport
3. B	GO:0007094	mitotic spindle assembly checkpoint signaling
3. B	GO:0071625	vocalization behavior
3. B	GO:0042994	cytoplasmic sequestering of transcription factor
3. B	GO:0000122	negative regulation of transcription by RNA polymerase II
3. B	GO:0050729	positive regulation of inflammatory response
3. B	GO:0090037	positive regulation of protein kinase C signaling
3. B	GO:0006511	ubiquitin-dependent protein catabolic process
3. B	GO:0007205	protein kinase C-activating G protein-coupled receptor signaling pathway
3. B	GO:0007507	heart development
3. B	GO:0001701	in utero embryonic development
3. B	GO:0072104	glomerular capillary formation
3. B	GO:1903779	regulation of cardiac conduction
3. B	GO:0042088	T-helper 1 type immune response
3. B	GO:0070563	negative regulation of vitamin D receptor signaling pathway
3. B	GO:0030334	regulation of cell migration
3. B	GO:0032421	stereocilium bundle
3. B	GO:2001259	positive regulation of cation channel activity
3. B	GO:0051247	positive regulation of protein metabolic process
3. B	GO:0070372	regulation of ERK1 and ERK2 cascade
3. B	GO:1903522	regulation of blood circulation
3. B	GO:0045663	positive regulation of myoblast differentiation
3. B	GO:0014044	Schwann cell development
3. B	GO:0006306	DNA methylation
3. B	GO:0097190	apoptotic signaling pathway
3. B	GO:0106310	protein serine kinase activity
3. B	GO:0019903	protein phosphatase binding
3. B	GO:0106015	negative regulation of inflammatory response to wounding
3. B	GO:0085020	protein K6-linked ubiquitination
3. B	GO:0047499	calcium-independent phospholipase A2 activity
3. B	GO:0043403	skeletal muscle tissue regeneration
3. B	GO:0051494	negative regulation of cytoskeleton organization
3. B	GO:0003950	NAD+ ADP-ribosyltransferase activity
3. B	GO:0032420	stereocilium
3. B	GO:0035264	multicellular organism growth
3. B	GO:0021519	spinal cord association neuron specification
3. B	GO:0015095	magnesium ion transmembrane transporter activity
3. B	GO:0045611	negative regulation of hemocyte differentiation
3. B	GO:0035622	intrahepatic bile duct development
3. B	GO:0045737	positive regulation of cyclin-dependent protein serine/threonine kinase activity
3. B	GO:0045036	protein targeting to chloroplast
3. B	GO:0033257	Bcl3/NF-kappaB2 complex
3. B	GO:0016571	histone methylation
3. B	GO:0043254	regulation of protein-containing complex assembly
3. B	GO:0010765	positive regulation of sodium ion transport
3. B	GO:0010557	positive regulation of macromolecule biosynthetic process
3. B	GO:1902367	negative regulation of Notch signaling pathway involved in somitogenesis
3. B	GO:0035690
3. B	GO:0048549	positive regulation of pinocytosis
3. B	GO:0030534	adult behavior
3. B	GO:0034976	response to endoplasmic reticulum stress
3. B	GO:0072659	protein localization to plasma membrane
3. B	GO:0086015	SA node cell action potential
3. B	GO:0032466	negative regulation of cytokinesis
3. B	GO:1990404	protein ADP-ribosylase activity
3. B	GO:0005903	brush border
3. B	GO:0061073	ciliary body morphogenesis
3. B	GO:0051092	positive regulation of NF-kappaB transcription factor activity
3. B	GO:0043015	gamma-tubulin binding
3. B	GO:0036464	cytoplasmic ribonucleoprotein granule
3. B	GO:1902807	negative regulation of cell cycle G1/S phase transition
3. B	GO:0003151	outflow tract morphogenesis
3. B	GO:0007520	myoblast fusion
3. B	GO:0006913	nucleocytoplasmic transport
3. B	GO:0072014	proximal tubule development
3. B	GO:0002039	p53 binding
3. B	GO:0031286	negative regulation of sorocarp stalk cell differentiation
3. B	GO:0080173	male-female gamete recognition during double fertilization forming a zygote and endosperm
3. B	GO:0042734	presynaptic membrane
3. B	GO:0050953	sensory perception of light stimulus
3. B	GO:0070417	cellular response to cold
3. B	GO:0010564	regulation of cell cycle process
3. B	GO:0034142	toll-like receptor 4 signaling pathway
3. B	GO:0005123	death receptor binding
3. B	GO:0032426	stereocilium tip
3. B	GO:0008608	attachment of spindle microtubules to kinetochore
3. B	GO:0043409	negative regulation of MAPK cascade
3. B	GO:0043008	ATP-dependent protein binding
3. B	GO:1900119	positive regulation of execution phase of apoptosis
3. B	GO:0043086	negative regulation of catalytic activity
3. B	GO:0022011	myelination in peripheral nervous system
3. B	GO:0007249	I-kappaB kinase/NF-kappaB signaling
3. B	GO:0010313	phytochrome binding
3. B	GO:0050894	determination of affect
3. B	GO:0045638	negative regulation of myeloid cell differentiation
3. B	GO:0099562	maintenance of postsynaptic density structure
3. B	GO:0000209	protein polyubiquitination
3. B	GO:0001947	heart looping
3. B	GO:0090201	negative regulation of release of cytochrome c from mitochondria
3. B	GO:0002027	regulation of heart rate
3. B	GO:2000178	negative regulation of neural precursor cell proliferation
3. B	GO:1904970	brush border assembly
3. B	GO:0044325	transmembrane transporter binding
3. B	GO:0030496	midbody
3. B	GO:0005634	nucleus
3. B	GO:0072116	pronephros formation
3. B	GO:1990760	osmolarity-sensing cation channel activity
3. B	GO:0046875	ephrin receptor binding
3. B	GO:0030660	Golgi-associated vesicle membrane
3. B	GO:0002789	negative regulation of antifungal peptide production
3. B	GO:0046826	negative regulation of protein export from nucleus
3. B	GO:1900246	positive regulation of RIG-I signaling pathway
3. B	GO:1904901	positive regulation of myosin II filament organization
3. B	GO:0070528	protein kinase C signaling
3. B	GO:0097129	cyclin D2-CDK4 complex
3. B	GO:0007253	cytoplasmic sequestering of NF-kappaB
3. B	GO:0060999	positive regulation of dendritic spine development
3. B	GO:0005516	calmodulin binding
3. B	GO:0001568	blood vessel development
3. B	GO:0010875	positive regulation of cholesterol efflux
3. B	GO:0045746	negative regulation of Notch signaling pathway
3. B	GO:0035774	positive regulation of insulin secretion involved in cellular response to glucose stimulus
3. B	GO:0097604	temperature-gated cation channel activity
3. B	GO:0070213	protein auto-ADP-ribosylation
3. B	GO:0004672	protein kinase activity
3. B	GO:0043330	response to exogenous dsRNA
3. B	GO:0010923	negative regulation of phosphatase activity
3. B	GO:0031877	somatostatin receptor binding
3. B	GO:0048812	neuron projection morphogenesis
3. B	GO:0033292	T-tubule organization
3. B	GO:0005769	early endosome
3. B	GO:0071356	cellular response to tumor necrosis factor
3. B	GO:0002043	blood vessel endothelial cell proliferation involved in sprouting angiogenesis
3. B	GO:0061629	RNA polymerase II-specific DNA-binding transcription factor binding
3. B	GO:1904108	protein localization to ciliary inversin compartment
3. B	GO:0005525	GTP binding
3. B	GO:1900245	positive regulation of MDA-5 signaling pathway
3. B	GO:0044305	calyx of Held
3. B	GO:0006915	apoptotic process
3. B	GO:0046475	glycerophospholipid catabolic process
3. B	GO:0106311
3. B	GO:0014832	urinary bladder smooth muscle contraction
3. B	GO:0071889	14-3-3 protein binding
3. B	GO:0032691	negative regulation of interleukin-1 beta production
3. B	GO:0006606	protein import into nucleus
3. B	GO:0090521	glomerular visceral epithelial cell migration
3. B	GO:0031436	BRCA1-BARD1 complex
3. B	GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process
3. B	GO:0045944	positive regulation of transcription by RNA polymerase II
3. B	GO:0030307	positive regulation of cell growth
3. B	GO:0099092	postsynaptic density, intracellular component
3. B	GO:0045893	positive regulation of transcription, DNA-templated
3. B	GO:0005249	voltage-gated potassium channel activity
3. B	GO:0045211	postsynaptic membrane
3. B	GO:0010838	positive regulation of keratinocyte proliferation
3. B	GO:0046834	lipid phosphorylation
3. B	GO:0010976	positive regulation of neuron projection development
3. B	GO:0031941	filamentous actin
3. B	GO:0030017	sarcomere
3. B	GO:0032270	positive regulation of cellular protein metabolic process
3. B	GO:0045581	negative regulation of T cell differentiation
3. B	GO:0043491	protein kinase B signaling
3. B	GO:0005902	microvillus
3. B	GO:0036336	dendritic cell migration
3. B	GO:0050680	negative regulation of epithelial cell proliferation
3. B	GO:0016055	Wnt signaling pathway
3. B	GO:0051967	negative regulation of synaptic transmission, glutamatergic
3. B	GO:0061195	taste bud formation
3. B	GO:0018345	protein palmitoylation
3. B	GO:1904106	protein localization to microvillus
3. B	GO:0032288	myelin assembly
3. B	GO:0015271	outward rectifier potassium channel activity
3. B	GO:0002011	morphogenesis of an epithelial sheet
3. B	GO:0006537	glutamate biosynthetic process
3. B	GO:0071212	subsynaptic reticulum
3. B	GO:0031670	cellular response to nutrient
3. B	GO:0030016	myofibril
3. B	GO:0006584	catecholamine metabolic process
3. B	GO:0060743	epithelial cell maturation involved in prostate gland development
3. B	GO:0055117	regulation of cardiac muscle contraction
3. B	GO:0071345	cellular response to cytokine stimulus
3. B	GO:2000646	positive regulation of receptor catabolic process
3. B	GO:0006929	substrate-dependent cell migration
3. B	GO:0030424	axon
3. B	GO:0007409	axonogenesis
3. B	GO:0051146	striated muscle cell differentiation
3. B	GO:0045171	intercellular bridge
3. B	GO:0035255	ionotropic glutamate receptor binding
3. B	GO:0003714	transcription corepressor activity
3. B	GO:0043069	negative regulation of programmed cell death
3. B	GO:1902260	negative regulation of delayed rectifier potassium channel activity
3. B	GO:0031013	troponin I binding
3. B	GO:0031430	M band
3. B	GO:0070198	protein localization to chromosome, telomeric region
3. B	GO:0090238	positive regulation of arachidonic acid secretion
3. B	GO:0045751	negative regulation of Toll signaling pathway
3. B	GO:0007030	Golgi organization
3. B	GO:0045838	positive regulation of membrane potential
3. B	GO:0005929	cilium
3. B	GO:0036371	protein localization to T-tubule
3. B	GO:0060076	excitatory synapse
