Summary

C9JJ37

Homolog: A6QPA3.
Function: BTB/POZ domain-containing protein 19.

Statistics

Total GO Annotation: 230
Unique PROST Go: 31
Unique BLAST Go: 197

Total Homologs: 278
Unique PROST Homologs: 16
Unique BLAST Homologs: 258

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was A6QPA3 (BTB/POZ domain-containing protein 19) with a FATCAT P-Value: 0.0 and RMSD of 0.62 angstrom. The sequence alignment identity is 92.1%.
Structural alignment shown in left. Query protein C9JJ37 colored as red in alignment, homolog A6QPA3 colored as blue. Query protein C9JJ37 is also shown in right top, homolog A6QPA3 showed in right bottom. They are colored based on secondary structures. 

  C9JJ37 ME-PLGLVVHGKAEPFSAALRSLVNNPRYSDVCFVVGQERQEVFAHRCLLACRCNFFQRLLGTEPGPGVPSPVVLSTVPTEAFLAVLEFLYTNSVKLYRH 99
  A6QPA3 METP-GLVVHGEAAPFSTALRSLVNNPLYSDVRFVVGQERQEVFAHRCLLACRCNFFQRLLSSEPGPGVPSPVVLSTVPAEAFLAVLEFLYTNSAKLQRH 99

  C9JJ37 SVLEVLTAAVEYGLEELRELCLQFVVKVLDVDLVCEALQVAVTFGLGQLQERCVAFIEAHSQEALRTRGFLELSAAALLPLLRSDKLCVDEAELVRAARS 199
  A6QPA3 SVLEVLTAAVEYGLEELRELCLEFVVKALDVELVCEALQVAVTFGLGQLQERCVAFIEAHSQETLRTRGFLELSAPALLPLLRSDKLCVDEAELVLAARS 199

  C9JJ37 WARVGAAVLERPVAEVAAPVVKELRLALLAPAELSALEEQNRQEPLIPVEQIVEAWKCHALRRGDEARGAPCRRRRGTLPREHHRFLDLSFK 291
  A6QPA3 WARVGAAVLERPVAEVAAPVVRELRLALLAPAELSALEEQNRREPLIPVEQIVEAWKCHALRRGDAARGTPCRRRRGTLPREHHRFLDLPFK 291

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0016567 protein ubiquitination
1. PB GO:0000151 ubiquitin ligase complex
2. P GO:0009751 response to salicylic acid
2. P GO:0043063 intercellular bridge organization
2. P GO:0070647 protein modification by small protein conjugation or removal
2. P GO:0051973 positive regulation of telomerase activity
2. P GO:0009651 response to salt stress
2. P GO:0010087 phloem or xylem histogenesis
2. P GO:0010588 cotyledon vascular tissue pattern formation
2. P GO:0010167 response to nitrate
2. P GO:0009409 response to cold
2. P GO:0007623 circadian rhythm
2. P GO:0009739 response to gibberellin
2. P GO:0009723 response to ethylene
2. P GO:0071944 cell periphery
2. P GO:0009738 abscisic acid-activated signaling pathway
2. P GO:0009611 response to wounding
2. P GO:0009734 auxin-activated signaling pathway
2. P GO:0009737 response to abscisic acid
2. P GO:0080022 primary root development
2. P GO:0009958 positive gravitropism
2. P GO:0010182 sugar mediated signaling pathway
2. P GO:0010305 leaf vascular tissue pattern formation
2. P GO:0048367 shoot system development
2. P GO:0042542 response to hydrogen peroxide
2. P GO:0009753 response to jasmonic acid
2. P GO:0009733 response to auxin
2. P GO:0006355 regulation of transcription, DNA-templated
2. P GO:0090543 Flemming body
2. P GO:0009743 response to carbohydrate
2. P GO:0005516 calmodulin binding
2. P GO:1990756 ubiquitin ligase-substrate adaptor activity
2. P GO:0010200 response to chitin
3. B GO:0001227 DNA-binding transcription repressor activity, RNA polymerase II-specific
3. B GO:1901149 salicylic acid binding
3. B GO:0045604 regulation of epidermal cell differentiation
3. B GO:0072429 response to intra-S DNA damage checkpoint signaling
3. B GO:0071466 cellular response to xenobiotic stimulus
3. B GO:0016055 Wnt signaling pathway
3. B GO:0007094 mitotic spindle assembly checkpoint signaling
3. B GO:0048873 homeostasis of number of cells within a tissue
3. B GO:0045600 positive regulation of fat cell differentiation
3. B GO:0045886 negative regulation of synaptic assembly at neuromuscular junction
3. B GO:0042994 cytoplasmic sequestering of transcription factor
3. B GO:0003691 double-stranded telomeric DNA binding
