Summary

B9A014

Homolog: P35072.
Function: Transposable element Tcb1 transposase.

Statistics

Total GO Annotation: 10
Unique PROST Go: 10
Unique BLAST Go: 0

Total Homologs: 22
Unique PROST Homologs: 19
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was P35072 (Transposable element Tcb1 transposase) with a FATCAT P-Value: 5.17e-09 and RMSD of 3.06 angstrom. The sequence alignment identity is 21.5%.
Structural alignment shown in left. Query protein B9A014 colored as red in alignment, homolog P35072 colored as blue. Query protein B9A014 is also shown in right top, homolog P35072 showed in right bottom. They are colored based on secondary structures. 

  B9A014 -------------------------MPRFASPL-LRNVIIRS-QFDGI--KR--KQCLQYLKTLRTLQYDGFKT-VYFG--E-TN-I--PESLVT--GED 60
  P35072 MDRNILRACREDPRRTSTDIQLSVTSPN--EPVPSRRTIRRRLQVAGLHGRRPVKKPLVSLKN-RKARVEWAKQHLSWGPREWANHIWSDESKFNMFG-- 95

  B9A014 ISDGYFIQTPTWCIVHAAGSQGWVPWKYRVFLRDELC--IKQ-EDSLFSEFC--DVVRKAYG--KCVIVVKERRQQEE-----QRPKEDREAEGQFYIPT 148
  P35072 -TDG--IQ---W-IRRPIGSR-YAP-QYQ-------CPTVKHGGGSVMVWGCFSDT---SMGPLKRIVGTMDRYVYEDILENTMRPWA-RANLGRSW--- 172

  B9A014 VISLASIMCCPEVAK-SCGH----------ELLSLPSPCNYLNPLDSAW----SSLKWFIINNRNE-FCLQSIDSGY-SYQCILFSNLI-S-----KGIE 225
  P35072 VFQQDN---DP---KHTSGHVANWFRRRRVNLLEWPSQSPDLNPIEHMWEELERRLKGVRASNANQKFA--QLEAAWKSIPMTVVQTLLESMPRRCKAV- 263

  B9A014 RINASKWRTLTSKVRRWENYYLGKFS 251
  P35072 -IDAKGYPT---KY------------ 273

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0004803 transposase activity
2. P GO:0000070 mitotic sister chromatid segregation
2. P GO:0000779 condensed chromosome, centromeric region
2. P GO:0019237 centromeric DNA binding
2. P GO:0032196 transposition
2. P GO:0006310 DNA recombination
2. P GO:0003676 nucleic acid binding
2. P GO:0006313 transposition, DNA-mediated
2. P GO:0015074 DNA integration
2. P GO:0003677 DNA binding

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q8CDS7 Uncharacterized protein C21orf140 homolog 0.00e+00 2.41e-50 1.09e-138
1. PB B9A014 Uncharacterized protein C21orf140 0 2.46e-134 0.0
1. PB F1MIW6 Uncharacterized protein C21orf140 homolog 0.00e+00 1.14e-71 3.59e-153
2. P P0CF28 Insertion element IS1 5 protein InsB 2.35e-02 3.14e-06 NA
2. P P0CF60 Putative transposase InsD for insertion element IS2E 1.47e-04 2.24e-02 NA
2. P O60108 CENP-B homolog protein 2 3.20e-03 4.18e-03 NA
2. P P59843 Insertion element IS1 protein InsB 1.12e-02 3.14e-06 NA
2. P P0CF30 Insertion element IS1 8 protein InsB 2.00e-02 3.14e-06 NA
2. P P0CF29 Insertion element IS1 6 protein InsB 1.89e-02 3.14e-06 NA
2. P P0A3L3 Insertion element IS136 uncharacterized protein Atu4601 9.24e-04 1.66e-05 NA
2. P P0CF25 Insertion element IS1 1 protein InsB 1.57e-02 3.14e-06 NA
2. P P0A3L4 Insertion element IS136 uncharacterized protein 9.09e-04 1.66e-05 NA
2. P P24536 Putative transposase for insertion sequence element IS402 3.74e-02 1.71e-02 NA
2. P P0CF31 Insertion element IS1 protein InsB 2.21e-02 3.82e-06 NA
2. P P03934 Transposable element Tc1 transposase 6.14e-09 9.14e-08 NA
2. P P0CF27 Insertion element IS1 3 protein InsB 2.22e-02 2.17e-06 NA
2. P P0CF26 Insertion element IS1 2 protein InsB 1.68e-02 2.17e-06 NA
2. P O05086 Uncharacterized transposase-like protein HI_1721 9.24e-04 1.44e-03 NA
2. P P57998 Insertion element IS1 4 protein InsB 1.87e-02 5.14e-07 NA
2. P A0A385XJL4 Insertion element IS1 9 protein InsB 2.09e-02 3.14e-06 NA
2. P Q04202 Transposable element Tcb2 transposase 5.64e-09 6.00e-07 NA
2. P P35072 Transposable element Tcb1 transposase 5.17e-09 9.99e-07 NA