3. B	GO:0070742	C2H2 zinc finger domain binding
3. B	GO:0140627	ubiquitin-dependent protein catabolic process via the C-end degron rule pathway
3. B	GO:0072332	intrinsic apoptotic signaling pathway by p53 class mediator
3. B	GO:2000812	regulation of barbed-end actin filament capping
3. B	GO:0010424	DNA methylation on cytosine within a CG sequence
3. B	GO:0051101	regulation of DNA binding
3. B	GO:0014731	spectrin-associated cytoskeleton
3. B	GO:0005737	cytoplasm
3. B	GO:0098978	glutamatergic synapse
3. B	GO:2000001	regulation of DNA damage checkpoint
3. B	GO:0055013	cardiac muscle cell development
3. B	GO:0072114	pronephros morphogenesis
3. B	GO:0071560	cellular response to transforming growth factor beta stimulus
3. B	GO:0010882	regulation of cardiac muscle contraction by calcium ion signaling
3. B	GO:0043005	neuron projection
3. B	GO:0098871	postsynaptic actin cytoskeleton
3. B	GO:0097435	supramolecular fiber organization
3. B	GO:0014704	intercalated disc
3. B	GO:0019901	protein kinase binding
3. B	GO:0046959	habituation
3. B	GO:0001955	blood vessel maturation
3. B	GO:0010225	response to UV-C
3. B	GO:0032013	negative regulation of ARF protein signal transduction
3. B	GO:0099519	dense core granule cytoskeletal transport
3. B	GO:0007219	Notch signaling pathway
3. B	GO:0031441	negative regulation of mRNA 3'-end processing
3. B	GO:0032232	negative regulation of actin filament bundle assembly
3. B	GO:0034638	phosphatidylcholine catabolic process
3. B	GO:0021546	rhombomere development
3. B	GO:0033280	response to vitamin D
3. B	GO:0046976	histone methyltransferase activity (H3-K27 specific)
3. B	GO:1905274	regulation of modification of postsynaptic actin cytoskeleton
3. B	GO:0005856	cytoskeleton
3. B	GO:0042048	olfactory behavior
3. B	GO:0071222	cellular response to lipopolysaccharide
3. B	GO:0071447	cellular response to hydroperoxide
3. B	GO:0032580	Golgi cisterna membrane
3. B	GO:0000731	DNA synthesis involved in DNA repair
3. B	GO:0016529	sarcoplasmic reticulum
3. B	GO:0071800	podosome assembly
3. B	GO:0061743	motor learning
3. B	GO:0005096	GTPase activator activity
3. B	GO:0030034	microvillar actin bundle assembly
3. B	GO:1901222	regulation of NIK/NF-kappaB signaling
3. B	GO:1904743	negative regulation of telomeric DNA binding
3. B	GO:0071347	cellular response to interleukin-1
3. B	GO:1900383	regulation of synaptic plasticity by receptor localization to synapse
3. B	GO:0072660	maintenance of protein location in plasma membrane
3. B	GO:0015629	actin cytoskeleton
3. B	GO:0009967	positive regulation of signal transduction
3. B	GO:0086004	regulation of cardiac muscle cell contraction
3. B	GO:0055007	cardiac muscle cell differentiation
3. B	GO:0031674	I band
3. B	GO:2000134	negative regulation of G1/S transition of mitotic cell cycle
3. B	GO:0043197	dendritic spine
3. B	GO:0099645	neurotransmitter receptor localization to postsynaptic specialization membrane
3. B	GO:0102991	myristoyl-CoA hydrolase activity
3. B	GO:1901187	regulation of ephrin receptor signaling pathway
3. B	GO:0010378	temperature compensation of the circadian clock
3. B	GO:0008285	negative regulation of cell population proliferation
3. B	GO:0045197	establishment or maintenance of epithelial cell apical/basal polarity
3. B	GO:0043054	dauer exit
3. B	GO:0090063	positive regulation of microtubule nucleation
3. B	GO:0060674	placenta blood vessel development
3. B	GO:0033209	tumor necrosis factor-mediated signaling pathway
3. B	GO:0036309	protein localization to M-band
3. B	GO:0001957	intramembranous ossification
3. B	GO:0065001	specification of axis polarity
3. B	GO:0050750	low-density lipoprotein particle receptor binding
3. B	GO:0086069	bundle of His cell to Purkinje myocyte communication
3. B	GO:0045732	positive regulation of protein catabolic process
3. B	GO:0034446	substrate adhesion-dependent cell spreading
3. B	GO:0002357	defense response to tumor cell
3. B	GO:0002070	epithelial cell maturation
3. B	GO:0031432	titin binding
3. B	GO:0034112	positive regulation of homotypic cell-cell adhesion
3. B	GO:0022407	regulation of cell-cell adhesion
3. B	GO:0060442	branching involved in prostate gland morphogenesis
3. B	GO:0006471	protein ADP-ribosylation
3. B	GO:0070531	BRCA1-A complex
3. B	GO:0099171	presynaptic modulation of chemical synaptic transmission
3. B	GO:0086070	SA node cell to atrial cardiac muscle cell communication
3. B	GO:0042327	positive regulation of phosphorylation
3. B	GO:0070972	protein localization to endoplasmic reticulum
3. B	GO:0090160	Golgi to lysosome transport
3. B	GO:0043268	positive regulation of potassium ion transport
3. B	GO:0035518	histone H2A monoubiquitination
3. B	GO:0016021	integral component of membrane
3. B	GO:0031267	small GTPase binding
3. B	GO:0042981	regulation of apoptotic process
3. B	GO:0060035	notochord cell development
3. B	GO:0045685	regulation of glial cell differentiation
3. B	GO:0030513	positive regulation of BMP signaling pathway
3. B	GO:1902531	regulation of intracellular signal transduction
3. B	GO:0000062	fatty-acyl-CoA binding
3. B	GO:1900827	positive regulation of membrane depolarization during cardiac muscle cell action potential
3. B	GO:0060074	synapse maturation
3. B	GO:0048892	lateral line nerve development
3. B	GO:0032049	cardiolipin biosynthetic process
3. B	GO:0008093	cytoskeletal anchor activity
3. B	GO:0010667	negative regulation of cardiac muscle cell apoptotic process
3. B	GO:0038061	NIK/NF-kappaB signaling
3. B	GO:0003170	heart valve development
3. B	GO:0019730	antimicrobial humoral response
3. B	GO:0005938	cell cortex
3. B	GO:0042802	identical protein binding
3. B	GO:0030674	protein-macromolecule adaptor activity
3. B	GO:0046486	glycerolipid metabolic process
3. B	GO:0034058	endosomal vesicle fusion
3. B	GO:0071286	cellular response to magnesium ion
3. B	GO:0050775	positive regulation of dendrite morphogenesis
3. B	GO:0032717	negative regulation of interleukin-8 production
3. B	GO:0060113	inner ear receptor cell differentiation
3. B	GO:0043034	costamere
3. B	GO:0045967	negative regulation of growth rate
3. B	GO:0030100	regulation of endocytosis
3. B	GO:0018230	peptidyl-L-cysteine S-palmitoylation
3. B	GO:0032791	lead ion binding
3. B	GO:0007626	locomotory behavior
3. B	GO:0031297	replication fork processing
3. B	GO:0030046	parallel actin filament bundle assembly
3. B	GO:0046843	dorsal appendage formation
3. B	GO:0036166	phenotypic switching
3. B	GO:0046469	platelet activating factor metabolic process
3. B	GO:0007605	sensory perception of sound
3. B	GO:0043052	thermotaxis
3. B	GO:0044877	protein-containing complex binding
3. B	GO:0005576	extracellular region
3. B	GO:0019887	protein kinase regulator activity
3. B	GO:0046974	histone methyltransferase activity (H3-K9 specific)
3. B	GO:0098908	regulation of neuronal action potential
3. B	GO:0018024	histone-lysine N-methyltransferase activity
3. B	GO:0030018	Z disc
3. B	GO:0002467	germinal center formation
3. B	GO:0098879	structural constituent of postsynaptic specialization
3. B	GO:0097431	mitotic spindle pole
3. B	GO:0001569	branching involved in blood vessel morphogenesis
3. B	GO:0036377	arbuscular mycorrhizal association
3. B	GO:0043063	intercellular bridge organization
3. B	GO:0046473	phosphatidic acid metabolic process
3. B	GO:0099612	protein localization to axon
3. B	GO:1902041	regulation of extrinsic apoptotic signaling pathway via death domain receptors
3. B	GO:0045669	positive regulation of osteoblast differentiation
3. B	GO:0005524	ATP binding
3. B	GO:1905456	regulation of lymphoid progenitor cell differentiation
3. B	GO:0046338	phosphatidylethanolamine catabolic process
3. B	GO:0071260	cellular response to mechanical stimulus
3. B	GO:0090216	positive regulation of 1-phosphatidylinositol-4-phosphate 5-kinase activity
3. B	GO:0097422	tubular endosome
3. B	GO:0018027	peptidyl-lysine dimethylation
3. B	GO:0035176	social behavior
3. B	GO:0010960	magnesium ion homeostasis
3. B	GO:2001204	regulation of osteoclast development
3. B	GO:0001650	fibrillar center
3. B	GO:0048536	spleen development
3. B	GO:0042826	histone deacetylase binding
3. B	GO:0140261	BCOR complex
3. B	GO:0035418	protein localization to synapse
3. B	GO:0005886	plasma membrane
3. B	GO:0042325	regulation of phosphorylation
3. B	GO:0021675	nerve development
3. B	GO:0035646	endosome to melanosome transport
3. B	GO:0044232	organelle membrane contact site
3. B	GO:0001841	neural tube formation
3. B	GO:0030219	megakaryocyte differentiation
3. B	GO:0048899	anterior lateral line development
3. B	GO:0001222	transcription corepressor binding
3. B	GO:0010434	bract formation
3. B	GO:0033147	negative regulation of intracellular estrogen receptor signaling pathway
3. B	GO:0007009	plasma membrane organization
3. B	GO:0043292	contractile fiber
3. B	GO:0032996	Bcl3-Bcl10 complex
3. B	GO:0019843	rRNA binding
3. B	GO:0070212	protein poly-ADP-ribosylation
3. B	GO:2000300	regulation of synaptic vesicle exocytosis
3. B	GO:1904058	positive regulation of sensory perception of pain
3. B	GO:0007160	cell-matrix adhesion
3. B	GO:0009066	aspartate family amino acid metabolic process
3. B	GO:0000151	ubiquitin ligase complex
3. B	GO:0030160	synaptic receptor adaptor activity
3. B	GO:0019228	neuronal action potential
3. B	GO:0046339	diacylglycerol metabolic process
3. B	GO:0072073	kidney epithelium development
3. B	GO:0045859	regulation of protein kinase activity
3. B	GO:0051569	regulation of histone H3-K4 methylation
3. B	GO:0004622	lysophospholipase activity
3. B	GO:0072357	PTW/PP1 phosphatase complex
3. B	GO:0009925	basal plasma membrane
3. B	GO:0070316	regulation of G0 to G1 transition
3. B	GO:0008022	protein C-terminus binding
3. B	GO:0010650	positive regulation of cell communication by electrical coupling
3. B	GO:0010638	positive regulation of organelle organization
3. B	GO:0060998	regulation of dendritic spine development
3. B	GO:0048102	autophagic cell death
3. B	GO:1901216	positive regulation of neuron death