3. B GO:0000122 negative regulation of transcription by RNA polymerase II
3. B GO:0072156 distal tubule morphogenesis
3. B GO:0031398 positive regulation of protein ubiquitination
3. B GO:0031463 Cul3-RING ubiquitin ligase complex
3. B GO:0000712 resolution of meiotic recombination intermediates
3. B GO:2000676 positive regulation of type B pancreatic cell apoptotic process
3. B GO:0006511 ubiquitin-dependent protein catabolic process
3. B GO:0071353 cellular response to interleukin-4
3. B GO:0035020 regulation of Rac protein signal transduction
3. B GO:0001887 selenium compound metabolic process
3. B GO:0010865 stipule development
3. B GO:1904431 positive regulation of t-circle formation
3. B GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
3. B GO:0007300 ovarian nurse cell to oocyte transport
3. B GO:0034451 centriolar satellite
3. B GO:0045109 intermediate filament organization
3. B GO:0030424 axon
3. B GO:0050951 sensory perception of temperature stimulus
3. B GO:0061138 morphogenesis of a branching epithelium
3. B GO:0001701 in utero embryonic development
3. B GO:0045171 intercellular bridge
3. B GO:0007301 female germline ring canal formation
3. B GO:0030723 ovarian fusome organization
3. B GO:0010187 negative regulation of seed germination
3. B GO:0070294 renal sodium ion absorption
3. B GO:0032435 negative regulation of proteasomal ubiquitin-dependent protein catabolic process
3. B GO:0031672 A band
3. B GO:0045656 negative regulation of monocyte differentiation
3. B GO:0014032 neural crest cell development
3. B GO:0008344 adult locomotory behavior
3. B GO:0045214 sarcomere organization
3. B GO:0004842 ubiquitin-protein transferase activity
3. B GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport
3. B GO:0014029 neural crest formation
3. B GO:0031275 obsolete regulation of lateral pseudopodium assembly
3. B GO:0032225 regulation of synaptic transmission, dopaminergic
3. B GO:0071233 cellular response to leucine
3. B GO:0036297 interstrand cross-link repair
3. B GO:0002467 germinal center formation
3. B GO:0032956 regulation of actin cytoskeleton organization
3. B GO:0043066 negative regulation of apoptotic process
3. B GO:0007163 establishment or maintenance of cell polarity
3. B GO:0009864 induced systemic resistance, jasmonic acid mediated signaling pathway
3. B GO:0001726 ruffle
3. B GO:0006513 protein monoubiquitination
3. B GO:0032465 regulation of cytokinesis
3. B GO:0007281 germ cell development
3. B GO:0030162 regulation of proteolysis
3. B GO:1902237 positive regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway
3. B GO:0005524 ATP binding
3. B GO:0051301 cell division
3. B GO:0010582 floral meristem determinacy
3. B GO:0005884 actin filament
3. B GO:2000291 regulation of myoblast proliferation
3. B GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
3. B GO:0010507 negative regulation of autophagy
3. B GO:0007297 ovarian follicle cell migration
3. B GO:0000706 meiotic DNA double-strand break processing
3. B GO:0060693 regulation of branching involved in salivary gland morphogenesis
3. B GO:0016605 PML body
3. B GO:0001658 branching involved in ureteric bud morphogenesis
3. B GO:0030057 desmosome
3. B GO:0019964 interferon-gamma binding
3. B GO:0042428 serotonin metabolic process
3. B GO:0030853 negative regulation of granulocyte differentiation
3. B GO:0005802 trans-Golgi network
3. B GO:2000031 regulation of salicylic acid mediated signaling pathway
3. B GO:2001014 regulation of skeletal muscle cell differentiation
3. B GO:0048808 male genitalia morphogenesis
3. B GO:0035183 female germline ring canal inner rim
