Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
P0CG09
(C2 calcium-dependent domain-containing protein 4D) with a FATCAT P-Value: 1.25e-08 and RMSD of 4.39 angstrom. The sequence alignment identity is 79.6%.
Structural alignment shown in left. Query protein B7Z1M9 colored as red in alignment, homolog P0CG09 colored as blue.
Query protein B7Z1M9 is also shown in right top, homolog P0CG09 showed in right bottom. They are colored based on secondary structures.
B7Z1M9 MWLLEKAGYKVGAAEPAARWA-PSGLFSKRRAPGPPTSAC-PNVLTPDRIPQFFIPPRLPDPGGAVPAAR--RHVAGRGLPATCSLPHLAGREGWAFLPE 96 P0CG09 MWLLEKAGYRVRTAEARALQAHPS-LVPKRQARGSP-SRCNPNVLTPDRIPQFFIPPRLRDPRGA--EGRVDRNPGGRNLPVACSLPHLAGREGWAFLPE 96 B7Z1M9 SPHTRRRESLFHGPPPAPAGGLPAAQSRLHVSAPDLRLCRAPDSDTASSPDSSPFGSPR-PGLGRRRVSRPHSLSPEKASSADTSPHSPRRAGPPTPPLF 195 P0CG09 SPHTRRRESLFHG-PRGLAAGLAPAQSRLHVSAPDLRLCRAPDSDTASSPDSSPCGSPHTP--------RPQSLSPDEASSADTSPYAPRRA----PPLF 183 B7Z1M9 HLDFLCCQLRPTRESVLRLGPRGGQLRLSTEYQAGPGRLRLRLVSAEGLPRPRSRPGSGGGGCCVVLRLRPRVRPREQQSRVVKCSANPIFNEDFFFDGL 295 P0CG09 HLDFLCCQLRPTKDSVLRLGPRGGQLRLSTEYQAGPGRLRLRLVSAEGLPRPRTRPGSGGGGCCVILRLQPRVRPGAQRSRVVQSSCNPIFNEDFFFEGL 283 B7Z1M9 GPPDLAARSLRAKVLDRGAGLRRDVLLGECETPLIALLPPLGGGLGPGSSLAPTHLSL 353 P0CG09 RPPDLAVRSLRAKVLDRGAGLRRDVLLGECETPLIALLPPLAGGLGPGSSLAPTHLSL 341
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0005737 | cytoplasm |
| 1. PB | GO:0005509 | calcium ion binding |
| 1. PB | GO:0098978 | glutamatergic synapse |
| 1. PB | GO:0030155 | regulation of cell adhesion |
| 1. PB | GO:0031340 | positive regulation of vesicle fusion |
| 1. PB | GO:0005544 | calcium-dependent phospholipid binding |
| 1. PB | GO:0001786 | phosphatidylserine binding |
| 1. PB | GO:0006886 | intracellular protein transport |
| 1. PB | GO:0099699 | integral component of synaptic membrane |
| 1. PB | GO:0071277 | cellular response to calcium ion |
| 1. PB | GO:0017158 | regulation of calcium ion-dependent exocytosis |
| 1. PB | GO:0030672 | synaptic vesicle membrane |
| 1. PB | GO:0098793 | presynapse |
| 1. PB | GO:0005802 | trans-Golgi network |
| 1. PB | GO:0031267 | small GTPase binding |
| 1. PB | GO:1903861 | positive regulation of dendrite extension |
| 1. PB | GO:0030658 | transport vesicle membrane |
| 1. PB | GO:0042043 | neurexin family protein binding |
| 1. PB | GO:0030285 | integral component of synaptic vesicle membrane |
| 1. PB | GO:0005543 | phospholipid binding |
| 1. PB | GO:0099502 | calcium-dependent activation of synaptic vesicle fusion |
| 1. PB | GO:0014059 | regulation of dopamine secretion |
| 1. PB | GO:0016192 | vesicle-mediated transport |
| 1. PB | GO:0019898 | extrinsic component of membrane |
| 1. PB | GO:0050796 | regulation of insulin secretion |
| 1. PB | GO:0042470 | melanosome |
| 1. PB | GO:0051592 | response to calcium ion |
| 1. PB | GO:0030667 | secretory granule membrane |
| 1. PB | GO:0030141 | secretory granule |
| 1. PB | GO:0002528 | regulation of vascular permeability involved in acute inflammatory response |
| 1. PB | GO:0006887 | exocytosis |
| 1. PB | GO:0045956 | positive regulation of calcium ion-dependent exocytosis |
| 1. PB | GO:0017156 | calcium-ion regulated exocytosis |