3. B	GO:0006897	endocytosis
3. B	GO:0032934	sterol binding
3. B	GO:0070650	actin filament bundle distribution
3. B	GO:0055008	cardiac muscle tissue morphogenesis
3. B	GO:1901339	regulation of store-operated calcium channel activity
3. B	GO:0006887	exocytosis
3. B	GO:0071314	cellular response to cocaine
3. B	GO:0000242	pericentriolar material
3. B	GO:2000096	positive regulation of Wnt signaling pathway, planar cell polarity pathway
3. B	GO:0016604	nuclear body
3. B	GO:0003723	RNA binding
3. B	GO:0098685	Schaffer collateral - CA1 synapse
3. B	GO:0042665	regulation of ectodermal cell fate specification
3. B	GO:0098907	regulation of SA node cell action potential
3. B	GO:0003408	optic cup formation involved in camera-type eye development
3. B	GO:1905383	protein localization to presynapse
3. B	GO:1905453	regulation of myeloid progenitor cell differentiation
3. B	GO:1900026	positive regulation of substrate adhesion-dependent cell spreading
3. B	GO:0035965	cardiolipin acyl-chain remodeling
3. B	GO:0003677	DNA binding
3. B	GO:0048471	perinuclear region of cytoplasm
3. B	GO:0030155	regulation of cell adhesion
3. B	GO:0086014	atrial cardiac muscle cell action potential
3. B	GO:0016409	palmitoyltransferase activity
3. B	GO:0008270	zinc ion binding
3. B	GO:0003184	pulmonary valve morphogenesis
3. B	GO:0046957	negative phototaxis
3. B	GO:0030507	spectrin binding
3. B	GO:0043518	negative regulation of DNA damage response, signal transduction by p53 class mediator
3. B	GO:1904908	negative regulation of maintenance of mitotic sister chromatid cohesion, telomeric
3. B	GO:0047389	glycerophosphocholine phosphodiesterase activity
3. B	GO:0045820	negative regulation of glycolytic process
3. B	GO:0002315	marginal zone B cell differentiation
3. B	GO:0071532	ankyrin repeat binding
3. B	GO:0070682	proteasome regulatory particle assembly
3. B	GO:0070936	protein K48-linked ubiquitination
3. B	GO:0070412	R-SMAD binding
3. B	GO:0140439	protein-cysteine S-stearoyltransferase activity
3. B	GO:0051438	regulation of ubiquitin-protein transferase activity
3. B	GO:0036086	positive regulation of transcription from RNA polymerase II promoter in response to iron ion starvation
3. B	GO:0045648	positive regulation of erythrocyte differentiation
3. B	GO:0031143	pseudopodium
3. B	GO:0051017	actin filament bundle assembly
3. B	GO:0032495	response to muramyl dipeptide
3. B	GO:0071244	cellular response to carbon dioxide
3. B	GO:0007368	determination of left/right symmetry
3. B	GO:0014069	postsynaptic density
3. B	GO:0007616	long-term memory
3. B	GO:0070431	nucleotide-binding oligomerization domain containing 2 signaling pathway
3. B	GO:0001954	positive regulation of cell-matrix adhesion
3. B	GO:0051726	regulation of cell cycle
3. B	GO:0002268	follicular dendritic cell differentiation
3. B	GO:0001818	negative regulation of cytokine production
3. B	GO:0032525	somite rostral/caudal axis specification
3. B	GO:0014912	negative regulation of smooth muscle cell migration
3. B	GO:0031359	integral component of chloroplast outer membrane
3. B	GO:0010780	meiotic DNA double-strand break formation involved in reciprocal meiotic recombination
3. B	GO:0071407	cellular response to organic cyclic compound
3. B	GO:0031867	EP4 subtype prostaglandin E2 receptor binding
3. B	GO:1904107	protein localization to microvillus membrane
3. B	GO:0015248	sterol transporter activity
3. B	GO:0043266	regulation of potassium ion transport
3. B	GO:0050955	thermoception
3. B	GO:2000651	positive regulation of sodium ion transmembrane transporter activity
3. B	GO:0014065	phosphatidylinositol 3-kinase signaling
3. B	GO:0061399	positive regulation of transcription from RNA polymerase II promoter in response to cobalt ion
3. B	GO:0140031	phosphorylation-dependent protein binding
3. B	GO:0001934	positive regulation of protein phosphorylation
3. B	GO:0051306	mitotic sister chromatid separation
3. B	GO:0050957	equilibrioception
3. B	GO:0021549	cerebellum development
3. B	GO:0043619	regulation of transcription from RNA polymerase II promoter in response to oxidative stress
3. B	GO:0048060	negative gravitaxis
3. B	GO:0072015	glomerular visceral epithelial cell development
3. B	GO:2000304	positive regulation of ceramide biosynthetic process
3. B	GO:0070171	negative regulation of tooth mineralization
3. B	GO:0034703	cation channel complex
3. B	GO:0019208	phosphatase regulator activity
3. B	GO:0030315	T-tubule
3. B	GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process
3. B	GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
3. B	GO:0090263	positive regulation of canonical Wnt signaling pathway
3. B	GO:0010888	negative regulation of lipid storage
3. B	GO:0010761	fibroblast migration
3. B	GO:0005262	calcium channel activity
3. B	GO:0008290	F-actin capping protein complex
3. B	GO:0102545	phosphatidyl phospholipase B activity
3. B	GO:0097062	dendritic spine maintenance
3. B	GO:0031901	early endosome membrane
3. B	GO:0031672	A band
3. B	GO:0098910	regulation of atrial cardiac muscle cell action potential
3. B	GO:0043194	axon initial segment
3. B	GO:0030941	chloroplast targeting sequence binding
3. B	GO:0099527	postsynapse to nucleus signaling pathway
3. B	GO:0048265	response to pain
3. B	GO:0016279	protein-lysine N-methyltransferase activity
3. B	GO:0043066	negative regulation of apoptotic process
3. B	GO:0007165	signal transduction
3. B	GO:1904355	positive regulation of telomere capping
3. B	GO:0010745	negative regulation of macrophage derived foam cell differentiation
3. B	GO:0033270	paranode region of axon
3. B	GO:0030511	positive regulation of transforming growth factor beta receptor signaling pathway
3. B	GO:1901223	negative regulation of NIK/NF-kappaB signaling
3. B	GO:0097543	ciliary inversin compartment
3. B	GO:0017124	SH3 domain binding
3. B	GO:0003847	1-alkyl-2-acetylglycerophosphocholine esterase activity
3. B	GO:0001658	branching involved in ureteric bud morphogenesis
3. B	GO:0017171	serine hydrolase activity
3. B	GO:0016235	aggresome
3. B	GO:1902230	negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage
3. B	GO:0042383	sarcolemma
3. B	GO:0070427	nucleotide-binding oligomerization domain containing 1 signaling pathway
3. B	GO:0050931	pigment cell differentiation
3. B	GO:0030030	cell projection organization
3. B	GO:0032212	positive regulation of telomere maintenance via telomerase
3. B	GO:0002040	sprouting angiogenesis
3. B	GO:0061001	regulation of dendritic spine morphogenesis
3. B	GO:0045064	T-helper 2 cell differentiation
3. B	GO:2000279	negative regulation of DNA biosynthetic process
3. B	GO:0061025	membrane fusion
3. B	GO:0051386	regulation of neurotrophin TRK receptor signaling pathway
3. B	GO:1990393	3M complex
3. B	GO:0060803	BMP signaling pathway involved in mesodermal cell fate specification
3. B	GO:1990705	cholangiocyte proliferation
3. B	GO:0060013	righting reflex
3. B	GO:0050968	detection of chemical stimulus involved in sensory perception of pain
3. B	GO:0002455	humoral immune response mediated by circulating immunoglobulin
3. B	GO:0007229	integrin-mediated signaling pathway
3. B	GO:1903343	positive regulation of meiotic DNA double-strand break formation
3. B	GO:0090029	negative regulation of pheromone-dependent signal transduction involved in conjugation with cellular fusion
3. B	GO:0048013	ephrin receptor signaling pathway
3. B	GO:1901019	regulation of calcium ion transmembrane transporter activity
3. B	GO:0045162	clustering of voltage-gated sodium channels
3. B	GO:0060413	atrial septum morphogenesis
3. B	GO:0050728	negative regulation of inflammatory response
3. B	GO:0030027	lamellipodium
3. B	GO:0043065	positive regulation of apoptotic process
3. B	GO:0008139	nuclear localization sequence binding
3. B	GO:0000415	negative regulation of histone H3-K36 methylation
3. B	GO:0033268	node of Ranvier
3. B	GO:0048665	neuron fate specification
3. B	GO:0090200	positive regulation of release of cytochrome c from mitochondria
3. B	GO:0019705	protein-cysteine S-myristoyltransferase activity
3. B	GO:0010613	positive regulation of cardiac muscle hypertrophy
3. B	GO:0043596	nuclear replication fork
3. B	GO:0001835	blastocyst hatching
3. B	GO:0008361	regulation of cell size
3. B	GO:0071709	membrane assembly
3. B	GO:0015278	calcium-release channel activity
3. B	GO:0045921	positive regulation of exocytosis
3. B	GO:0043422	protein kinase B binding
3. B	GO:1990756	ubiquitin ligase-substrate adaptor activity
3. B	GO:0060992	response to fungicide
3. B	GO:2000463	positive regulation of excitatory postsynaptic potential
3. B	GO:0016290	palmitoyl-CoA hydrolase activity
3. B	GO:0014732	skeletal muscle atrophy
3. B	GO:0042393	histone binding
3. B	GO:0019899	enzyme binding
3. B	GO:0060361	flight
3. B	GO:0099173	postsynapse organization
3. B	GO:0051570	regulation of histone H3-K9 methylation
3. B	GO:0004857	enzyme inhibitor activity
3. B	GO:0060997	dendritic spine morphogenesis
3. B	GO:1901018	positive regulation of potassium ion transmembrane transporter activity
3. B	GO:0050714	positive regulation of protein secretion
3. B	GO:0004143	diacylglycerol kinase activity
3. B	GO:0060135	maternal process involved in female pregnancy
3. B	GO:0031663	lipopolysaccharide-mediated signaling pathway
3. B	GO:2000311	regulation of AMPA receptor activity
3. B	GO:0086066	atrial cardiac muscle cell to AV node cell communication
3. B	GO:1901021	positive regulation of calcium ion transmembrane transporter activity
3. B	GO:1901224	positive regulation of NIK/NF-kappaB signaling
3. B	GO:0060253	negative regulation of glial cell proliferation
3. B	GO:0005925	focal adhesion
3. B	GO:0050966	detection of mechanical stimulus involved in sensory perception of pain
3. B	GO:0021707	cerebellar granule cell differentiation
3. B	GO:0033256	I-kappaB/NF-kappaB complex
3. B	GO:0051151	negative regulation of smooth muscle cell differentiation
3. B	GO:0005829	cytosol
3. B	GO:0046872	metal ion binding
3. B	GO:0001771	immunological synapse formation