3. B GO:0060586 multicellular organismal iron ion homeostasis
3. B GO:1901044 protein polyubiquitination involved in nucleus-associated proteasomal ubiquitin-dependent protein catabolic process
3. B GO:0071322 cellular response to carbohydrate stimulus
3. B GO:0010506 regulation of autophagy
3. B GO:0097718 disordered domain specific binding
3. B GO:0033557 Slx1-Slx4 complex
3. B GO:0050801 ion homeostasis
3. B GO:1904263 positive regulation of TORC1 signaling
3. B GO:0055038 recycling endosome membrane
3. B GO:0048813 dendrite morphogenesis
3. B GO:0071630 nuclear protein quality control by the ubiquitin-proteasome system
3. B GO:2000022 regulation of jasmonic acid mediated signaling pathway
3. B GO:0009615 response to virus
3. B GO:0005856 cytoskeleton
3. B GO:0009862 systemic acquired resistance, salicylic acid mediated signaling pathway
3. B GO:0010434 bract formation
3. B GO:0034599 cellular response to oxidative stress
3. B GO:0097602 cullin family protein binding
3. B GO:0005912 adherens junction
3. B GO:0035914 skeletal muscle cell differentiation
3. B GO:0045172 germline ring canal
3. B GO:0098528 skeletal muscle fiber differentiation
3. B GO:0021680 cerebellar Purkinje cell layer development
3. B GO:2000677 regulation of transcription regulatory region DNA binding
3. B GO:1903025 regulation of RNA polymerase II regulatory region sequence-specific DNA binding
3. B GO:0016234 inclusion body
3. B GO:2001243 negative regulation of intrinsic apoptotic signaling pathway
3. B GO:0050804 modulation of chemical synaptic transmission
3. B GO:0005654 nucleoplasm
3. B GO:0015629 actin cytoskeleton
3. B GO:0016358 dendrite development
3. B GO:0031674 I band
3. B GO:0031625 ubiquitin protein ligase binding
3. B GO:0009627 systemic acquired resistance
3. B GO:0035324 female germline ring canal
3. B GO:0005764 lysosome
3. B GO:0010833 telomere maintenance via telomere lengthening
3. B GO:0048741 skeletal muscle fiber development
3. B GO:0051865 protein autoubiquitination
3. B GO:0048208 COPII vesicle coating
3. B GO:0072686 mitotic spindle
3. B GO:0009944 polarity specification of adaxial/abaxial axis
3. B GO:0042748 circadian sleep/wake cycle, non-REM sleep
3. B GO:0000209 protein polyubiquitination
3. B GO:0031397 negative regulation of protein ubiquitination
3. B GO:0030134 COPII-coated ER to Golgi transport vesicle
3. B GO:0048257 3'-flap endonuclease activity
3. B GO:2001199 negative regulation of dendritic cell differentiation
3. B GO:0048439 flower morphogenesis
3. B GO:0060028 convergent extension involved in axis elongation
3. B GO:0010254 nectary development
3. B GO:0030425 dendrite
3. B GO:0030496 midbody
3. B GO:0009954 proximal/distal pattern formation
3. B GO:0045650 negative regulation of macrophage differentiation
3. B GO:0009968 negative regulation of signal transduction
3. B GO:0005634 nucleus
3. B GO:0099402 plant organ development
3. B GO:0010792 DNA double-strand break processing involved in repair via single-strand annealing
3. B GO:1901992 positive regulation of mitotic cell cycle phase transition
3. B GO:0005827 polar microtubule
3. B GO:0022008 neurogenesis
3. B GO:0046329 negative regulation of JNK cascade
3. B GO:0006895 Golgi to endosome transport
3. B GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding
3. B GO:0007049 cell cycle
3. B GO:0007010 cytoskeleton organization
3. B GO:2001200 positive regulation of dendritic cell differentiation
3. B GO:0048512 circadian behavior
3. B GO:0000070 mitotic sister chromatid segregation
3. B GO:0045661 regulation of myoblast differentiation
