Summary

B7ZAP0

Homolog: Q6NTM6.
Function: Coiled-coil domain-containing protein 42 like-2.

Statistics

Total GO Annotation: 74
Unique PROST Go: 60
Unique BLAST Go: 12

Total Homologs: 42
Unique PROST Homologs: 37
Unique BLAST Homologs: 4

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was Q6NTM6 (Coiled-coil domain-containing protein 42 like-2) with a FATCAT P-Value: 3.63e-13 and RMSD of 1.90 angstrom. The sequence alignment identity is 23.7%.
Structural alignment shown in left. Query protein B7ZAP0 colored as red in alignment, homolog Q6NTM6 colored as blue. Query protein B7ZAP0 is also shown in right top, homolog Q6NTM6 showed in right bottom. They are colored based on secondary structures. 

  B7ZAP0 MIENSSWSMTFEERENRRLQEASMRLEQENDDLAHELVTSKIALRNDLDQAEDKADVLNKEL-LLTKQR-LVETEEEKRKQEEETAQLK-EVF---RKQL 94
  Q6NTM6 --------MEFD------LGE-YFRAAFE-DKL---LV--KMP-----DR-ED--DFMTPATRLLEKRREMVEVEQALSTQKEE-FQMKSESLQQRRSEL 70

  B7ZAP0 E-KAEYEIKKTTAIIAEY-KQICSQLSTR---L-----EKQQAASKE----ELEVVKGKMMACKHC-------SDIFSKEGALK--LAATGRED--QGI- 168
  Q6NTM6 ELKEE-KLKDS---LFKFDKFLKENDSKRKRALHKAAEERQMAAQKERDALRLQAENTQLMQRKHILLQRQEKNSIYQRY--LQRVLERT---DEFQEVQ 161

  B7ZAP0 ETDDEKDS--------LKKQLR-----EME---LEL---AQTKLQLVEAK---CKIQ-ELEHQRGALMN------EIQ--AAKNS-WFSK----TLNSIK 232
  Q6NTM6 EMIDRFNTLMATQNKLLKRELKNQEHAEMEKARL-LHYQEETRSQILELNNQIAQLQGELERARAVAFQWESRWAQIQNTAAENTLRLGRVRMATLNLFQ 260

  B7ZAP0 TATGTQPLQPAPVTQPPKEST------------------------------------- 253
  Q6NTM6 TISKQMRLK----TDISVEDTEAQLEKIQICFEDLAAIHKDLKKAEMVPQTPAVPTTN 314

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0005815 microtubule organizing center
1. PB GO:0005813 centrosome
2. P GO:0051303 establishment of chromosome localization
2. P GO:0001764 neuron migration
2. P GO:0051301 cell division
2. P GO:0007094 mitotic spindle assembly checkpoint signaling
2. P GO:0019904 protein domain specific binding
2. P GO:0051028 mRNA transport
2. P GO:0007080 mitotic metaphase plate congression
2. P GO:0051642 centrosome localization
2. P GO:0016477 cell migration
2. P GO:0007100 mitotic centrosome separation
2. P GO:0005874 microtubule
2. P GO:0034501 protein localization to kinetochore
2. P GO:0031616 spindle pole centrosome
2. P GO:0048489 synaptic vesicle transport
2. P GO:0051932 synaptic transmission, GABAergic
2. P GO:0003341 cilium movement
2. P GO:0031023 microtubule organizing center organization
2. P GO:0047496 vesicle transport along microtubule
2. P GO:2000574 obsolete regulation of microtubule motor activity
2. P GO:0035024 negative regulation of Rho protein signal transduction
2. P GO:2000146 negative regulation of cell motility
2. P GO:0000922 spindle pole
2. P GO:0005871 kinesin complex
2. P GO:0000132 establishment of mitotic spindle orientation
2. P GO:0035974 meiotic spindle pole body
2. P GO:0030989 dynein-driven meiotic oscillatory nuclear movement
2. P GO:0048309 endoplasmic reticulum inheritance
2. P GO:0007129 homologous chromosome pairing at meiosis
2. P GO:0021987 cerebral cortex development
2. P GO:0070840 dynein complex binding
2. P GO:0043515 kinetochore binding
2. P GO:0031262 Ndc80 complex
2. P GO:0000940 outer kinetochore
2. P GO:0043015 gamma-tubulin binding
2. P GO:0036159 inner dynein arm assembly
2. P GO:0000795 synaptonemal complex
2. P GO:0000212 meiotic spindle organization
2. P GO:0045202 synapse
2. P GO:0048870 cell motility
2. P GO:0051298 centrosome duplication
2. P GO:0007130 synaptonemal complex assembly
2. P GO:0008017 microtubule binding
2. P GO:0007020 microtubule nucleation
2. P GO:0032118 horsetail-astral microtubule organization
2. P GO:0007010 cytoskeleton organization
2. P GO:0005789 endoplasmic reticulum membrane
2. P GO:0097225 sperm midpiece
2. P GO:0051311 meiotic metaphase plate congression
2. P GO:0000776 kinetochore
2. P GO:0007405 neuroblast proliferation
2. P GO:0030900 forebrain development
2. P GO:0010155 regulation of proton transport
2. P GO:0097545 axonemal outer doublet
2. P GO:0042802 identical protein binding
2. P GO:0031214 biomineral tissue development
2. P GO:0032154 cleavage furrow
2. P GO:0005635 nuclear envelope
2. P GO:0007097 nuclear migration
2. P GO:0007059 chromosome segregation
2. P GO:0019899 enzyme binding
3. B GO:0005875 microtubule associated complex
3. B GO:0043547 positive regulation of GTPase activity
3. B GO:0043087 regulation of GTPase activity
3. B GO:0015631 tubulin binding
3. B GO:0090630 activation of GTPase activity
3. B GO:0007049 cell cycle
3. B GO:0005096 GTPase activator activity
3. B GO:0005829 cytosol
3. B GO:2000637 positive regulation of gene silencing by miRNA
3. B GO:0031267 small GTPase binding
3. B GO:0006886 intracellular protein transport
3. B GO:0042335 cuticle development