3. B	GO:0035544	negative regulation of SNARE complex assembly
3. B	GO:0035508	positive regulation of myosin-light-chain-phosphatase activity
3. B	GO:0097553	calcium ion transmembrane import into cytosol
3. B	GO:0031668	cellular response to extracellular stimulus
3. B	GO:0000139	Golgi membrane
3. B	GO:0060708	spongiotrophoblast differentiation
3. B	GO:0019706	protein-cysteine S-palmitoyltransferase activity
3. B	GO:0051572	negative regulation of histone H3-K4 methylation
3. B	GO:1903793	positive regulation of anion transport
3. B	GO:0044354	macropinosome
3. B	GO:0035507	regulation of myosin-light-chain-phosphatase activity
3. B	GO:1904357	negative regulation of telomere maintenance via telomere lengthening

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	A6NGH8	Ankyrin repeat domain-containing protein 61	1.68e-05	7.40e-03	0.006
1. PB	Q2IBB4	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.10e-04	4.98e-02	0.006
1. PB	Q6KAE5	Probable E3 ubiquitin-protein ligase XBOS32	1.15e-04	1.89e-04	7.27e-05
1. PB	Q8N9B4	Ankyrin repeat domain-containing protein 42	3.01e-05	1.24e-05	2.35e-08
1. PB	Q8N9V6	Ankyrin repeat domain-containing protein 53	2.16e-05	4.12e-02	4.31e-05
1. PB	P14360	Putative ankyrin repeat protein FPV240	NA	9.80e-04	2.88e-07
1. PB	Q8VHQ3	Protein phosphatase 1 regulatory inhibitor subunit 16B	7.20e-04	4.09e-05	2.70e-05
1. PB	P51480	Cyclin-dependent kinase inhibitor 2A	1.81e-07	1.04e-07	3.22e-05
1. PB	Q9J504	Putative ankyrin repeat protein FPV231	NA	4.20e-03	0.044
1. PB	Q91ZT9	Ankyrin repeat and SOCS box protein 8	7.18e-07	3.75e-06	4.81e-07
1. PB	A2ARS0	Ankyrin repeat domain-containing protein 63	2.89e-05	2.13e-03	0.004
1. PB	Q09YN0	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	2.61e-04	1.78e-02	0.005
1. PB	Q8BTZ5	Ankyrin repeat domain-containing protein 46	3.83e-06	1.18e-08	0.022
1. PB	Q810N6	Ankyrin repeat domain-containing protein 45	1.01e-07	7.07e-12	5.29e-08
1. PB	Q65XV2	E3 ubiquitin-protein ligase XB3	1.44e-05	3.03e-09	1.50e-04
1. PB	Q5R6D7	Ankyrin repeat and SOCS box protein 8	5.54e-07	4.28e-06	2.82e-07
1. PB	Q86W74	Ankyrin repeat domain-containing protein 46	9.95e-08	1.14e-07	0.007
1. PB	Q337A0	Probable E3 ubiquitin-protein ligase XBOS33	3.89e-06	6.75e-05	0.004
1. PB	B4E2M5	Ankyrin repeat domain-containing protein 66	0	1.90e-06	3.48e-147
1. PB	Q96I34	Protein phosphatase 1 regulatory subunit 16A	3.30e-04	2.25e-04	9.69e-05
1. PB	Q1RJN6	Putative ankyrin repeat protein RBE_0347	1.15e-04	3.41e-02	0.011
1. PB	Q4JHE0	Probable E3 ubiquitin-protein ligase XBOS36	1.46e-05	2.53e-02	0.004
1. PB	Q9J5I7	Putative ankyrin repeat protein FPV014	NA	2.95e-02	1.41e-06
1. PB	Q94CT7	Probable E3 ubiquitin-protein ligase XBOS31	3.89e-06	1.27e-09	1.93e-04
1. PB	Q9UU77	Ankyrin repeat-containing protein P1E11.10	1.12e-08	5.45e-11	0.009
1. PB	Q9WV74	Ankyrin repeat and SOCS box protein 1	1.06e-05	2.43e-02	0.047
1. PB	Q8VD46	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	3.15e-05	2.58e-02	0.004
1. PB	Q641X1	Ankyrin repeat domain-containing protein 61	5.92e-05	9.26e-05	0.013
1. PB	P42570	DNA replication inhibitor plutonium	1.51e-07	1.25e-14	0.003
1. PB	Q08E43	Ankyrin repeat and SOCS box protein 8	2.51e-06	8.00e-07	2.35e-07
1. PB	Q07E30	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.05e-04	4.62e-02	0.007
1. PB	Q96T49	Protein phosphatase 1 regulatory inhibitor subunit 16B	6.62e-04	1.24e-03	7.53e-05
1. PB	Q5R8C8	Ankyrin repeat domain-containing protein 46	8.04e-08	9.72e-08	0.008
1. PB	Q94B55	Putative E3 ubiquitin-protein ligase XBAT31	5.60e-05	7.26e-09	2.28e-06
1. PB	Q6TNT2	Ankyrin repeat domain-containing protein 46	2.78e-08	6.49e-10	0.001
1. PB	Q9H765	Ankyrin repeat and SOCS box protein 8	1.85e-06	8.07e-06	2.61e-07
1. PB	Q5TZF3	Ankyrin repeat domain-containing protein 45	3.00e-07	1.79e-14	1.52e-08
1. PB	Q7EZ44	Probable E3 ubiquitin-protein ligase XBOS35	1.14e-04	2.48e-06	5.04e-04
1. PB	Q9R0Z3	Cyclin-dependent kinase inhibitor 2A	1.35e-08	1.47e-11	0.002
1. PB	Q3KP44	Ankyrin repeat domain-containing protein 55	4.80e-04	2.04e-02	3.45e-07
1. PB	P46683	Ankyrin repeat-containing protein YAR1	1.37e-07	3.86e-15	6.41e-04
1. PB	P14368	Putative ankyrin repeat protein FPV234	NA	2.90e-04	0.014
1. PB	Q76K24	Ankyrin repeat domain-containing protein 46	1.05e-07	8.99e-08	0.023
1. PB	C9JTQ0	Ankyrin repeat domain-containing protein 63	4.73e-05	3.64e-02	0.002
1. PB	Q95N27	Protein phosphatase 1 regulatory inhibitor subunit 16B	6.60e-04	3.27e-04	6.55e-05
1. PB	Q4R544	Ankyrin repeat and SOCS box protein 8	2.58e-06	2.04e-05	3.75e-07
1. PB	Q9HFE7	Ankyrin repeat-containing protein P16F5.05c	2.21e-11	2.28e-06	0.007
1. PB	Q3V096	Ankyrin repeat domain-containing protein 42	6.54e-05	8.83e-10	3.06e-11
1. PB	Q6NLQ8	E3 ubiquitin-protein ligase XBAT32	2.19e-04	3.03e-03	0.001
1. PB	Q6NSI1	Putative ankyrin repeat domain-containing protein 26-like protein	8.77e-06	1.27e-15	1.52e-04
1. PB	Q63369	Nuclear factor NF-kappa-B p105 subunit (Fragment)	1.67e-04	1.19e-03	0.004
1. PB	Q569N2	Ankyrin repeat domain-containing protein 37	3.26e-06	8.75e-15	0.012
1. PB	Q3SX00	Ankyrin repeat domain-containing protein 46	9.54e-08	1.14e-07	0.007
1. PB	Q9CQM6	Ankyrin repeat domain-containing protein 61	1.69e-05	1.04e-03	0.025
1. PB	Q923M0	Protein phosphatase 1 regulatory subunit 16A	5.47e-04	1.49e-05	6.95e-04
2. P	Q1RHQ8	Putative ankyrin repeat protein RBE_1025	5.64e-07	8.10e-04	NA
2. P	Q3U0L2	Ankyrin repeat domain-containing protein 33B	1.60e-03	6.82e-04	NA
2. P	Q0VC93	Ankyrin repeat domain-containing protein 37	3.21e-05	9.89e-14	NA
2. P	Q4ULD9	Putative ankyrin repeat protein RF_0783	1.20e-06	7.93e-04	NA
2. P	Q1RJM6	Putative ankyrin repeat protein RBE_0357	1.33e-03	1.44e-02	NA
2. P	Q58CT0	Dynein axonemal heavy chain 12	1.32e-03	3.65e-04	NA
2. P	Q7Z713	Ankyrin repeat domain-containing protein 37	1.20e-07	6.78e-13	NA
2. P	Q28FJ2	Ankyrin repeat domain-containing protein 37	1.04e-06	7.90e-10	NA
2. P	Q9J519	Putative ankyrin repeat protein FPV216	NA	7.91e-05	NA
2. P	Q9P7I0	Ankyrin repeat-containing protein C105.02c	1.05e-06	2.62e-03	NA
2. P	Q9Y574	Ankyrin repeat and SOCS box protein 4	2.01e-05	3.10e-04	NA
2. P	Q5I125	I-Kappa-B like protein N3	NA	2.84e-02	NA
2. P	Q4UNJ5	Putative ankyrin repeat protein RF_0011	4.21e-05	2.09e-04	NA
2. P	Q8BXP5	Photoreceptor ankyrin repeat protein	2.69e-05	8.77e-03	NA
2. P	Q1RIW0	Putative ankyrin repeat protein RBE_0623	1.51e-04	3.87e-03	NA
2. P	O36972	IkB-like protein	NA	1.23e-10	NA
2. P	P0C965	IkB-like protein	NA	2.71e-07	NA
2. P	Q09YH1	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	7.91e-05	1.20e-02	NA
2. P	Q76U48	IkB-like protein	NA	1.04e-09	NA
2. P	Q91ZU1	Ankyrin repeat and SOCS box protein 6	3.26e-06	6.40e-04	NA
2. P	P25631	Ankyrin repeat-containing protein YCR051W	6.71e-07	2.78e-07	NA
2. P	Q1RJ94	Putative ankyrin repeat protein RBE_0489	5.11e-06	2.87e-09	NA
2. P	A6NCL7	Ankyrin repeat domain-containing protein 33B	9.17e-05	6.90e-04	NA
2. P	Q1RJ28	Putative ankyrin repeat protein RBE_0555	1.69e-04	4.80e-03	NA
2. P	Q9WV71	Ankyrin repeat and SOCS box protein 4	1.22e-05	4.33e-03	NA
2. P	P0C966	IkB-like protein	NA	5.40e-10	NA
2. P	P0C964	IkB-like protein	NA	9.74e-10	NA
2. P	Q7Z3H0	Photoreceptor ankyrin repeat protein	7.74e-04	3.93e-06	NA
2. P	P53066	Ankyrin repeat-containing protein YGL242C	5.62e-06	1.83e-07	NA
2. P	Q4ULE0	Putative ankyrin repeat protein RF_0782	1.46e-04	4.71e-06	NA
2. P	Q1RIZ4	Putative ankyrin repeat protein RBE_0589	2.66e-05	1.92e-03	NA
2. P	Q83DF6	Putative ankyrin repeat protein CBU_0781	1.69e-04	1.31e-05	NA
3. B	Q9H560	Putative ankyrin repeat domain-containing protein 19	1.97e-06	NA	0.003
3. B	Q8VHS6	Ankyrin repeat and SOCS box protein 15	4.82e-04	NA	0.033
3. B	Q5UPD5	Putative ankyrin repeat protein L59	NA	NA	0.004
3. B	P20632	Interferon antagonist K1L	NA	NA	0.005
3. B	Q1RGM2	Putative ankyrin repeat protein RBE_1411	6.33e-05	NA	0.024
3. B	Q8IUH5	Palmitoyltransferase ZDHHC17	1.14e-03	NA	8.23e-09
3. B	Q54KA7	Ankyrin repeat, PH and SEC7 domain containing protein secG	2.62e-03	NA	4.97e-11
3. B	Q0V8G2	GA-binding protein subunit beta-2	4.14e-05	NA	1.03e-04
3. B	P59672	Ankyrin repeat and SAM domain-containing protein 1A	4.02e-02	NA	4.53e-05
3. B	O14974	Protein phosphatase 1 regulatory subunit 12A	7.52e-03	NA	6.92e-10
3. B	Q99NH0	Ankyrin repeat domain-containing protein 17	2.85e-01	NA	1.69e-05
3. B	Q2QL84	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.12e-04	NA	0.039
3. B	A9JR78	Tonsoku-like protein	8.02e-02	NA	0.002
3. B	P57078	Receptor-interacting serine/threonine-protein kinase 4	3.82e-03	NA	7.29e-10
3. B	Q6P9J5	KN motif and ankyrin repeat domain-containing protein 4	8.48e-03	NA	0.026
3. B	Q499M5	Ankyrin repeat domain-containing protein 16	2.22e-05	NA	2.68e-09
3. B	Q3TYL0	IQ motif and ankyrin repeat domain-containing protein 1	4.17e-05	NA	2.52e-05
3. B	Q9Y575	Ankyrin repeat and SOCS box protein 3	1.87e-04	NA	2.05e-04
3. B	Q1LZC5	Ankyrin repeat domain-containing protein 54	4.33e-08	NA	1.42e-10
3. B	Q6S5J6	Krev interaction trapped protein 1	1.05e-02	NA	1.64e-06
3. B	P0C6P7	Protein fem-1 homolog B	5.78e-04	NA	6.74e-09
3. B	Q8CEF1	Protein fem-1 homolog C	4.81e-06	NA	3.34e-04
3. B	Q4FE45	E3 ubiquitin-protein ligase XBAT33	6.37e-04	NA	2.00e-05
3. B	Q9J5H8	Putative ankyrin repeat protein FPV023	NA	NA	0.024
3. B	D3J162	Protein VAPYRIN	1.88e-03	NA	4.98e-05
3. B	Q0P5B9	Ankyrin repeat domain-containing protein 39	7.60e-09	NA	2.01e-07
3. B	Q4UJ75	Putative ankyrin repeat domain-containing protein 20A4	3.18e-03	NA	1.05e-04
3. B	Q06527	Ankyrin homolog	1.17e-06	NA	1.67e-07
3. B	Q9JRZ6	Putative ankyrin repeat protein NMB1133/NMB1171	5.50e-03	NA	1.87e-04
3. B	Q8N7Z5	Ankyrin repeat domain-containing protein 31	1.22e-01	NA	2.60e-05
3. B	Q01317	Ankyrin repeat protein nuc-2	6.10e-03	NA	0.024
3. B	Q566C8	Ankyrin repeat domain-containing protein 54	8.64e-07	NA	1.27e-10
3. B	P14585	Protein lin-12	1.02e-01	NA	0.005
3. B	O14593	DNA-binding protein RFXANK	4.10e-06	NA	1.64e-07