3. B GO:0042803 protein homodimerization activity
3. B GO:0061912 selective autophagy
3. B GO:0048471 perinuclear region of cytoplasm
3. B GO:0035853 chromosome passenger complex localization to spindle midzone
3. B GO:0036268 swimming
3. B GO:0006357 regulation of transcription by RNA polymerase II
3. B GO:0030127 COPII vesicle coat
3. B GO:1900242 regulation of synaptic vesicle endocytosis
3. B GO:2000312 regulation of kainate selective glutamate receptor activity
3. B GO:0061820 telomeric D-loop disassembly
3. B GO:0010022 meristem determinacy
3. B GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
3. B GO:0070936 protein K48-linked ubiquitination
3. B GO:0007286 spermatid development
3. B GO:0031267 small GTPase binding
3. B GO:0021987 cerebral cortex development
3. B GO:0000781 chromosome, telomeric region
3. B GO:2000104 negative regulation of DNA-dependent DNA replication
3. B GO:0033017 sarcoplasmic reticulum membrane
3. B GO:0005829 cytosol
3. B GO:0030865 cortical cytoskeleton organization
3. B GO:0009566 fertilization
3. B GO:0047485 protein N-terminus binding
3. B GO:0071889 14-3-3 protein binding
3. B GO:0007616 long-term memory
3. B GO:0003779 actin binding
3. B GO:0070522 ERCC4-ERCC1 complex
3. B GO:0001669 acrosomal vesicle
3. B GO:0016607 nuclear speck
3. B GO:0001933 negative regulation of protein phosphorylation
3. B GO:0071379 cellular response to prostaglandin stimulus
3. B GO:2000042 negative regulation of double-strand break repair via homologous recombination
3. B GO:0010227 floral organ abscission
3. B GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process
3. B GO:0090656 t-circle formation
3. B GO:0007628 adult walking behavior
3. B GO:0030307 positive regulation of cell growth
3. B GO:0030292 protein tyrosine kinase inhibitor activity
3. B GO:0046580 negative regulation of Ras protein signal transduction
3. B GO:0042802 identical protein binding
3. B GO:0009877 nodulation
3. B GO:1904357 negative regulation of telomere maintenance via telomere lengthening
3. B GO:0008584 male gonad development
3. B GO:1990390 protein K33-linked ubiquitination

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB O22890 Putative BTB/POZ domain-containing protein At2g40450 1.12e-09 6.11e-07 6.23e-04
1. PB A6QPA3 BTB/POZ domain-containing protein 19 0.00e+00 5.50e-110 8.98e-175
1. PB C9JJ37 BTB/POZ domain-containing protein 19 0 6.45e-140 0.0
1. PB Q9LQ95 BTB/POZ domain-containing protein At1g01640 2.27e-09 4.66e-10 4.21e-05
2. P Q6EJ98 BTB/POZ and TAZ domain-containing protein 5 8.27e-07 2.44e-05 NA
2. P Q9SJ29 Putative BTB/POZ domain-containing protein At2g05330 3.06e-06 5.42e-07 NA
2. P Q5UQJ1 Putative BTB/POZ domain-containing protein L834 NA 1.09e-15 NA
2. P P34325 Cytokinesis defective protein 7 1.92e-06 3.23e-07 NA
2. P Q94BN0 BTB/POZ and TAZ domain-containing protein 2 3.29e-06 5.45e-06 NA
2. P Q9LVG9 BTB/POZ domain-containing protein At5g60050 5.65e-04 2.16e-03 NA
2. P Q9LV63 BTB/POZ domain-containing protein At5g48510 5.46e-08 6.86e-14 NA
2. P Q9FJX5 BTB/POZ and TAZ domain-containing protein 4 9.61e-07 2.48e-02 NA
2. P Q9LFU0 BTB/POZ domain-containing protein DOT3 1.31e-03 2.08e-02 NA
2. P O74778 BTB/POZ domain-containing protein 2 4.37e-07 1.56e-21 NA
2. P O81432 Putative BTB/POZ domain-containing protein At4g04090 1.01e-10 3.15e-04 NA
2. P O64814 BTB/POZ domain-containing protein NPY4 3.52e-05 4.96e-02 NA
2. P Q9SVM0 BTB/POZ domain-containing protein At3g50780 1.19e-03 1.18e-02 NA
2. P P17367 Protein C5 NA 3.78e-02 NA
2. P Q95J53 BTB/POZ domain-containing protein 16 3.09e-06 3.64e-02 NA