| 1. PB | GO:0030276 | clathrin binding |
| 1. PB | GO:0005546 | phosphatidylinositol-4,5-bisphosphate binding |
| 1. PB | GO:0019897 | extrinsic component of plasma membrane |
| 1. PB | GO:0005513 | detection of calcium ion |
| 1. PB | GO:0031045 | dense core granule |
| 1. PB | GO:0098686 | hippocampal mossy fiber to CA3 synapse |
| 1. PB | GO:0070382 | exocytic vesicle |
| 1. PB | GO:0019905 | syntaxin binding |
| 1. PB | GO:0002675 | positive regulation of acute inflammatory response |
| 1. PB | GO:0005942 | phosphatidylinositol 3-kinase complex |
| 1. PB | GO:0016079 | synaptic vesicle exocytosis |
| 1. PB | GO:0000149 | SNARE binding |
| 1. PB | GO:0046982 | protein heterodimerization activity |
| 2. P | GO:0033162 | melanosome membrane |
| 2. P | GO:0046854 | phosphatidylinositol phosphate biosynthetic process |
| 2. P | GO:0030154 | cell differentiation |
| 2. P | GO:0070257 | positive regulation of mucus secretion |
| 2. P | GO:0007340 | acrosome reaction |
| 2. P | GO:0031528 | microvillus membrane |
| 2. P | GO:0060478 | acrosomal vesicle exocytosis |
| 2. P | GO:0021799 | cerebral cortex radially oriented cell migration |
| 2. P | GO:0021819 | layer formation in cerebral cortex |
| 2. P | GO:0048306 | calcium-dependent protein binding |
| 2. P | GO:0046935 | 1-phosphatidylinositol-3-kinase regulator activity |
| 2. P | GO:0030669 | clathrin-coated endocytic vesicle membrane |
| 2. P | GO:0040008 | regulation of growth |
| 2. P | GO:0019902 | phosphatase binding |
| 2. P | GO:0005886 | plasma membrane |
| 2. P | GO:0006904 | vesicle docking involved in exocytosis |
| 2. P | GO:0009968 | negative regulation of signal transduction |
| 2. P | GO:0097038 | perinuclear endoplasmic reticulum |
| 2. P | GO:0099525 | presynaptic dense core vesicle exocytosis |
| 2. P | GO:0021942 | radial glia guided migration of Purkinje cell |
| 2. P | GO:0042802 | identical protein binding |
| 2. P | GO:0042803 | protein homodimerization activity |
| 3. B | GO:0036477 | somatodendritic compartment |
| 3. B | GO:0050709 | negative regulation of protein secretion |
| 3. B | GO:0036092 | phosphatidylinositol-3-phosphate biosynthetic process |
| 3. B | GO:0032720 | negative regulation of tumor necrosis factor production |
| 3. B | GO:0070679 | inositol 1,4,5 trisphosphate binding |
| 3. B | GO:1905171 | positive regulation of protein localization to phagocytic vesicle |
| 3. B | GO:1900424 | regulation of defense response to bacterium |
| 3. B | GO:0030100 | regulation of endocytosis |
| 3. B | GO:0097061 | dendritic spine organization |
| 3. B | GO:0055037 | recycling endosome |
| 3. B | GO:0030424 | axon |
| 3. B | GO:0031338 | regulation of vesicle fusion |
| 3. B | GO:0030348 | syntaxin-3 binding |
| 3. B | GO:0031369 | translation initiation factor binding |
| 3. B | GO:0008430 | selenium binding |
| 3. B | GO:2000301 | negative regulation of synaptic vesicle exocytosis |
| 3. B | GO:0097449 | astrocyte projection |
| 3. B | GO:0008021 | synaptic vesicle |
| 3. B | GO:1905469 | negative regulation of clathrin-coated pit assembly |
| 3. B | GO:0060076 | excitatory synapse |