3. B	Q8LSQ2	Probable signal recognition particle 43 kDa protein, chloroplastic	4.54e-05	NA	7.48e-04
3. B	Q8K4M9	Oxysterol-binding protein-related protein 1	4.78e-03	NA	4.05e-04
3. B	Q07E41	Cortactin-binding protein 2	8.46e-02	NA	3.30e-09
3. B	Q9Y576	Ankyrin repeat and SOCS box protein 1	7.78e-06	NA	0.001
3. B	P62774	Myotrophin	1.79e-14	NA	0.001
3. B	Q00PJ3	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	4.26e-05	NA	0.030
3. B	Q9Z2X2	26S proteasome non-ATPase regulatory subunit 10	1.28e-07	NA	1.59e-08
3. B	P97819	85/88 kDa calcium-independent phospholipase A2	6.98e-03	NA	9.15e-08
3. B	Q9WV06	Ankyrin repeat domain-containing protein 2	3.04e-06	NA	3.51e-10
3. B	Q02357	Ankyrin-1	2.16e-02	NA	3.67e-10
3. B	Q14161	ARF GTPase-activating protein GIT2	7.36e-03	NA	5.27e-04
3. B	Q66H91	ARF GTPase-activating protein GIT2	7.77e-03	NA	0.001
3. B	Q2QLC6	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.77e-04	NA	0.012
3. B	Q8N8A2	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B	1.30e-02	NA	2.92e-16
3. B	Q9D504	Ankyrin repeat domain-containing protein 7	4.95e-07	NA	3.06e-04
3. B	Q9NU02	Ankyrin repeat and EF-hand domain-containing protein 1	9.58e-04	NA	4.48e-08
3. B	Q29RM5	Protein fem-1 homolog A	2.59e-05	NA	1.09e-04
3. B	Q9ZU96	Ankyrin repeat-containing protein At2g01680	4.21e-04	NA	0.020
3. B	Q5TYM7	CARD- and ANK-domain containing inflammasome adapter protein	3.13e-03	NA	7.28e-10
3. B	B2FKA7	Actin-binding protein Smlt3054	7.26e-05	NA	3.96e-04
3. B	Q5U312	Ankycorbin	1.80e-02	NA	1.55e-06
3. B	Q21920	Ankyrin repeat and KH domain-containing protein mask-1	3.60e-01	NA	0.043
3. B	S0DPL8	Apicidin F cluster transcription factor apf2	5.43e-06	NA	0.019
3. B	Q8IV38	Ankyrin repeat and MYND domain-containing protein 2	1.60e-05	NA	3.17e-06
3. B	A1ZBY1	Protein fem-1 homolog B	1.48e-03	NA	0.001
3. B	Q08353	NF-kappa-B inhibitor alpha	6.38e-05	NA	1.83e-07
3. B	Q5UQC4	Putative ankyrin repeat protein R229	NA	NA	0.001
3. B	Q14DN9	Ankyrin repeat and death domain-containing protein 1B	1.56e-04	NA	0.047
3. B	Q9VUX2	E3 ubiquitin-protein ligase mind-bomb	7.06e-02	NA	1.37e-05
3. B	P53356	Tyrosine-protein kinase HTK16	3.19e-03	NA	4.50e-09
3. B	Q9SQK3	Ankyrin repeat domain-containing protein EMB506, chloroplastic	4.80e-07	NA	2.81e-07
3. B	Q7T0Q1	Myotrophin	9.33e-15	NA	0.003
3. B	Q6P6B7	Ankyrin repeat domain-containing protein 16	6.24e-06	NA	1.63e-06
3. B	O70511	Ankyrin-3	2.72e-01	NA	8.33e-13
3. B	Q90623	Protein phosphatase 1 regulatory subunit 12A	6.50e-03	NA	4.63e-10
3. B	Q3U0D9	E3 ubiquitin-protein ligase HACE1	1.17e-03	NA	1.22e-07
3. B	Q9Z2X3	26S proteasome non-ATPase regulatory subunit 10	2.15e-07	NA	1.43e-07
3. B	Q5UQJ0	Putative ankyrin repeat protein R835	NA	NA	0.022
3. B	Q9TXQ1	Poly [ADP-ribose] polymerase tankyrase	1.20e-01	NA	1.19e-06
3. B	Q7Z8U2	Palmitoyltransferase akr1	2.11e-03	NA	0.001
3. B	Q5UPE2	Putative ankyrin repeat protein L63	NA	NA	0.044
3. B	Q7T163	Kinase D-interacting substrate of 220 kDa B	6.72e-03	NA	6.30e-04
3. B	Q68DC2	Ankyrin repeat and SAM domain-containing protein 6	1.07e-04	NA	0.003
3. B	A1X154	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	2.23e-04	NA	0.034
3. B	Q7XUW4	Potassium channel KOR2	2.86e-04	NA	3.22e-04
3. B	Q6RI86	Transient receptor potential cation channel subfamily A member 1	3.56e-02	NA	7.44e-07
3. B	Q1RMI3	GA-binding protein subunit beta-1	1.98e-05	NA	4.09e-05
3. B	Q9WV48	SH3 and multiple ankyrin repeat domains protein 1	3.93e-01	NA	1.52e-04
3. B	Q6BP80	Palmitoyltransferase AKR1	2.79e-03	NA	0.001
3. B	D3J163	Protein VAPYRIN-LIKE	1.52e-04	NA	7.87e-11
3. B	Q10311	Ankyrin repeat-containing protein C6C3.08	4.26e-07	NA	3.06e-05
3. B	Q07DW4	Cortactin-binding protein 2	2.49e-01	NA	1.79e-08
3. B	A2A690	Protein TANC2	2.28e-01	NA	1.71e-07
3. B	Q6FJ70	Palmitoyltransferase AKR1	1.66e-03	NA	9.28e-05
3. B	Q4R3S3	Ankyrin repeat domain-containing protein 7	2.53e-06	NA	2.12e-04
3. B	Q8CGN4	BCL-6 corepressor	1.23e-01	NA	4.74e-04
3. B	Q7T3X9	Notch-regulated ankyrin repeat-containing protein B	1.09e-05	NA	7.49e-07
3. B	Q7T3P8	Protein fem-1 homolog C	1.15e-05	NA	2.16e-04
3. B	Q80UP3	Diacylglycerol kinase zeta	4.26e-03	NA	0.009
3. B	Q9Z2F6	B-cell lymphoma 3 protein homolog	1.23e-04	NA	5.47e-04
3. B	Q8WXK4	Ankyrin repeat and SOCS box protein 12	7.29e-06	NA	0.001
3. B	A7MB89	Protein fem-1 homolog C	4.36e-06	NA	3.16e-04
3. B	Q80T11	Usher syndrome type-1G protein homolog	5.49e-05	NA	5.00e-10
3. B	Q9D2J7	Ankyrin repeat and EF-hand domain-containing protein 1	1.07e-03	NA	3.92e-09
3. B	Q9D119	Protein phosphatase 1 regulatory subunit 27	2.46e-10	NA	8.38e-07
3. B	Q9H2K2	Poly [ADP-ribose] polymerase tankyrase-2	1.37e-02	NA	6.62e-07
3. B	Q9D061	Acyl-CoA-binding domain-containing protein 6	9.68e-07	NA	0.007
3. B	Q8VHA6	Ankyrin repeat and SOCS box protein 18	2.20e-04	NA	0.021
3. B	Q9BXX2	Ankyrin repeat domain-containing protein 30B	7.74e-02	NA	0.001
3. B	Q06547	GA-binding protein subunit beta-1	1.86e-06	NA	3.81e-05
3. B	Q91ZT7	Ankyrin repeat and SOCS box protein 10	1.23e-04	NA	0.001
3. B	A6NHY2	Ankyrin repeat and death domain-containing protein 1B	8.55e-04	NA	0.003
3. B	P55273	Cyclin-dependent kinase 4 inhibitor D	4.61e-11	NA	3.35e-07
3. B	Q62415	Apoptosis-stimulating of p53 protein 1	4.76e-02	NA	7.65e-04
3. B	Q5RCK5	Ankyrin repeat and SOCS box protein 7	1.45e-07	NA	1.82e-10
3. B	Q8UVC1	Inversin	4.02e-02	NA	2.76e-08
3. B	Q5SQ80	Putative ankyrin repeat domain-containing protein 20A2	1.90e-03	NA	5.68e-05
3. B	Q2IBD4	Cortactin-binding protein 2	1.03e-01	NA	5.05e-09
3. B	Q6ZVZ8	Ankyrin repeat and SOCS box protein 18	1.60e-03	NA	5.33e-04
3. B	Q2IBE3	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	9.07e-05	NA	0.037
3. B	Q63618	Espin	3.85e-03	NA	6.82e-07
3. B	B9EJA2	Cortactin-binding protein 2	1.25e-01	NA	2.73e-09
3. B	Q8CGB3	Uveal autoantigen with coiled-coil domains and ankyrin repeats	3.88e-02	NA	5.51e-04
3. B	Q8IWB6	Inactive serine/threonine-protein kinase TEX14	2.94e-02	NA	1.40e-08
3. B	Q3UES3	Poly [ADP-ribose] polymerase tankyrase-2	1.47e-02	NA	8.13e-07
3. B	A5WVX9	Palmitoyltransferase ZDHHC17	5.12e-04	NA	7.60e-09
3. B	Q6W2J9	BCL-6 corepressor	1.09e-01	NA	5.30e-04
3. B	P40578	Protein MGA2	7.32e-02	NA	2.33e-05
3. B	Q9Y2G4	Ankyrin repeat domain-containing protein 6	8.21e-04	NA	9.80e-06
3. B	F1LTE0	Protein TANC2	1.49e-01	NA	1.71e-07
3. B	Q80UU1	Ankyrin repeat and zinc finger domain-containing protein 1	3.64e-02	NA	0.003
3. B	B1AK53	Espin	3.54e-03	NA	6.65e-07
3. B	Q495M9	Usher syndrome type-1G protein	1.00e-04	NA	4.55e-10
3. B	Q9ERC1	Unconventional myosin-XVI	1.04e-01	NA	5.13e-04
3. B	Q9P2R3	Rabankyrin-5	3.45e-02	NA	1.21e-04
3. B	Q8BZ25	Ankyrin repeat and protein kinase domain-containing protein 1	1.52e-03	NA	2.28e-12
3. B	Q8UVC3	Inversin	8.38e-03	NA	1.89e-09
3. B	Q9SCX5	Probable potassium channel AKT5	2.64e-02	NA	2.11e-04
3. B	Q05823	2-5A-dependent ribonuclease	9.70e-05	NA	2.31e-10
3. B	P57044	Integrin-linked protein kinase	2.15e-06	NA	1.37e-07
3. B	Q8ZWC4	Putative ankyrin repeat protein PAE1861	5.26e-08	NA	1.04e-05
3. B	Q91XL9	Oxysterol-binding protein-related protein 1	6.03e-03	NA	0.005
3. B	Q4X251	Palmitoyltransferase akr1	1.27e-03	NA	6.89e-06
3. B	Q12013	Probable palmitoyltransferase AKR2	4.38e-03	NA	5.07e-04
3. B	Q8WMX7	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	6.29e-05	NA	0.039
3. B	Q1RK82	Putative ankyrin repeat protein RBE_0151	4.61e-05	NA	1.20e-04
3. B	Q8VBX0	Ankyrin repeat and SOCS box protein 13	4.92e-06	NA	8.29e-07
3. B	Q9Z205	DNA-binding protein RFXANK	3.84e-06	NA	2.34e-07
3. B	Q9BXW6	Oxysterol-binding protein-related protein 1	1.82e-03	NA	2.47e-04
3. B	Q00653	Nuclear factor NF-kappa-B p100 subunit	1.95e-02	NA	1.17e-05
3. B	Q5ZLC8	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C	1.93e-02	NA	3.51e-16
3. B	Q9ULT8	E3 ubiquitin-protein ligase HECTD1	2.71e-01	NA	0.005
3. B	Q68LP1	E3 ubiquitin-protein ligase MIB2	6.76e-03	NA	0.005
3. B	Q01484	Ankyrin-2	NA	NA	4.10e-11
3. B	Q9UK73	Protein fem-1 homolog B	2.09e-05	NA	7.84e-09
3. B	F8W2M1	E3 ubiquitin-protein ligase HACE1	1.09e-03	NA	1.75e-07
3. B	Q2QLH1	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	2.58e-04	NA	0.037
3. B	Q4R739	Ankyrin repeat domain-containing protein 53	1.26e-05	NA	3.08e-05
3. B	Q9J513	Putative ankyrin repeat protein FPV222	NA	NA	0.012
3. B	Q9DBR7	Protein phosphatase 1 regulatory subunit 12A	7.29e-03	NA	6.85e-10
3. B	Q9Y283	Inversin	1.89e-02	NA	3.86e-08
3. B	Q9J512	Putative ankyrin repeat protein FPV223	NA	NA	0.010
3. B	Q495B1	Ankyrin repeat and death domain-containing protein 1A	2.89e-05	NA	0.023
3. B	Q9M8S6	Potassium channel SKOR	3.52e-03	NA	2.79e-04
3. B	Q9ULH0	Kinase D-interacting substrate of 220 kDa	4.90e-02	NA	4.24e-09
3. B	Q9BGT9	Ankyrin repeat and SOCS box protein 7	6.65e-08	NA	1.97e-10
3. B	Q5XJ13	Ankyrin repeat and SAM domain-containing protein 6	2.14e-03	NA	0.020
3. B	O70445	BRCA1-associated RING domain protein 1	2.90e-03	NA	5.06e-10
3. B	Q4UKJ3	Putative ankyrin repeat protein RF_1087	7.40e-07	NA	3.81e-05
3. B	Q86SG2	Ankyrin repeat domain-containing protein 23	4.02e-07	NA	8.23e-08
3. B	Q9WV72	Ankyrin repeat and SOCS box protein 3	1.39e-04	NA	1.01e-05
3. B	Q876L4	Probable palmitoyltransferase AKR2	1.58e-04	NA	2.59e-04
3. B	Q91WK7	Ankyrin repeat domain-containing protein 54	7.59e-06	NA	1.13e-10
3. B	Q5UPG5	Putative ankyrin repeat protein L93	NA	NA	0.005
3. B	Q5U2S6	Ankyrin repeat and SOCS box protein 2	8.03e-04	NA	2.29e-04
3. B	Q80SY4	E3 ubiquitin-protein ligase MIB1	3.91e-03	NA	8.79e-06
3. B	Q876L5	Palmitoyltransferase AKR1	3.97e-04	NA	2.49e-05
3. B	Q4I8B6	Palmitoyltransferase AKR1	3.97e-04	NA	2.94e-04
3. B	P16157	Ankyrin-1	4.62e-02	NA	1.75e-10
3. B	Q5VUR7	Putative ankyrin repeat domain-containing protein 20A3	1.33e-03	NA	6.35e-05
3. B	Q502M6	Ankyrin repeat domain-containing protein 29	2.83e-07	NA	0.003
3. B	A4II29	Notch-regulated ankyrin repeat-containing protein	2.32e-06	NA	2.78e-07
3. B	Q0VGY8	Protein TANC1	1.02e-01	NA	1.95e-06
3. B	P0C0T2	Ankyrin repeat and SAM domain-containing protein 6	1.18e-04	NA	7.88e-04
3. B	O95271	Poly [ADP-ribose] polymerase tankyrase-1	3.70e-02	NA	1.85e-06