2. P Q9SYL0 BTB/POZ and TAZ domain-containing protein 3 1.71e-06 4.59e-06 NA
3. B E9QIN8 Kelch-like protein 41a 5.02e-07 NA 1.27e-05
3. B Q54BA2 Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 3.05e-02 NA 6.35e-06
3. B Q6P8B3 Speckle-type POZ protein 8.76e-07 NA 2.45e-11
3. B Q6P798 RCC1 and BTB domain-containing protein 2 7.12e-09 NA 3.14e-08
3. B A0A1B8YAB1 Kelch repeat and BTB domain-containing protein 8 7.74e-08 NA 2.44e-08
3. B Q4VBD9 GDNF-inducible zinc finger protein 1 4.53e-01 NA 0.002
3. B Q8JZP3 Kelch-like protein 2 1.13e-07 NA 5.03e-04
3. B Q16RL8 Kelch-like protein diablo 1.86e-09 NA 2.87e-09
3. B P34147 Rho-related protein racA 4.40e-06 NA 1.93e-04
3. B B1WAZ8 Zinc finger and BTB domain-containing protein 8A 6.89e-04 NA 1.03e-04
3. B Q0VCJ6 Zinc finger and BTB domain-containing protein 8A 3.24e-04 NA 2.25e-04
3. B Q0IHH9 Speckle-type POZ protein B 9.96e-07 NA 1.58e-11
3. B Q14145 Kelch-like ECH-associated protein 1 2.41e-07 NA 8.49e-08
3. B Q5ZLD3 Kelch-like protein 13 2.14e-08 NA 4.17e-09
3. B Q9M1I7 Regulatory protein NPR6 2.04e-06 NA 2.73e-06
3. B F1MBP6 Kelch-like protein 3 1.01e-07 NA 1.60e-04
3. B Q684M4 Kelch-like ECH-associated protein 1 3.12e-07 NA 2.01e-08
3. B Q6NXM2 RCC1 and BTB domain-containing protein 1 6.67e-09 NA 4.68e-07
3. B Q7QGL0 Kelch-like protein diablo 2.04e-09 NA 1.04e-09
3. B Q8K2J9 BTB/POZ domain-containing protein 6 4.44e-16 NA 5.42e-14
3. B Q04652 Ring canal kelch protein NA NA 2.57e-07
3. B Q86UZ6 Zinc finger and BTB domain-containing protein 46 1.92e-03 NA 4.47e-05
3. B D3ZZC3 Kelch-like protein 22 7.69e-06 NA 9.89e-10
3. B Q3ZB90 Kelch repeat and BTB domain-containing protein 12 1.20e-08 NA 0.002
3. B Q8IXQ5 Kelch-like protein 7 2.51e-07 NA 1.13e-09
3. B Q9UH77 Kelch-like protein 3 1.15e-07 NA 2.04e-04
3. B Q3U410 Kelch-like protein 21 3.66e-09 NA 0.001
3. B Q8BUL5 Kelch-like protein 7 1.94e-07 NA 1.37e-09
3. B Q2M0J9 Kelch-like protein diablo 5.05e-09 NA 5.78e-09
3. B Q5U374 Kelch-like protein 12 2.57e-08 NA 6.53e-07
3. B Q9DB72 BTB/POZ domain-containing protein 17 4.32e-14 NA 0.011
3. B Q8N653 Leucine-zipper-like transcriptional regulator 1 8.40e-04 NA 1.95e-06
3. B Q8CII0 Zinc finger and BTB domain-containing protein 8B 1.28e-03 NA 1.34e-05
3. B Q5U575 Kelch-like protein 21 7.00e-09 NA 3.17e-05
3. B Q5RG82 Influenza virus NS1A-binding protein homolog A 2.66e-06 NA 1.62e-07
3. B Q8BHI4 Kelch repeat and BTB domain-containing protein 3 5.79e-09 NA 3.65e-10
3. B D2HEW7 Kelch-like protein 22 7.65e-06 NA 4.63e-10
3. B F1LZ52 Kelch-like protein 3 8.78e-08 NA 1.19e-04
3. B Q6NYM1 Kelch-like protein 21 1.77e-07 NA 8.02e-07
3. B Q6DFF6 Kelch-like protein 20 5.00e-08 NA 4.14e-10
3. B Q5R774 Kelch-like ECH-associated protein 1 2.39e-07 NA 5.60e-08
3. B Q8WZ60 Kelch-like protein 6 8.34e-08 NA 4.35e-11
3. B Q9P2N7 Kelch-like protein 13 4.47e-08 NA 8.42e-10
3. B D3Z8N4 Kelch-like protein 20 8.05e-08 NA 3.46e-10
3. B Q2HW56 BTB/POZ domain and ankyrin repeat-containing protein NOOT1 2.81e-06 NA 6.46e-05
3. B Q96BR9 Zinc finger and BTB domain-containing protein 8A 3.68e-04 NA 2.62e-04
3. B Q6V595 Kelch-like protein 6 7.38e-08 NA 7.53e-13
3. B Q6DEL7 Kelch-like protein 15 2.28e-09 NA 6.02e-10
3. B Q8CFE5 BTB/POZ domain-containing protein 7 1.94e-04 NA 0.030
3. B D3ZA50 Kelch-like protein 15 5.48e-09 NA 2.39e-10
3. B Q8NAB2 Kelch repeat and BTB domain-containing protein 3 4.10e-09 NA 2.66e-10
3. B Q5RCZ7 RCC1 and BTB domain-containing protein 2 9.07e-09 NA 2.97e-08
3. B Q5SVQ8 Zinc finger and BTB domain-containing protein 41 2.36e-02 NA 0.003
3. B B4L0G9 Kelch-like protein diablo 4.52e-09 NA 5.19e-09
3. B O57174 Kelch repeat protein F3 NA NA 0.032