| 3. B | GO:0048487 | beta-tubulin binding |
| 3. B | GO:0050764 | regulation of phagocytosis |
| 3. B | GO:0007613 | memory |
| 3. B | GO:0016303 | 1-phosphatidylinositol-3-kinase activity |
| 3. B | GO:0098850 | extrinsic component of synaptic vesicle membrane |
| 3. B | GO:0035005 | 1-phosphatidylinositol-4-phosphate 3-kinase activity |
| 3. B | GO:0048787 | presynaptic active zone membrane |
| 3. B | GO:0001778 | plasma membrane repair |
| 3. B | GO:0005524 | ATP binding |
| 3. B | GO:0007420 | brain development |
| 3. B | GO:0007612 | learning |
| 3. B | GO:0043005 | neuron projection |
| 3. B | GO:0046929 | negative regulation of neurotransmitter secretion |
| 3. B | GO:0099519 | dense core granule cytoskeletal transport |
| 3. B | GO:0099059 | integral component of presynaptic active zone membrane |
| 3. B | GO:0043025 | neuronal cell body |
| 3. B | GO:0061792 | secretory granule maturation |
| 3. B | GO:0055038 | recycling endosome membrane |
| 3. B | GO:2000310 | regulation of NMDA receptor activity |
| 3. B | GO:0031339 | negative regulation of vesicle fusion |
| 3. B | GO:0098992 | neuronal dense core vesicle |
| 3. B | GO:0043195 | terminal bouton |
| 3. B | GO:0060077 | inhibitory synapse |
| 3. B | GO:0044297 | cell body |
| 3. B | GO:0042734 | presynaptic membrane |
| 3. B | GO:0050765 | negative regulation of phagocytosis |
| 3. B | GO:0048174 | negative regulation of short-term neuronal synaptic plasticity |
| 3. B | GO:0099161 | regulation of presynaptic dense core granule exocytosis |
| 3. B | GO:0061782 | vesicle fusion with vesicle |
| 3. B | GO:0052742 | phosphatidylinositol kinase activity |
| 3. B | GO:0044306 | neuron projection terminus |
| 3. B | GO:0006906 | vesicle fusion |
| 3. B | GO:0030670 | phagocytic vesicle membrane |
| 3. B | GO:0070092 | regulation of glucagon secretion |
| 3. B | GO:0033602 | negative regulation of dopamine secretion |
| 3. B | GO:0031625 | ubiquitin protein ligase binding |
| 3. B | GO:0043197 | dendritic spine |
| 3. B | GO:1905433 | negative regulation of retrograde trans-synaptic signaling by neuropeptide |
| 3. B | GO:0045806 | negative regulation of endocytosis |
| 3. B | GO:0048791 | calcium ion-regulated exocytosis of neurotransmitter |
| 3. B | GO:0090385 | phagosome-lysosome fusion |
| 3. B | GO:0005764 | lysosome |
| 3. B | GO:0040017 | positive regulation of locomotion |
| 3. B | GO:0009611 | response to wounding |
| 3. B | GO:1903979 | negative regulation of microglial cell activation |
| 3. B | GO:0046850 | regulation of bone remodeling |
| 3. B | GO:0032715 | negative regulation of interleukin-6 production |
| 3. B | GO:0030425 | dendrite |
| 3. B | GO:0042301 | phosphate ion binding |
| 3. B | GO:1900186 | negative regulation of clathrin-dependent endocytosis |
| 3. B | GO:0098685 | Schaffer collateral - CA1 synapse |
| 3. B | GO:0001891 | phagocytic cup |
| 3. B | GO:0099066 | integral component of neuronal dense core vesicle membrane |
| 3. B | GO:0099056 | integral component of presynaptic membrane |
| 3. B | GO:0043204 | perikaryon |
| 3. B | GO:0017075 | syntaxin-1 binding |
| 3. B | GO:0005516 | calmodulin binding |