3. B	Q9UI32	Glutaminase liver isoform, mitochondrial	4.97e-03	NA	0.030
3. B	G0LXV8	Alpha-latrotoxin-Lh1a (Fragment)	5.02e-02	NA	6.31e-04
3. B	Q8WWX0	Ankyrin repeat and SOCS box protein 5	5.85e-05	NA	1.16e-04
3. B	Q9Y566	SH3 and multiple ankyrin repeat domains protein 1	3.89e-01	NA	1.58e-04
3. B	Q653P0	Potassium channel KOR1	4.74e-04	NA	1.16e-04
3. B	Q6PFX9	Poly [ADP-ribose] polymerase tankyrase-1	2.84e-02	NA	2.01e-06
3. B	Q2IBG0	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.61e-04	NA	0.041
3. B	Q6P1S6	Myotrophin	8.22e-15	NA	0.002
3. B	C7B178	Protein VAPYRIN	4.18e-04	NA	2.71e-04
3. B	Q9D1A4	Ankyrin repeat and SOCS box protein 5	1.14e-04	NA	4.29e-04
3. B	Q875M2	Palmitoyltransferase AKR1	2.76e-04	NA	0.004
3. B	Q29Q26	Ankyrin repeat domain-containing protein 2B	2.51e-08	NA	1.83e-05
3. B	Q71S21	Inversin-B	1.23e-02	NA	4.72e-10
3. B	Q8VHK2	Caskin-1	8.86e-02	NA	2.94e-04
3. B	Q7Z020	Transient receptor potential cation channel subfamily A member 1	4.85e-02	NA	0.001
3. B	Q6DGX3	Ankyrin repeat domain-containing protein 54	7.21e-07	NA	1.51e-10
3. B	Q4P6L3	Palmitoyltransferase AKR1	1.56e-03	NA	3.08e-05
3. B	Q9P0K7	Ankycorbin	3.28e-03	NA	1.19e-04
3. B	Q5JPF3	Ankyrin repeat domain-containing protein 36C	1.07e-01	NA	6.87e-04
3. B	Q8GSA7	Calmodulin-binding transcription activator 3	1.62e-02	NA	0.014
3. B	Q96AX9	E3 ubiquitin-protein ligase MIB2	6.46e-03	NA	6.72e-05
3. B	A0A3L7I2I8	85/88 kDa calcium-independent phospholipase A2	3.51e-03	NA	3.42e-09
3. B	Q5RFS1	Ankyrin repeat and SOCS box protein 11	1.73e-05	NA	3.04e-05
3. B	Q5DU14	Unconventional myosin-XVI	1.72e-01	NA	6.78e-04
3. B	Q5UQY4	Putative ankyrin repeat protein R886 (Fragment)	NA	NA	0.017
3. B	O77617	Cyclin-dependent kinase inhibitor 2A	1.58e-10	NA	1.96e-06
3. B	G5EDE9	ANK repeat-containing protein nipk-1	1.85e-03	NA	0.035
3. B	Q07E28	Cortactin-binding protein 2	1.16e-01	NA	2.71e-08
3. B	Q8WXK3	Ankyrin repeat and SOCS box protein 13	3.77e-07	NA	8.94e-07
3. B	Q5GIG6	Serine/threonine-protein kinase TNNI3K	6.11e-03	NA	3.94e-08
3. B	Q5TYW2	Ankyrin repeat domain-containing protein 20A1	1.53e-03	NA	4.94e-05
3. B	Q92625	Ankyrin repeat and SAM domain-containing protein 1A	1.90e-02	NA	8.34e-07
3. B	Q09YI3	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	5.52e-05	NA	0.015
3. B	A0M8T5	Cortactin-binding protein 2	1.22e-01	NA	2.92e-08
3. B	Q9J5I9	Putative ankyrin repeat protein FPV012	NA	NA	1.67e-06
3. B	Q5ZM55	Protein fem-1 homolog B	2.24e-05	NA	1.12e-07
3. B	Q2KI79	Ankyrin repeat family A protein 2	2.21e-06	NA	1.10e-04
3. B	Q07E15	Cortactin-binding protein 2	1.56e-01	NA	1.28e-07
3. B	Q6UB98	Ankyrin repeat domain-containing protein 12	2.86e-01	NA	5.50e-06
3. B	Q9XZC0	Alpha-latrocrustotoxin-Lt1a (Fragment)	6.51e-02	NA	1.50e-07
3. B	A6QPE7	Ankyrin repeat domain-containing protein 65	3.94e-06	NA	2.81e-07
3. B	P55272	Cyclin-dependent kinase 4 inhibitor B	1.53e-13	NA	2.97e-06
3. B	Q94A76	Potassium channel GORK	3.90e-03	NA	1.66e-05
3. B	Q8Q0U0	Putative ankyrin repeat protein MM_0045	4.29e-06	NA	5.44e-04
3. B	Q54KH3	Ankyrin repeat domain-containing protein 39 homolog	2.20e-11	NA	1.41e-04
3. B	O35516	Neurogenic locus notch homolog protein 2	3.54e-01	NA	0.036
3. B	Q755Y0	Palmitoyltransferase AKR1	5.14e-04	NA	8.05e-06
3. B	Q03017	NF-kappa-B inhibitor cactus	1.59e-04	NA	5.15e-08
3. B	B8N0E6	Ankyrin-repeat domain containing transcription coregulator asaA	9.30e-04	NA	6.80e-09
3. B	O75762	Transient receptor potential cation channel subfamily A member 1	4.60e-02	NA	1.27e-04
3. B	Q5M9H0	Ankyrin repeat and SAM domain-containing protein 3	2.23e-04	NA	5.89e-07
3. B	Q5UPA0	Putative ankyrin repeat protein L25	NA	NA	8.57e-05
3. B	E7BQV0	BTB/POZ domain and ankyrin repeat-containing protein NPR1	5.74e-04	NA	0.024
3. B	P19838	Nuclear factor NF-kappa-B p105 subunit	1.03e-02	NA	0.005
3. B	A0M8S4	Cortactin-binding protein 2	1.10e-01	NA	1.10e-06
3. B	Q9Z1E3	NF-kappa-B inhibitor alpha	3.78e-05	NA	1.60e-05
3. B	Q9TU71	Ankyrin repeat domain-containing protein 1	1.93e-05	NA	1.53e-08
3. B	E9Q4F7	Ankyrin repeat domain-containing protein 11	5.29e-01	NA	2.23e-07
3. B	Q18297	Transient receptor potential cation channel subfamily A member 1 homolog	2.79e-02	NA	1.36e-06
3. B	Q8WWH4	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	7.68e-05	NA	0.020
3. B	P98150	Nuclear factor NF-kappa-B p100 subunit	2.71e-02	NA	3.86e-07
3. B	Q5RF15	Serine/threonine-protein kinase TNNI3K	1.13e-03	NA	2.59e-08
3. B	Q9VFD5	Protein fem-1 homolog CG6966	2.30e-05	NA	1.17e-04
3. B	Q6P9K8	Caskin-1	5.20e-02	NA	2.75e-04
3. B	Q2KJD8	Cyclin-dependent kinase 4 inhibitor B	1.75e-13	NA	6.92e-05
3. B	Q9BZL4	Protein phosphatase 1 regulatory subunit 12C	1.00e-03	NA	2.47e-07
3. B	Q2IBA2	Cortactin-binding protein 2	1.23e-01	NA	1.02e-06
3. B	Q812A3	Ankyrin repeat domain-containing protein 23	2.07e-07	NA	2.09e-09
3. B	Q3SWY2	Integrin-linked protein kinase	4.82e-08	NA	1.47e-07
3. B	A5PMU4	Ankyrin repeat and sterile alpha motif domain-containing protein 1B	5.32e-02	NA	1.59e-07
3. B	Q876A6	Palmitoyltransferase AKR1	1.11e-03	NA	2.48e-07
3. B	Q96KQ7	Histone-lysine N-methyltransferase EHMT2	1.85e-02	NA	4.38e-08
3. B	P25799	Nuclear factor NF-kappa-B p105 subunit	2.08e-02	NA	0.001
3. B	Q99LW0	Ankyrin repeat domain-containing protein 10	1.69e-04	NA	7.63e-07
3. B	Q91ZU0	Ankyrin repeat and SOCS box protein 7	6.49e-08	NA	2.12e-10
3. B	Q6GNY1	E3 ubiquitin-protein ligase mib1	2.28e-02	NA	6.72e-05
3. B	Q91ZT8	Ankyrin repeat and SOCS box protein 9	1.67e-05	NA	7.79e-07
3. B	A2A2Z9	Ankyrin repeat domain-containing protein 18B	9.35e-03	NA	0.001
3. B	Q9J5H7	Putative ankyrin repeat protein FPV024	NA	NA	0.007
3. B	Q09701	Palmitoyltransferase akr1	8.64e-04	NA	2.10e-04
3. B	Q8WXI3	Ankyrin repeat and SOCS box protein 10	3.61e-04	NA	0.020
3. B	Q9Z2G1	Protein fem-1 homolog A-A	8.31e-04	NA	2.49e-05
3. B	P0C550	Potassium channel AKT1	1.94e-02	NA	3.51e-06
3. B	Q13625	Apoptosis-stimulating of p53 protein 2	1.04e-02	NA	1.48e-05
3. B	Q5UQI7	Putative ankyrin repeat protein R838	NA	NA	0.002
3. B	Q8WXK1	Ankyrin repeat and SOCS box protein 15	1.08e-04	NA	0.003
3. B	Q2IBF8	Cortactin-binding protein 2	8.99e-02	NA	8.72e-08
3. B	Q2T9K6	Protein fem-1 homolog C	4.65e-06	NA	0.001
3. B	Q9ULJ7	Ankyrin repeat domain-containing protein 50	3.19e-02	NA	5.20e-10
3. B	P0C927	Ankyrin repeat and SOCS box protein 14	3.68e-04	NA	8.28e-05
3. B	Q07DX6	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.19e-05	NA	0.040
3. B	Q8VHK1	Caskin-2	1.20e-02	NA	6.66e-04
3. B	Q9Y6X6	Unconventional myosin-XVI	1.58e-01	NA	1.22e-04
3. B	Q2IBE6	Cortactin-binding protein 2	8.71e-02	NA	4.77e-08
3. B	Q3ZBX7	Ankyrin repeat domain-containing protein 1	1.03e-06	NA	3.92e-09
3. B	Q4V869	Acyl-CoA-binding domain-containing protein 6	1.40e-08	NA	0.017
3. B	Q09YG9	Cortactin-binding protein 2	9.37e-02	NA	1.40e-07
3. B	Q8HXA6	Ankyrin repeat and SOCS box protein 15	4.76e-04	NA	1.69e-04
3. B	Q0P5G1	Tonsoku-like protein	1.12e-01	NA	0.001
3. B	Q96NS5	Ankyrin repeat and SOCS box protein 16	2.29e-04	NA	0.005
3. B	Q52T38	Protein S-acyltransferase 24	1.40e-03	NA	3.26e-05
3. B	P0C6S7	Ankyrin repeat and sterile alpha motif domain-containing protein 1B	5.58e-02	NA	3.73e-07
3. B	Q96JP0	Protein fem-1 homolog C	5.13e-06	NA	3.07e-04
3. B	Q9C6C3	ADP-ribosylation factor GTPase-activating protein AGD2	1.68e-03	NA	0.007
3. B	F1N6G5	E3 ubiquitin-protein ligase HACE1	9.84e-04	NA	6.90e-08
3. B	Q8NFD2	Ankyrin repeat and protein kinase domain-containing protein 1	9.79e-04	NA	2.72e-14
3. B	Q865U8	Ankyrin repeat domain-containing protein 1	3.09e-06	NA	3.92e-08
3. B	Q9DF58	Integrin-linked protein kinase	4.94e-10	NA	1.62e-07
3. B	Q3SZE4	Ankyrin repeat and SOCS box protein 11	5.60e-05	NA	1.87e-05
3. B	O60237	Protein phosphatase 1 regulatory subunit 12B	4.56e-03	NA	4.56e-08
3. B	Q6NZL6	Tonsoku-like protein	2.53e-02	NA	3.66e-04
3. B	Q9SMX5	ADP-ribosylation factor GTPase-activating protein AGD4	2.59e-03	NA	0.004
3. B	Q1LZH7	KN motif and ankyrin repeat domain-containing protein 2	1.83e-02	NA	0.003
3. B	P17442	Phosphate system positive regulatory protein PHO81	1.40e-01	NA	4.55e-04
3. B	Q8WVL7	Ankyrin repeat domain-containing protein 49	2.38e-07	NA	5.72e-05
3. B	A2VDR2	Acyl-CoA-binding domain-containing protein 6	7.99e-07	NA	4.92e-04
3. B	Q95RG8	ARF GTPase-activating protein Git	8.41e-03	NA	5.43e-04
3. B	Q00PJ1	Cortactin-binding protein 2	9.43e-02	NA	8.80e-07
3. B	Q54BA2	Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800	3.76e-03	NA	9.58e-08
3. B	Q9VCA8	Ankyrin repeat and KH domain-containing protein mask	NA	NA	1.69e-06
3. B	Q04861	Nuclear factor NF-kappa-B p105 subunit	1.61e-02	NA	0.009
3. B	F1MJR8	Inactive serine/threonine-protein kinase TEX14	7.72e-02	NA	1.69e-08
3. B	Q15327	Ankyrin repeat domain-containing protein 1	1.49e-05	NA	3.40e-08
3. B	Q25338	Delta-latroinsectotoxin-Lt1a	1.82e-02	NA	0.019
3. B	Q5EA33	Ankyrin repeat domain-containing protein 49	3.32e-07	NA	1.97e-05
3. B	Q86YT6	E3 ubiquitin-protein ligase MIB1	7.23e-03	NA	9.21e-06
3. B	Q9BXX3	Ankyrin repeat domain-containing protein 30A	9.49e-02	NA	0.004
3. B	Q9TZC4	Integrin-linked protein kinase homolog pat-4	7.38e-06	NA	0.009
3. B	O89019	Inversin	1.39e-02	NA	3.61e-08
3. B	Q66JD7	Acyl-CoA-binding domain-containing protein 6	2.61e-07	NA	0.035
3. B	Q53RE8	Ankyrin repeat domain-containing protein 39	2.57e-06	NA	1.16e-06
3. B	Q54HW1	26S proteasome non-ATPase regulatory subunit 10	1.08e-08	NA	7.25e-11
3. B	Q69ZU8	Ankyrin repeat domain-containing protein 6	2.27e-03	NA	8.98e-06
3. B	Q8WMX8	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	2.35e-04	NA	0.015
3. B	Q0JKV1	Potassium channel AKT1	3.87e-03	NA	3.51e-06
3. B	Q60773	Cyclin-dependent kinase 4 inhibitor D	1.21e-10	NA	4.27e-06
3. B	Q2IBB2	Cortactin-binding protein 2	1.31e-01	NA	1.17e-07
3. B	Q9EQG6	Kinase D-interacting substrate of 220 kDa	7.09e-02	NA	3.38e-08
3. B	Q5ZLC6	Ankyrin repeat domain-containing protein 10	1.18e-05	NA	1.92e-06
3. B	Q4KL97	Ankyrin repeat domain-containing protein 1	2.72e-06	NA	3.99e-08