3. B Q9CQ33 Leucine-zipper-like transcriptional regulator 1 2.08e-03 NA 3.70e-08
3. B Q8R2H4 Kelch-like protein 12 3.51e-08 NA 9.89e-08
3. B G8GTN7 BTB/POZ domain and ankyrin repeat-containing protein COCH 3.30e-06 NA 3.70e-05
3. B B4HIK1 Kelch-like protein diablo 3.66e-09 NA 8.00e-09
3. B Q96PQ7 Kelch-like protein 5 1.51e-07 NA 3.69e-08
3. B Q7ZX06 Speckle-type POZ protein A 9.88e-07 NA 2.45e-11
3. B Q5U504 Kelch-like protein 40 3.56e-07 NA 0.041
3. B Q9Z2X8 Kelch-like ECH-associated protein 1 4.03e-09 NA 1.66e-07
3. B Q9Y573 Actin-binding protein IPP 1.58e-07 NA 9.58e-11
3. B Q8BRG6 Kelch-like protein 24 9.77e-08 NA 3.69e-07
3. B Q9NVR0 Kelch-like protein 11 1.62e-11 NA 7.62e-07
3. B Q9H116 GDNF-inducible zinc finger protein 1 2.18e-01 NA 0.002
3. B Q9CR40 Kelch-like protein 28 4.05e-08 NA 1.02e-06
3. B Q2T9Z7 Kelch-like protein 9 5.30e-09 NA 5.35e-10
3. B E1B932 Kelch-like protein 12 2.95e-08 NA 5.05e-08
3. B Q9Y2F9 BTB/POZ domain-containing protein 3 2.89e-15 NA 4.95e-14
3. B Q5ZI33 Kelch-like protein 7 1.49e-07 NA 1.11e-09
3. B B4GRJ2 Kelch-like protein diablo 1.49e-07 NA 6.69e-09
3. B Q8BGY4 Kelch-like protein 26 8.48e-09 NA 2.77e-10
3. B Q52KG4 Zinc finger and BTB domain-containing protein 45 4.62e-01 NA 0.009
3. B Q8NAP8 Zinc finger and BTB domain-containing protein 8B 1.38e-03 NA 1.48e-04
3. B Q9UJP4 Kelch-like protein 21 3.75e-09 NA 0.001
3. B Q5R7B8 Kelch-like protein 20 5.72e-08 NA 4.00e-10
3. B Q96M94 Kelch-like protein 15 3.43e-09 NA 9.43e-10
3. B Q53G59 Kelch-like protein 12 4.94e-08 NA 1.24e-07
3. B P34568 BTB and MATH domain-containing protein 43 2.79e-06 NA 1.75e-08
3. B Q6YCH2 TD and POZ domain-containing protein 4 2.13e-07 NA 1.60e-08
3. B P0DMR5 TD and POZ domain-containing protein 1 5.12e-07 NA 1.34e-07
3. B A9JRD8 BTB/POZ domain-containing protein 6-A 4.11e-15 NA 7.23e-17
3. B Q9P2J3 Kelch-like protein 9 3.67e-09 NA 5.16e-10
3. B Q5BL35 Speckle-type POZ protein-like A 2.23e-06 NA 1.04e-07
3. B A1YPR0 Zinc finger and BTB domain-containing protein 7C 4.20e-04 NA 0.011
3. B Q8BZM0 Kelch-like protein 12 2.66e-09 NA 1.60e-07
3. B M3XQV7 BTB/POZ domain-containing protein 3 5.33e-15 NA 5.81e-14
3. B Q9VUU5 Kelch-like protein diablo 4.24e-09 NA 8.00e-09
3. B P10074 Telomere zinc finger-associated protein 4.86e-02 NA 0.002
3. B Q96K62 Zinc finger and BTB domain-containing protein 45 6.51e-03 NA 0.009
3. B Q5R633 Telomere zinc finger-associated protein 6.33e-01 NA 8.64e-04
3. B O60662 Kelch-like protein 41 1.27e-08 NA 0.002
3. B Q5TZE1 BTB/POZ domain-containing protein 6-B 6.66e-16 NA 5.45e-16
3. B Q8CA72 Gigaxonin 5.24e-06 NA 7.94e-04
3. B Q9D783 Kelch-like protein 40 9.36e-07 NA 3.38e-07
3. B B4PD06 Kelch-like protein diablo 3.54e-09 NA 8.00e-09
3. B Q5RCQ9 Kelch-like protein 23 5.18e-07 NA 0.002
3. B B9DHT4 ARM REPEAT PROTEIN INTERACTING WITH ABF2 7.46e-04 NA 1.92e-08
3. B A4IFG2 BTB/POZ domain-containing protein 9 1.05e-13 NA 9.52e-22
3. B Q0VCW1 Speckle-type POZ protein 1.00e-06 NA 1.19e-11
3. B Q8N239 Kelch-like protein 34 6.59e-12 NA 1.94e-07
3. B E7F6F9 Kelch-like protein 3 6.62e-09 NA 0.003
3. B Q8VCZ7 Zinc finger and BTB domain-containing protein 7C 3.28e-04 NA 0.010
3. B Q9D618 Kelch repeat and BTB domain-containing protein 12 9.73e-12 NA 5.07e-05
3. B Q9H0C5 BTB/POZ domain-containing protein 1 3.33e-16 NA 3.49e-12
3. B Q99JN2 Kelch-like protein 22 7.02e-07 NA 5.61e-10
3. B Q6P1D7 Structure-specific endonuclease subunit SLX4 2.59e-01 NA 3.77e-04
3. B Q920G9 Germ cell-less protein-like 1 1.02e-08 NA 0.004
3. B Q9D5V2 Kelch-like protein 10 3.39e-07 NA 0.001
3. B P58544 BTB/POZ domain-containing protein 1 3.33e-16 NA 1.40e-11