| 3. B | GO:1905414 | negative regulation of dense core granule exocytosis |
| 3. B | GO:1901981 | phosphatidylinositol phosphate binding |
| 3. B | GO:0005765 | lysosomal membrane |
| 3. B | GO:0006909 | phagocytosis |
| 3. B | GO:0031594 | neuromuscular junction |
| 3. B | GO:0048471 | perinuclear region of cytoplasm |
| 3. B | GO:0007269 | neurotransmitter secretion |
| 3. B | GO:0005778 | peroxisomal membrane |
| 3. B | GO:0098794 | postsynapse |
| 3. B | GO:0043679 | axon terminus |
| 3. B | GO:0036465 | synaptic vesicle recycling |
| 3. B | GO:1905154 | negative regulation of membrane invagination |
| 3. B | GO:0033604 | negative regulation of catecholamine secretion |
| 3. B | GO:1990742 | microvesicle |
| 3. B | GO:1900242 | regulation of synaptic vesicle endocytosis |
| 3. B | GO:0051650 | establishment of vesicle localization |
| 3. B | GO:0030665 | clathrin-coated vesicle membrane |
| 3. B | GO:0045955 | negative regulation of calcium ion-dependent exocytosis |
| 3. B | GO:0098981 | cholinergic synapse |
| 3. B | GO:0098982 | GABA-ergic synapse |
| 3. B | GO:0014049 | positive regulation of glutamate secretion |
| 3. B | GO:0032009 | early phagosome |
| 3. B | GO:0005777 | peroxisome |
| 3. B | GO:1905162 | regulation of phagosome maturation |
| 3. B | GO:1990504 | dense core granule exocytosis |
| 3. B | GO:0061669 | spontaneous neurotransmitter secretion |
| 3. B | GO:0045202 | synapse |
| 3. B | GO:0014069 | postsynaptic density |
| 3. B | GO:0098675 | intrinsic component of neuronal dense core vesicle membrane |
| 3. B | GO:1990926 | short-term synaptic potentiation |
| 3. B | GO:1905415 | positive regulation of dense core granule exocytosis |
| 3. B | GO:0001818 | negative regulation of cytokine production |
| 3. B | GO:0099183 | trans-synaptic signaling by BDNF, modulating synaptic transmission |
| 3. B | GO:0031982 | vesicle |
| 3. B | GO:1990927 | calcium ion regulated lysosome exocytosis |
| 3. B | GO:1900243 | negative regulation of synaptic vesicle endocytosis |
| 3. B | GO:0045335 | phagocytic vesicle |
| 3. B | GO:0090119 | vesicle-mediated cholesterol transport |
| 3. B | GO:0045211 | postsynaptic membrane |
| 3. B | GO:0006914 | autophagy |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | O35681 | Synaptotagmin-3 | 8.91e-03 | 2.88e-04 | 0.008 |
| 1. PB | P40748 | Synaptotagmin-3 | 3.28e-02 | 8.84e-05 | 0.007 |
| 1. PB | B7Z1M9 | C2 calcium-dependent domain-containing protein 4D | 0 | 1.15e-129 | 0.0 |
| 1. PB | Q8IYJ3 | Synaptotagmin-like protein 1 | 1.38e-01 | 1.19e-02 | 0.019 |
| 1. PB | Q17RD7 | Synaptotagmin-16 | 2.16e-02 | 2.05e-08 | 0.027 |
| 1. PB | Q2KJ18 | C2 calcium-dependent domain-containing protein 4A | 5.71e-04 | 9.79e-16 | 8.46e-18 |
| 1. PB | A6NLJ0 | C2 calcium-dependent domain-containing protein 4B | 8.78e-04 | 1.15e-18 | 1.20e-14 |
| 1. PB | Q99N80 | Synaptotagmin-like protein 1 | 1.29e-01 | 1.13e-02 | 0.005 |
| 1. PB | Q7TN83 | Synaptotagmin-16 | 1.12e-01 | 2.27e-05 | 0.028 |
| 1. PB | Q8TF44 | C2 calcium-dependent domain-containing protein 4C | 6.38e-04 | 2.79e-10 | 3.18e-39 |