3. B	Q91955	Myotrophin	2.99e-14	NA	6.80e-04
3. B	P58546	Myotrophin	2.05e-14	NA	0.002
3. B	Q2QLG9	Cortactin-binding protein 2	1.71e-01	NA	1.19e-07
3. B	Q9J4Z6	Putative ankyrin repeat protein FPV244	NA	NA	3.36e-04
3. B	Q68FF6	ARF GTPase-activating protein GIT1	5.35e-03	NA	0.001
3. B	Q9J5A7	Putative ankyrin repeat protein FPV115	NA	NA	0.003
3. B	Q60772	Cyclin-dependent kinase 4 inhibitor C	4.42e-10	NA	1.26e-05
3. B	Q07E17	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	9.45e-05	NA	0.008
3. B	Q9UVH3	Palmitoyltransferase AKR1 (Fragment)	6.11e-05	NA	0.010
3. B	O08560	Diacylglycerol kinase zeta	1.47e-03	NA	0.022
3. B	Q09YJ5	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	1.51e-04	NA	0.016
3. B	Q8WMX6	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	6.76e-05	NA	0.040
3. B	Q5F478	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B	6.80e-03	NA	8.91e-17
3. B	Q8K3X6	Ankyrin repeat and SAM domain-containing protein 4B	5.93e-06	NA	6.04e-08
3. B	Q7TQP6	Serine/threonine-protein kinase TNNI3K	4.63e-03	NA	1.20e-07
3. B	P28492	Glutaminase liver isoform, mitochondrial	7.12e-03	NA	0.011
3. B	Q9Z2G0	Protein fem-1 homolog B	2.09e-05	NA	6.55e-09
3. B	P0CS67	Palmitoyltransferase AKR1	2.69e-03	NA	1.36e-04
3. B	G5E8K5	Ankyrin-3	1.18e-01	NA	1.32e-12
3. B	Q8K0L0	Ankyrin repeat and SOCS box protein 2	3.62e-04	NA	5.39e-04
3. B	Q6DD51	Caskin-2	1.27e-02	NA	5.48e-05
3. B	Q8TF21	Ankyrin repeat domain-containing protein 24	1.91e-02	NA	0.001
3. B	Q9Z272	ARF GTPase-activating protein GIT1	5.61e-03	NA	0.001
3. B	G4NID8	Transcription factor SWI6	3.45e-02	NA	0.018
3. B	A0A0R4IQZ2	Putative palmitoyltransferase ZDHHC13	4.58e-03	NA	4.25e-07
3. B	Q96HA7	Tonsoku-like protein	8.01e-02	NA	4.25e-04
3. B	Q5CZ79	Ankyrin repeat domain-containing protein 20B	1.59e-03	NA	2.34e-04
3. B	Q8NAG6	Ankyrin repeat and LEM domain-containing protein 1	8.01e-04	NA	0.022
3. B	Q63746	NF-kappa-B inhibitor alpha	3.83e-05	NA	2.14e-05
3. B	Q10728	Protein phosphatase 1 regulatory subunit 12A	7.37e-03	NA	6.72e-10
3. B	Q07DV1	Cortactin-binding protein 2	9.00e-02	NA	7.22e-08
3. B	Q9CWU2	Palmitoyltransferase ZDHHC13	2.00e-03	NA	1.60e-07
3. B	Q9W0T5	Transient receptor potential channel pyrexia	2.51e-03	NA	0.004
3. B	Q5W7F2	ADP-ribosylation factor GTPase-activating protein AGD3	4.16e-03	NA	0.004
3. B	Q9FNP4	Phytochrome-interacting ankyrin-repeat protein 2	6.73e-07	NA	3.04e-04
3. B	Q9STP8	Acyl-CoA-binding domain-containing protein 2	2.37e-06	NA	3.65e-06
3. B	Q07DX4	Cortactin-binding protein 2	1.34e-01	NA	7.09e-08
3. B	Q9CR42	Ankyrin repeat domain-containing protein 1	1.12e-05	NA	1.24e-07
3. B	A6NK59	Ankyrin repeat and SOCS box protein 14	1.26e-04	NA	2.26e-04
3. B	Q8BLA8	Transient receptor potential cation channel subfamily A member 1	3.93e-02	NA	2.63e-05
3. B	Q8H569	Potassium channel AKT3	1.97e-02	NA	0.001
3. B	O73630	Nuclear factor NF-kappa-B p100 subunit	1.30e-02	NA	1.85e-07
3. B	Q6C520	Palmitoyltransferase AKR1	8.07e-04	NA	0.003
3. B	Q2QLA2	Cortactin-binding protein 2	1.21e-01	NA	1.18e-07
3. B	Q74ZH9	Glycerophosphocholine phosphodiesterase GDE1	4.91e-02	NA	2.75e-05
3. B	Q9D2X0	Ankyrin repeat domain-containing protein 39	3.92e-11	NA	3.96e-07
3. B	O75179	Ankyrin repeat domain-containing protein 17	2.86e-01	NA	1.42e-05
3. B	Q9HYV6	Putative ankyrin repeat protein PA3287	8.46e-13	NA	7.71e-04
3. B	Q5ZMD2	Ankyrin repeat and MYND domain-containing protein 2	1.30e-07	NA	9.94e-05
3. B	Q09YM8	Cortactin-binding protein 2	1.38e-01	NA	2.15e-07
3. B	Q9WTK5	Nuclear factor NF-kappa-B p100 subunit	1.47e-02	NA	3.77e-06
3. B	Q6GPE5	Protein fem-1 homolog B	7.04e-06	NA	1.83e-05
3. B	Q8WXE0	Caskin-2	1.02e-02	NA	5.69e-04
3. B	Q69ZR2	E3 ubiquitin-protein ligase HECTD1	2.62e-01	NA	0.005
3. B	Q4R690	Palmitoyltransferase ZDHHC13	5.24e-04	NA	1.90e-07
3. B	P55271	Cyclin-dependent kinase 4 inhibitor B	6.64e-14	NA	1.04e-05
3. B	Q5DW34	Histone-lysine N-methyltransferase EHMT1	1.28e-02	NA	2.61e-07
3. B	Q80YE7	Death-associated protein kinase 1	3.86e-02	NA	4.89e-05
3. B	Q4UMP3	Putative ankyrin repeat protein RF_0314	6.78e-05	NA	0.001
3. B	E9PTT0	Palmitoyltransferase ZDHHC17	3.87e-03	NA	2.20e-09
3. B	P0DJE3	Alpha-latrotoxin-Lhe1a	6.65e-02	NA	0.003
3. B	Q7Z6K4	Notch-regulated ankyrin repeat-containing protein	3.85e-06	NA	4.64e-07
3. B	Q978J0	Putative ankyrin repeat protein TV1425	8.14e-08	NA	1.81e-09
3. B	Q2IBF5	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	6.77e-05	NA	0.035
3. B	Q9VSA4	Tonsoku-like protein	7.05e-02	NA	0.002
3. B	I1S2J8	Transcription regulator FGM4	1.02e-02	NA	1.56e-04
3. B	Q3UYR4	Espin-like protein	4.17e-03	NA	1.24e-09
3. B	P42772	Cyclin-dependent kinase 4 inhibitor B	3.71e-13	NA	4.29e-05
3. B	Q8IWZ3	Ankyrin repeat and KH domain-containing protein 1	2.56e-01	NA	5.62e-05
3. B	Q4V890	Protein fem-1 homolog A	1.71e-05	NA	1.90e-05
3. B	Q8IVF6	Ankyrin repeat domain-containing protein 18A	6.51e-03	NA	1.70e-04
3. B	Q9J4Z4	Putative ankyrin repeat protein FPV246	NA	NA	5.99e-06
3. B	A6NC57	Ankyrin repeat domain-containing protein 62	2.45e-03	NA	0.001
3. B	Q29RV0	Cyclin-dependent kinase 4 inhibitor D	3.87e-11	NA	6.92e-08
3. B	B0G124	Ankyrin repeat-containing protein DDB_G0279043	1.91e-09	NA	8.18e-07
3. B	Q9XVN3	Apoptotic enhancer 1 protein	2.02e-03	NA	0.039
3. B	Q8C6Y6	Ankyrin repeat and SOCS box protein 14	9.85e-05	NA	1.55e-05
3. B	Q91974	NF-kappa-B inhibitor alpha	2.32e-06	NA	0.003
3. B	Q5AL27	Palmitoyltransferase AKR1	8.46e-04	NA	0.003
3. B	Q54F46	Homeobox protein Wariai	1.16e-02	NA	1.17e-07
3. B	Q108T9	Cortactin-binding protein 2	1.71e-01	NA	3.29e-07
3. B	Q9H672	Ankyrin repeat and SOCS box protein 7	3.68e-08	NA	1.99e-10
3. B	Q9ET47	Espin	4.69e-03	NA	1.48e-09
3. B	Q05921	2-5A-dependent ribonuclease	2.53e-04	NA	2.55e-06
3. B	Q5ZIJ9	E3 ubiquitin-protein ligase MIB2	2.53e-03	NA	1.59e-05
3. B	Q8CG79	Apoptosis-stimulating of p53 protein 2	9.75e-03	NA	1.88e-05
3. B	Q9GKW8	Ankyrin repeat and death domain-containing protein 1A (Fragment)	1.62e-05	NA	0.023
3. B	Q9FY74	Calmodulin-binding transcription activator 1	7.74e-03	NA	0.027
3. B	Q80VM7	Ankyrin repeat domain-containing protein 24	5.61e-03	NA	0.005
3. B	P50086	Probable 26S proteasome regulatory subunit p28	4.83e-09	NA	5.55e-04
3. B	P42771	Cyclin-dependent kinase inhibitor 2A	3.06e-07	NA	3.25e-04
3. B	Q02979	Glycerophosphocholine phosphodiesterase GDE1	2.17e-02	NA	7.96e-04
3. B	Q505D1	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A	1.59e-02	NA	1.32e-15
3. B	Q8IUH4	Palmitoyltransferase ZDHHC13	6.21e-04	NA	1.44e-07
3. B	P81069	GA-binding protein subunit beta-2	1.72e-06	NA	1.98e-05
3. B	Q54GC8	Acyl-CoA-binding domain-containing protein 6 homolog	9.68e-06	NA	1.11e-04
3. B	Q9VUW9	Palmitoyltransferase Hip14	8.77e-04	NA	7.38e-05
3. B	Q9NXR5	Ankyrin repeat domain-containing protein 10	1.99e-05	NA	1.70e-07
3. B	Q96Q27	Ankyrin repeat and SOCS box protein 2	4.52e-04	NA	8.18e-04
3. B	Q00420	GA-binding protein subunit beta-1	1.66e-06	NA	3.33e-05
3. B	Q86WC6	Protein phosphatase 1 regulatory subunit 27	1.69e-13	NA	1.13e-06
3. B	Q9J508	Putative ankyrin repeat protein FPV227	NA	NA	0.006
3. B	A4D7T3	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	6.67e-05	NA	0.006
3. B	Q8R516	E3 ubiquitin-protein ligase MIB2	7.33e-03	NA	0.034
3. B	P83757	NF-kappa-B inhibitor cactus	NA	NA	5.90e-08
3. B	Q13418	Integrin-linked protein kinase	6.89e-10	NA	1.53e-07
3. B	Q8BG95	Protein phosphatase 1 regulatory subunit 12B	1.33e-02	NA	8.66e-09
3. B	Q6ZVH7	Espin-like protein	3.48e-03	NA	1.53e-08
3. B	Q9FF09	Phytochrome-interacting ankyrin-repeat protein 1	9.27e-07	NA	8.60e-07
3. B	F1REV3	Krev interaction trapped protein 1	5.86e-03	NA	1.21e-06
3. B	Q9C0D5	Protein TANC1	1.06e-01	NA	1.05e-07
3. B	Q5BKI6	Ankyrin repeat domain-containing protein 1	3.33e-06	NA	2.04e-08
3. B	Q9Z1P7	KN motif and ankyrin repeat domain-containing protein 3	8.73e-03	NA	0.002
3. B	Q9D738	Ankyrin repeat and SOCS box protein 12	8.07e-07	NA	1.69e-04
3. B	Q07DZ5	Cortactin-binding protein 2	9.61e-02	NA	2.24e-08
3. B	D3YZU1	SH3 and multiple ankyrin repeat domains protein 1	3.61e-01	NA	1.52e-04
3. B	Q92527	Ankyrin repeat domain-containing protein 7	1.29e-08	NA	2.01e-05
3. B	Q02989	Alpha-latroinsectotoxin-Lt1a (Fragment)	5.07e-02	NA	7.29e-05
3. B	Q60J38	Ankyrin repeat and KH domain-containing protein CBG24701	3.06e-01	NA	8.71e-05
3. B	D3ZD05	KN motif and ankyrin repeat domain-containing protein 2	1.62e-02	NA	0.049
3. B	Q8T2Q0	Putative ZDHHC-type palmitoyltransferase 6	8.32e-04	NA	1.29e-06
3. B	B2RXR6	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B	6.10e-03	NA	1.76e-15
3. B	Q502K3	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C	2.32e-02	NA	1.01e-17
3. B	Q3TPE9	Ankyrin repeat and MYND domain-containing protein 2	1.35e-05	NA	2.45e-07
3. B	Q862Z2	Ankyrin repeat and SOCS box protein 5	1.05e-05	NA	7.14e-05
3. B	Q9C104	Glycerophosphocholine phosphodiesterase gde1	3.70e-02	NA	5.62e-05
3. B	Q7M6U3	Inactive serine/threonine-protein kinase TEX14	2.38e-02	NA	4.56e-07
3. B	Q571F8	Glutaminase liver isoform, mitochondrial	7.41e-03	NA	0.004
3. B	Q9EP71	Ankycorbin	4.78e-03	NA	7.99e-05
3. B	Q2QLB3	Cortactin-binding protein 2	9.47e-02	NA	2.54e-08
3. B	Q05753	Ankyrin repeat domain-containing protein, chloroplastic	1.55e-06	NA	6.12e-05
3. B	Q8HYY4	Uveal autoantigen with coiled-coil domains and ankyrin repeats protein	1.91e-02	NA	8.59e-04
3. B	Q6UB99	Ankyrin repeat domain-containing protein 11	3.77e-01	NA	2.62e-07
3. B	O55222	Integrin-linked protein kinase	8.58e-07	NA	1.56e-07
3. B	Q9J569	Putative ankyrin repeat protein FPV162	NA	NA	4.47e-07
3. B	Q3SX45	Ankyrin repeat and SOCS box protein 2	3.85e-04	NA	5.05e-06
3. B	Q9SAR5	Ankyrin repeat domain-containing protein 2A	7.71e-08	NA	1.52e-06
3. B	Q08DV6	Ankyrin repeat and SOCS box protein 3	3.39e-03	NA	1.26e-05
3. B	Q9JUF2	Putative ankyrin repeat protein NMA1343	2.64e-03	NA	3.26e-04
3. B	Q09103	Eye-specific diacylglycerol kinase	3.57e-02	NA	4.68e-04
3. B	Q04721	Neurogenic locus notch homolog protein 2	3.78e-01	NA	0.038
3. B	Q09YI1	Cortactin-binding protein 2	4.24e-02	NA	9.22e-08