3. B Q6P882 Zinc finger and BTB domain-containing protein 8A.2 6.38e-04 NA 9.09e-07
3. B A0A2R8Q1W5 Kelch-like ECH-associated protein 1B 1.93e-09 NA 1.73e-05
3. B O95198 Kelch-like protein 2 9.57e-08 NA 1.89e-04
3. B Q08CL3 Kelch repeat and BTB domain-containing protein 8 8.33e-07 NA 1.18e-10
3. B Q6INL2 Kelch-like protein 30 3.25e-07 NA 2.09e-07
3. B Q96IK5 Germ cell-less protein-like 1 9.37e-09 NA 0.008
3. B B3M9V8 Kelch-like protein diablo 5.65e-09 NA 2.53e-08
3. B Q5BK60 Kelch-like protein 38 1.16e-07 NA 0.006
3. B O94889 Kelch-like protein 18 7.09e-08 NA 2.07e-05
3. B Q2RAQ5 BTB/POZ domain and ankyrin repeat-containing protein NH5.1 3.40e-06 NA 0.004
3. B Q6NRH0 Kelch-like protein 12 3.45e-08 NA 3.07e-05
3. B Q9H511 Kelch-like protein 31 7.15e-09 NA 3.16e-06
3. B Q86V97 Kelch repeat and BTB domain-containing protein 6 3.14e-08 NA 1.68e-07
3. B Q2QXZ2 BTB/POZ domain and ankyrin repeat-containing protein NH5.2 1.08e-05 NA 0.002
3. B Q8LEV3 BTB/POZ domain-containing protein At2g30600 6.57e-10 NA 3.64e-05
3. B Q6ZPT1 Kelch-like protein 9 7.71e-09 NA 3.00e-10
3. B Q96Q07 BTB/POZ domain-containing protein 9 2.59e-13 NA 7.59e-22
3. B Q7ZVQ8 Influenza virus NS1A-binding protein homolog B 3.00e-05 NA 4.10e-07
3. B F1QEG2 Kelch-like protein 41b 6.90e-07 NA 1.84e-06
3. B Q5R4S6 Kelch repeat and BTB domain-containing protein 4 5.17e-06 NA 0.033
3. B Q80TF4 Kelch-like protein 13 6.87e-09 NA 1.11e-09
3. B Q54D84 Trishanku 1.61e-05 NA 2.56e-05
3. B Q811F1 Zinc finger and BTB domain-containing protein 41 1.93e-02 NA 0.005
3. B Q3ZCT8 Kelch repeat and BTB domain-containing protein 12 9.02e-12 NA 8.74e-05
3. B Q8BSF5 Kelch-like protein 38 1.60e-06 NA 0.001
3. B Q70JS2 Ring canal kelch homolog NA NA 6.72e-08
3. B B4J045 Kelch-like protein diablo 4.43e-09 NA 5.61e-09
3. B Q96NJ5 Kelch-like protein 32 6.30e-09 NA 1.03e-04
3. B Q8CE33 Kelch-like protein 11 2.12e-11 NA 7.55e-07
3. B Q9LYL9 BTB/POZ domain-containing protein At3g56230 2.81e-08 NA 1.01e-10
3. B Q8VCK5 Kelch-like protein 20 1.03e-07 NA 3.48e-10
3. B Q9Y2M5 Kelch-like protein 20 3.74e-09 NA 3.46e-10
3. B Q5PQR3 BTB/POZ domain-containing protein 9 1.36e-13 NA 9.62e-22
3. B Q5REP9 Kelch-like protein 3 1.06e-07 NA 2.97e-04
3. B O43791 Speckle-type POZ protein 1.35e-09 NA 1.19e-11
3. B Q0V9W6 BTB/POZ domain-containing protein 6 4.77e-15 NA 2.46e-13
3. B A0A072VIM5 BTB/POZ domain and ankyrin repeat-containing protein NOOT2 6.41e-06 NA 9.79e-06
3. B Q1LYM6 Kelch-like protein 38 8.12e-10 NA 3.69e-05
3. B Q9WTY8 Zinc finger and BTB domain-containing protein 10 1.80e-02 NA 4.12e-05
3. B Q9CWH1 Zinc finger and BTB domain-containing protein 8A 2.69e-04 NA 1.13e-04
3. B A6NCF5 Kelch-like protein 33 1.96e-06 NA 0.026
3. B B3DIV9 Kelch-like protein 40a 2.49e-07 NA 0.036
3. B Q9C0H6 Kelch-like protein 4 1.05e-07 NA 0.009
3. B O95199 RCC1 and BTB domain-containing protein 2 1.11e-08 NA 2.97e-08
3. B Q6TFL4 Kelch-like protein 24 9.17e-08 NA 4.58e-07
3. B A2AAX3 Kelch-like protein 15 5.65e-09 NA 2.39e-10
3. B Q9NVX7 Kelch repeat and BTB domain-containing protein 4 4.05e-06 NA 0.037
3. B Q5NVK7 Speckle-type POZ protein 9.78e-07 NA 1.19e-11
3. B P32228 Protein C4 NA NA 0.041
3. B O61366 Serine-enriched protein 3.95e-05 NA 1.31e-10
3. B O94955 Rho-related BTB domain-containing protein 3 3.38e-06 NA 0.004
3. B Q5RGB8 Kelch-like protein 26 9.78e-09 NA 2.13e-09
3. B Q8BWA5 Kelch-like protein 31 1.32e-09 NA 1.34e-06
3. B Q969K4 Ankyrin repeat and BTB/POZ domain-containing protein 1 7.38e-05 NA 2.48e-08
3. B Q5ZKD9 Kelch-like protein 20 1.08e-07 NA 1.30e-07
3. B B3NDN0 Kelch-like protein diablo 5.46e-09 NA 5.36e-09