| 1. PB | Q8NCU7 | C2 calcium-dependent domain-containing protein 4A | 5.88e-04 | 5.21e-19 | 1.09e-19 |
| 1. PB | Q9BQG1 | Synaptotagmin-3 | 6.86e-02 | 1.26e-05 | 0.012 |
| 1. PB | P0CG09 | C2 calcium-dependent domain-containing protein 4D | 1.25e-08 | 1.99e-66 | 0.0 |
| 1. PB | Q5HZI2 | C2 calcium-dependent domain-containing protein 4C | 1.55e-03 | 2.25e-12 | 2.59e-40 |
| 2. P | Q5R8Q5 | Synaptotagmin-17 | 1.02e-03 | 7.11e-03 | NA |
| 2. P | Q9BSW7 | Synaptotagmin-17 | 2.38e-03 | 2.59e-03 | NA |
| 2. P | Q9HCH5 | Synaptotagmin-like protein 2 | 3.16e-01 | 3.83e-06 | NA |
| 2. P | Q91XT6 | Tandem C2 domains nuclear protein | 4.55e-03 | 4.71e-07 | NA |
| 2. P | Q5RCK6 | Synaptotagmin-10 | 9.78e-03 | 3.43e-02 | NA |
| 2. P | Q8VHQ2 | Suppressor of cytokine signaling 7 | 4.37e-01 | 8.16e-04 | NA |
| 2. P | Q99N50 | Synaptotagmin-like protein 2 | 5.55e-02 | 3.61e-04 | NA |
| 2. P | A4IJ05 | Synaptotagmin-17 | 7.51e-03 | 5.02e-03 | NA |
| 2. P | Q9R0N8 | Synaptotagmin-6 | 5.44e-03 | 1.69e-03 | NA |
| 2. P | Q80T23 | Synaptotagmin-like protein 5 | 2.82e-02 | 4.58e-06 | NA |
| 2. P | Q86SS6 | Synaptotagmin-9 | 7.41e-03 | 2.06e-04 | NA |
| 2. P | Q925C0 | Synaptotagmin-9 | 2.08e-02 | 9.22e-05 | NA |
| 2. P | Q7TN84 | Synaptotagmin-14 | 2.69e-02 | 2.25e-04 | NA |
| 2. P | Q812E4 | Synaptotagmin-like protein 5 | 5.93e-02 | 3.82e-05 | NA |
| 2. P | Q8N9U0 | Tandem C2 domains nuclear protein | 6.95e-03 | 8.24e-10 | NA |
| 2. P | Q9R0N9 | Synaptotagmin-9 | 9.06e-02 | 1.72e-04 | NA |
| 2. P | Q62746 | Synaptotagmin-6 | 4.05e-03 | 1.26e-03 | NA |
| 2. P | A6QP06 | Synaptotagmin-like protein 2 | 3.59e-02 | 1.87e-05 | NA |
| 2. P | Q5T7P8 | Synaptotagmin-6 | 4.12e-02 | 1.55e-04 | NA |
| 2. P | Q8NB59 | Synaptotagmin-14 | 1.03e-01 | 8.84e-05 | NA |
| 2. P | Q62807 | Synaptotagmin-17 | 6.17e-03 | 1.04e-02 | NA |
| 2. P | Q8TDW5 | Synaptotagmin-like protein 5 | 3.56e-02 | 1.21e-04 | NA |
| 2. P | O14512 | Suppressor of cytokine signaling 7 | 2.93e-01 | 2.31e-03 | NA |
| 2. P | Q920M7 | Synaptotagmin-17 | 1.27e-03 | 1.78e-02 | NA |
| 3. B | P50232 | Synaptotagmin-4 | 1.72e-02 | NA | 8.19e-04 |
| 3. B | Q9BT88 | Synaptotagmin-11 | 1.14e-02 | NA | 2.59e-04 |
| 3. B | P47708 | Rabphilin-3A | 1.46e-01 | NA | 6.61e-04 |
| 3. B | Q62747 | Synaptotagmin-7 | 2.52e-02 | NA | 0.002 |
| 3. B | O43581 | Synaptotagmin-7 | 3.82e-03 | NA | 0.001 |
| 3. B | O08835 | Synaptotagmin-11 | 1.58e-02 | NA | 1.71e-04 |
| 3. B | Q9R0N3 | Synaptotagmin-11 | 3.58e-03 | NA | 2.93e-04 |
| 3. B | P47709 | Rabphilin-3A | 4.38e-01 | NA | 8.69e-04 |
| 3. B | Q7TNF0 | Double C2-like domain-containing protein alpha | 8.57e-03 | NA | 0.018 |
| 3. B | P40749 | Synaptotagmin-4 | 7.32e-03 | NA | 0.001 |
| 3. B | P70611 | Double C2-like domain-containing protein alpha | 2.28e-02 | NA | 0.019 |
| 3. B | O00750 | Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta | 1.93e-01 | NA | 0.002 |
| 3. B | Q9Y2J0 | Rabphilin-3A | 4.06e-01 | NA | 0.001 |
| 3. B | P59926 | Synaptotagmin-15 | 6.25e-02 | NA | 0.005 |
| 3. B | Q06846 | Rabphilin-3A | 6.70e-02 | NA | 6.50e-04 |
| 3. B | Q9R0N7 | Synaptotagmin-7 | 1.40e-03 | NA | 0.002 |
| 3. B | P41885 | Rabphilin-1 | 1.37e-01 | NA | 0.002 |