3. B	Q3UMT1	Protein phosphatase 1 regulatory subunit 12C	2.17e-03	NA	1.90e-07
3. B	Q9C7A2	Ankyrin repeat-containing protein ITN1	1.79e-03	NA	0.004
3. B	Q8N6D5	Ankyrin repeat domain-containing protein 29	5.74e-07	NA	0.008
3. B	O15084	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A	1.61e-02	NA	1.44e-15
3. B	Q5NVB9	Palmitoyltransferase ZDHHC13	1.16e-03	NA	1.44e-07
3. B	Q7T2B9	Myotrophin	1.10e-14	NA	0.002
3. B	Q9J4Z5	Putative ankyrin repeat protein FPV245	NA	NA	6.72e-08
3. B	Q8BTI7	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C	1.01e-02	NA	8.97e-15
3. B	E5RJM6	Ankyrin repeat domain-containing protein 65	8.67e-06	NA	5.16e-07
3. B	Q6P9Z4	Protein fem-1 homolog A	1.47e-05	NA	3.70e-04
3. B	Q9GZV1	Ankyrin repeat domain-containing protein 2	4.00e-06	NA	6.61e-09
3. B	Q6GQX6	Ankyrin repeat and SAM domain-containing protein 6	1.17e-04	NA	0.008
3. B	Q86U10	60 kDa lysophospholipase	4.92e-05	NA	0.023
3. B	Q2IBB1	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	6.59e-05	NA	0.041
3. B	Q59H18	Serine/threonine-protein kinase TNNI3K	4.26e-03	NA	1.70e-08
3. B	Q9SM23	Acyl-CoA-binding domain-containing protein 1	7.00e-05	NA	0.001
3. B	Q3S405	Transcription factor SWI6	4.89e-02	NA	0.018
3. B	Q99PE2	Ankyrin repeat family A protein 2	3.13e-06	NA	2.30e-04
3. B	Q9BSK4	Protein fem-1 homolog A	3.86e-04	NA	1.42e-05
3. B	Q9H9B1	Histone-lysine N-methyltransferase EHMT1	1.08e-02	NA	9.47e-08
3. B	Q99ME3	Synphilin-1	1.21e-02	NA	0.030
3. B	P35210	Protein SPT23	1.89e-01	NA	0.022
3. B	P42773	Cyclin-dependent kinase 4 inhibitor C	2.10e-10	NA	5.75e-05
3. B	Q28BK1	E3 ubiquitin-protein ligase HACE1	1.20e-03	NA	4.19e-08
3. B	D4A615	Tonsoku-like protein	1.47e-01	NA	4.01e-04
3. B	Q96KQ4	Apoptosis-stimulating of p53 protein 1	1.27e-02	NA	7.51e-04
3. B	Q9BZF9	Uveal autoantigen with coiled-coil domains and ankyrin repeats	2.98e-02	NA	0.004
3. B	Q9DAM9	Fibronectin type 3 and ankyrin repeat domains 1 protein	3.05e-06	NA	0.025
3. B	Q8N283	Ankyrin repeat domain-containing protein 35	8.37e-03	NA	3.16e-05
3. B	Q8WXH4	Ankyrin repeat and SOCS box protein 11	1.83e-06	NA	2.93e-05
3. B	O60733	85/88 kDa calcium-independent phospholipase A2	4.60e-03	NA	6.25e-06
3. B	Q9ERK0	Receptor-interacting serine/threonine-protein kinase 4	6.06e-03	NA	2.36e-09
3. B	A0A1D8PNZ7	Glycerophosphocholine phosphodiesterase GDE1	5.43e-02	NA	4.02e-05
3. B	Q810B6	Rabankyrin-5	3.17e-02	NA	6.71e-04
3. B	Q09YJ3	Cortactin-binding protein 2	1.26e-01	NA	9.14e-08
3. B	Q12955	Ankyrin-3	NA	NA	4.08e-13
3. B	Q8C0T1	Protein fem-1 homolog A-B	1.27e-05	NA	1.59e-05
3. B	P04297	Interferon antagonist K1L	NA	NA	0.002
3. B	Q38998	Potassium channel AKT1	2.48e-02	NA	1.52e-07
3. B	Q80TN5	Palmitoyltransferase ZDHHC17	1.10e-03	NA	8.88e-09
3. B	Q9JLQ2	ARF GTPase-activating protein GIT2	3.10e-03	NA	0.001
3. B	P20749	B-cell lymphoma 3 protein	2.19e-04	NA	3.79e-04
3. B	Q7S3M5	Palmitoyltransferase akr1	1.09e-03	NA	1.31e-06
3. B	Q3V0J4	Ankyrin repeat domain-containing protein 53	6.62e-05	NA	0.001
3. B	Q7Z6G8	Ankyrin repeat and sterile alpha motif domain-containing protein 1B	5.63e-02	NA	3.45e-07
3. B	Q99LJ2	Ankyrin repeat and BTB/POZ domain-containing protein 1	1.45e-02	NA	0.018
3. B	Q5R5V4	Integrin-linked protein kinase	5.50e-07	NA	1.64e-07
3. B	O75832	26S proteasome non-ATPase regulatory subunit 10	9.46e-08	NA	1.32e-08
3. B	F1M5M3	Inactive serine/threonine-protein kinase TEX14	NA	NA	4.95e-08
3. B	P62775	Myotrophin	1.17e-14	NA	0.001
3. B	Q6ZW76	Ankyrin repeat and SAM domain-containing protein 3	1.40e-04	NA	5.80e-06
3. B	Q9BYB0	SH3 and multiple ankyrin repeat domains protein 3	1.84e-01	NA	0.036
3. B	Q9TZM3	Leucine-rich repeat serine/threonine-protein kinase 1	3.83e-01	NA	0.017
3. B	Q8GXE6	Potassium channel AKT6	4.41e-02	NA	5.75e-05
3. B	Q9N3Q8	Dauer abnormal formation protein 25	5.01e-07	NA	5.98e-08
3. B	A0A140LI88	Ankyrin repeat domain-containing protein 31	1.32e-01	NA	0.002
3. B	Q09YK4	Cortactin-binding protein 2	7.31e-02	NA	8.72e-08
3. B	Q8C8R3	Ankyrin-2	NA	NA	5.50e-11
3. B	E1C656	E3 ubiquitin-protein ligase HACE1	1.55e-03	NA	5.08e-08
3. B	Q6F6B3	Protein TANC1	6.81e-02	NA	2.51e-06
3. B	Q17QS6	Ankyrin repeat and SOCS box protein 5	7.35e-05	NA	4.43e-05
3. B	Q8N8V4	Ankyrin repeat and SAM domain-containing protein 4B	4.67e-05	NA	2.52e-08
3. B	Q07DY6	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	3.53e-05	NA	0.041
3. B	Q7T3Y0	Notch-regulated ankyrin repeat-containing protein A	3.16e-06	NA	9.38e-07
3. B	P40480	Protein HOS4	2.06e-02	NA	4.58e-09
3. B	Q55FM5	Myotrophin homolog	3.65e-13	NA	2.99e-04
3. B	Q9H9E1	Ankyrin repeat family A protein 2	4.43e-06	NA	1.12e-04
3. B	Q6NXT1	Ankyrin repeat domain-containing protein 54	4.83e-08	NA	1.15e-10
3. B	Q8BIZ1	Ankyrin repeat and sterile alpha motif domain-containing protein 1B	4.66e-02	NA	4.13e-07
3. B	Q6AWW5	Ankyrin repeat-containing protein At5g02620	3.48e-04	NA	0.011
3. B	Q9QZH2	BRCA1-associated RING domain protein 1	2.39e-03	NA	5.51e-12
3. B	Q7ZT11	Ankyrin repeat domain-containing protein 1	1.02e-07	NA	8.99e-08
3. B	Q07E43	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	3.33e-05	NA	0.004
3. B	Q8TC84	Fibronectin type 3 and ankyrin repeat domains protein 1	4.46e-06	NA	0.003
3. B	Q91ZA8	Notch-regulated ankyrin repeat-containing protein	3.73e-06	NA	4.64e-07
3. B	Q9J503	Putative ankyrin repeat protein FPV232	NA	NA	0.017
3. B	Q99728	BRCA1-associated RING domain protein 1	3.42e-03	NA	9.77e-12
3. B	P97570	85/88 kDa calcium-independent phospholipase A2	6.79e-03	NA	1.44e-07
3. B	Q3UMR0	Ankyrin repeat domain-containing protein 27	1.59e-02	NA	5.88e-08
3. B	A3AYR1	Acyl-CoA-binding domain-containing protein 4	3.39e-05	NA	0.004
3. B	Q3T0F7	Myotrophin	1.71e-14	NA	0.002
3. B	Q811D2	Ankyrin repeat domain-containing protein 26	6.39e-02	NA	9.91e-08
3. B	Q07DY4	Cortactin-binding protein 2	1.17e-01	NA	1.11e-06
3. B	Q8C0J6	Ankyrin repeat domain-containing protein SOWAHC	7.07e-04	NA	0.003
3. B	A1X157	Cortactin-binding protein 2	1.32e-01	NA	1.95e-08
3. B	Q9HCD6	Protein TANC2	1.76e-01	NA	1.74e-07
3. B	Q9Z148	Histone-lysine N-methyltransferase EHMT2	1.96e-02	NA	1.89e-07
3. B	Q9GL21	Uveal autoantigen with coiled-coil domains and ankyrin repeats	5.26e-02	NA	7.77e-04
3. B	Q9CZK6	Ankyrin repeat and SAM domain-containing protein 3	1.75e-04	NA	6.92e-06
3. B	Q8TAK5	GA-binding protein subunit beta-2	1.81e-04	NA	7.96e-05
3. B	Q1RK83	Putative ankyrin repeat protein RBE_0150	2.33e-09	NA	5.32e-04
3. B	Q99J82	Integrin-linked protein kinase	1.77e-06	NA	1.56e-07
3. B	Q2QLF8	Cortactin-binding protein 2	1.21e-01	NA	7.72e-08
3. B	Q2IBF7	Cortactin-binding protein 2	1.26e-01	NA	1.51e-07
3. B	P18954	Protein PhlB	4.59e-07	NA	0.003
3. B	Q71S22	Inversin-A	1.28e-03	NA	1.71e-09
3. B	Q5XIU1	Ankyrin repeat and BTB/POZ domain-containing protein 1	1.46e-02	NA	0.018
3. B	Q9BZ19	Ankyrin repeat domain-containing protein 60	1.55e-04	NA	0.047
3. B	A0M8T3	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	4.38e-05	NA	0.008
3. B	Q4UMH6	Putative ankyrin repeat protein RF_0381	4.70e-03	NA	5.33e-08
3. B	P53355	Death-associated protein kinase 1	3.29e-02	NA	2.81e-06
3. B	Q804S5	E3 ubiquitin-protein ligase mib1	1.30e-02	NA	6.68e-05
3. B	Q8IYU2	E3 ubiquitin-protein ligase HACE1	1.24e-03	NA	6.70e-08
3. B	Q875S9	Palmitoyltransferase AKR1	7.12e-04	NA	3.48e-06
3. B	A8MXQ7	IQ motif and ankyrin repeat domain-containing protein 1	5.36e-05	NA	1.20e-04
3. B	P0CS66	Palmitoyltransferase AKR1	3.05e-03	NA	1.36e-04
3. B	Q53LP3	Ankyrin repeat domain-containing protein SOWAHC	2.25e-03	NA	0.004
3. B	Q9HLN1	Putative ankyrin repeat protein Ta0196	6.22e-08	NA	6.40e-05
3. B	Q8NB46	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C	1.15e-02	NA	1.28e-14
3. B	Q0VCS9	Ankyrin repeat and MYND domain-containing protein 2	1.36e-05	NA	3.02e-06
3. B	P25963	NF-kappa-B inhibitor alpha	2.84e-05	NA	2.06e-06
3. B	Q5REW9	Ankyrin repeat domain-containing protein 27	2.09e-02	NA	1.05e-07
3. B	Q863Z4	Myotrophin	1.50e-14	NA	0.002
3. B	Q9CQ31	Ankyrin repeat and SOCS box protein 11	1.81e-06	NA	1.53e-05
3. B	Q6JAN1	Inversin	2.00e-02	NA	3.86e-08
3. B	F4IS56	Integrin-linked protein kinase 1	4.67e-03	NA	0.006
3. B	D3ZBM7	E3 ubiquitin-protein ligase HACE1	1.32e-03	NA	1.02e-07
3. B	A2AS55	Ankyrin repeat domain-containing protein 16	8.28e-06	NA	3.79e-10
3. B	Q9Y2X7	ARF GTPase-activating protein GIT1	1.40e-03	NA	0.001
3. B	Q9J5G9	Putative ankyrin repeat protein FPV034	NA	NA	0.027
3. B	Q9ZVC2	Regulatory protein NPR5	2.89e-04	NA	0.013
3. B	Q2QLA4	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1	2.56e-04	NA	0.007
3. B	P23631	Alpha-latrotoxin-Lt1a	5.23e-02	NA	0.001
3. B	Q5U5A6	Notch-regulated ankyrin repeat-containing protein	2.10e-06	NA	9.37e-07
3. B	P39010	Palmitoyltransferase AKR1	2.60e-03	NA	7.85e-05
3. B	Q8WXD9	Caskin-1	3.29e-02	NA	1.44e-04
3. B	Q8R560	Ankyrin repeat domain-containing protein 1	6.12e-07	NA	4.16e-08
3. B	Q9FPH0	Putative E3 ubiquitin-protein ligase XBAT34	7.17e-07	NA	0.012
3. B	Q9FY48	E3 ubiquitin-protein ligase KEG	7.03e-02	NA	0.010
3. B	Q54XY6	Probable serine/threonine-protein kinase DDB_G0278521	1.48e-02	NA	0.046
3. B	A0A084B9Z8	Ankyrin repeat domain-containing protein SAT10	2.67e-01	NA	1.20e-04
3. B	Q8WZ74	Cortactin-binding protein 2	6.99e-02	NA	1.61e-07
3. B	Q3EC11	Probable protein S-acyltransferase 23	2.05e-04	NA	3.62e-06
3. B	Q5B0V6	Palmitoyltransferase akr1	3.38e-03	NA	6.57e-06
3. B	Q8BLD6	Ankyrin repeat domain-containing protein 55	6.51e-04	NA	2.82e-06
3. B	Q6DRG7	Protein phosphatase 1 regulatory subunit 12A	8.09e-03	NA	2.08e-08
3. B	Q9VBP3	Poly [ADP-ribose] polymerase tankyrase	1.55e-02	NA	1.10e-08
3. B	Q96DX5	Ankyrin repeat and SOCS box protein 9	2.19e-05	NA	6.10e-07
3. B	Q6DCL5	E3 ubiquitin-protein ligase HACE1	4.00e-03	NA	4.21e-08
3. B	Q2QL82	Cortactin-binding protein 2	1.44e-01	NA	8.16e-08
3. B	Q96NW4	Ankyrin repeat domain-containing protein 27	2.37e-02	NA	4.39e-08
3. B	A7E2S9	Putative ankyrin repeat domain-containing protein 30B-like	1.90e-07	NA	1.16e-06
3. B	Q8VE42	Ankyrin repeat domain-containing protein 49	2.01e-06	NA	1.58e-05