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB B7ZAP0 Rab GTPase-activating protein 1-like, isoform 10 0 1.58e-130 0.0
2. P Q9SHJ6 Peroxisomal and mitochondrial division factor 2 1.24e-10 1.27e-02 NA
2. P Q3KPU6 Coiled-coil domain-containing protein 172 2.34e-11 2.79e-04 NA
2. P Q5U465 Coiled-coil domain-containing protein 125 1.02e-08 4.36e-02 NA
2. P Q8VDS7 Centrosomal protein CEP57L1 1.30e-09 2.84e-03 NA
2. P Q9NXR1 Nuclear distribution protein nudE homolog 1 9.89e-11 2.62e-05 NA
2. P A6NNP5 Coiled-coil domain-containing protein 169 1.14e-08 5.94e-04 NA
2. P Q6AXZ4 Centrosomal protein CEP57L1 9.74e-09 7.57e-03 NA
2. P Q9ZUA3 Microtubule-associated protein 70-3 1.56e-06 1.15e-03 NA
2. P Q3KPT0 Coiled-coil domain-containing protein 169 2.05e-07 2.03e-02 NA
2. P O45717 Protein nud-2 1.61e-11 1.05e-06 NA
2. P A9UQN0 Coiled-coil domain-containing protein 42 homolog 1.89e-11 4.74e-02 NA
2. P Q9V3V7 Kinetochore protein Spc25 1.85e-07 1.36e-02 NA
2. P Q6NRW2 Protein Spindly-B 6.18e-10 1.18e-02 NA
2. P B3DLE8 Protein Spindly 3.88e-08 1.02e-03 NA
2. P Q0VCP9 Coiled-coil domain-containing protein 149 9.53e-09 6.04e-03 NA
2. P C5DLA5 SWI5-dependent HO expression protein 3 3.05e-08 1.43e-04 NA
2. P P0DKC0 Proton pump-interactor 3B 8.92e-07 4.66e-02 NA
2. P Q10336 Meiotic coiled-coil protein 6 5.69e-11 4.62e-02 NA
2. P Q6Z746 Microtubule-associated protein 70-2 1.92e-08 6.20e-03 NA
2. P Q6ZUS5 Coiled-coil domain-containing protein 121 7.20e-10 3.16e-05 NA
2. P A7MD70 Protein Spindly 2.40e-08 5.12e-03 NA
2. P Q9LQU7 Microtubule-associated protein 70-4 9.23e-08 1.94e-03 NA
2. P F4K1B4 Nuclear envelope-associated protein 2 1.05e-12 1.06e-05 NA
2. P Q6NTM6 Coiled-coil domain-containing protein 42 like-2 3.63e-13 4.74e-02 NA
2. P M1V4Y8 Cilia- and flagella-associated protein 73 2.77e-11 3.40e-04 NA
2. P Q9CZA6 Nuclear distribution protein nudE homolog 1 1.59e-07 2.22e-02 NA
2. P Q32LM7 Coiled-coil domain-containing protein 152 1.17e-09 9.40e-03 NA
2. P Q8L7S4 Microtubule-associated protein 70-2 1.75e-06 1.33e-03 NA
2. P Q6AXT4 Coiled-coil domain-containing protein 172 5.95e-11 7.70e-04 NA
2. P Q4R7J8 Synaptonemal complex central element protein 1 7.10e-11 2.38e-02 NA
2. P O31700 Sporulation protein cse15 2.41e-11 9.62e-08 NA
2. P O97557 Tuftelin (Fragment) 3.01e-11 6.49e-03 NA
2. P Q6CRH4 SWI5-dependent HO expression protein 3 6.58e-09 5.28e-04 NA
2. P Q923A2 Protein Spindly 9.13e-07 1.62e-02 NA
2. P Q3KR99 Protein Spindly 2.95e-08 2.96e-02 NA
2. P P0DKC1 Proton pump-interactor 3A 1.87e-07 4.66e-02 NA
2. P Q08DR9 Protein Spindly 1.16e-09 1.20e-02 NA
3. B Q5RAN1 Rab GTPase-activating protein 1 1.47e-06 NA 8.07e-88
3. B H2KZZ6 Rab GTPase-activating protein tbc-11 NA NA 7.71e-24
3. B A2AWA9 Rab GTPase-activating protein 1 1.25e-06 NA 3.57e-93
3. B Q9Y3P9 Rab GTPase-activating protein 1 8.29e-07 NA 8.76e-88