3. B A6NE02 BTB/POZ domain-containing protein 17 2.18e-10 NA 2.17e-04
3. B Q8IY92 Structure-specific endonuclease subunit SLX4 3.21e-01 NA 4.65e-04
3. B O76612 BTB and MATH domain-containing protein 47 5.47e-03 NA 1.95e-05
3. B Q99LJ7 RCC1 and BTB domain-containing protein 2 1.30e-08 NA 1.83e-08
3. B Q717B4 TD and POZ domain-containing protein 3 1.75e-07 NA 5.96e-08
3. B Q2M2N2 Speckle-type POZ protein-like 3.35e-06 NA 4.91e-08
3. B E9Q4F2 Kelch-like protein 18 7.53e-08 NA 2.36e-05
3. B Q6JEL2 Kelch-like protein 10 2.12e-07 NA 0.001
3. B Q2LE78 BTB/POZ domain-containing protein 6 4.44e-15 NA 4.10e-14
3. B O15062 Zinc finger and BTB domain-containing protein 5 3.90e-03 NA 0.013
3. B Q6NRS1 Inhibitor of Bruton tyrosine kinase 2.75e-02 NA 0.031
3. B Q8C726 BTB/POZ domain-containing protein 9 1.56e-13 NA 6.22e-22
3. B Q6ZWS8 Speckle-type POZ protein 1.04e-09 NA 1.19e-11
3. B Q9H2C0 Gigaxonin 3.93e-06 NA 0.001
3. B Q8WVZ9 Kelch repeat and BTB domain-containing protein 7 8.79e-07 NA 5.21e-07
3. B P28575 Actin-binding protein IPP 2.58e-07 NA 5.26e-09
3. B Q6DBN1 BTB/POZ domain-containing protein At4g08455 4.95e-07 NA 0.046
3. B Q9BX70 BTB/POZ domain-containing protein 2 1.22e-15 NA 3.59e-14
3. B Q96KE9 BTB/POZ domain-containing protein 6 5.55e-16 NA 2.26e-15
3. B Q8NDN9 RCC1 and BTB domain-containing protein 1 1.17e-08 NA 2.31e-07
3. B D3ZUU2 GDNF-inducible zinc finger protein 1 3.79e-03 NA 1.87e-04
3. B Q9W2S3 BTB/POZ domain-containing protein 9 8.78e-12 NA 5.35e-19
3. B Q8BID6 Zinc finger and BTB domain-containing protein 46 1.17e-02 NA 2.09e-04
3. B Q8L746 Regulatory protein NPR3 7.04e-05 NA 0.007
3. B Q1H9T6 Telomere zinc finger-associated protein 3.31e-02 NA 6.43e-04
3. B B1WBU4 Zinc finger and BTB domain-containing protein 8A 3.73e-04 NA 6.82e-05
3. B Q9CTN4 Rho-related BTB domain-containing protein 3 9.52e-06 NA 0.004
3. B Q9NR64 Kelch-like protein 1 1.01e-07 NA 1.53e-05
3. B P0DMR6 TD and POZ domain-containing protein 1-like 2.04e-07 NA 1.61e-07
3. B Q6DFU2 Influenza virus NS1A-binding protein homolog 2.49e-06 NA 3.90e-05
3. B Q6JEL3 Kelch-like protein 10 4.25e-07 NA 0.001
3. B Q08CY1 Kelch-like protein 22 7.07e-07 NA 3.20e-11
3. B Q7TQG0 Zinc finger and BTB domain-containing protein 5 1.82e-03 NA 0.011
3. B A1L4W5 BTB/POZ and MATH domain-containing protein 6 4.04e-06 NA 3.83e-07
3. B Q99LJ2 Ankyrin repeat and BTB/POZ domain-containing protein 1 8.96e-05 NA 2.15e-07
3. B Q08DS0 Kelch-like protein 21 3.49e-09 NA 8.09e-04
3. B Q5ICL9 Regulatory protein NPR4 4.04e-05 NA 5.07e-04
3. B Q9Y6Y0 Influenza virus NS1A-binding protein 3.59e-05 NA 8.52e-07
3. B Q8R179 Kelch repeat and BTB domain-containing protein 4 5.78e-06 NA 0.035
3. B Q08DK3 Kelch-like protein 20 4.06e-09 NA 3.46e-10
3. B Q6YCH1 TD and POZ domain-containing protein 5 1.77e-10 NA 9.79e-08
3. B Q9NXS3 Kelch-like protein 28 4.68e-08 NA 4.64e-06
3. B E7BQV0 BTB/POZ domain and ankyrin repeat-containing protein NPR1 5.38e-04 NA 0.007
3. B Q96DT7 Zinc finger and BTB domain-containing protein 10 1.79e-02 NA 2.05e-05
3. B B4LIG6 Kelch-like protein diablo 5.14e-09 NA 4.81e-09
3. B A0JMG1 Speckle-type POZ protein-like B 1.49e-05 NA 2.93e-07
3. B Q6GR09 Speckle-type POZ protein-like 1.61e-06 NA 7.26e-06
3. B Q53HC5 Kelch-like protein 26 1.16e-08 NA 2.07e-08
3. B Q6ZPR6 Inhibitor of Bruton tyrosine kinase 1.89e-02 NA 0.002
3. B Q8NBE8 Kelch-like protein 23 4.17e-07 NA 8.57e-04
3. B D4A2K4 Kelch-like protein 21 3.96e-09 NA 0.001
3. B P57790 Kelch-like ECH-associated protein 1 2.44e-07 NA 1.77e-07
3. B Q5R663 Kelch repeat and BTB domain-containing protein 3 8.74e-09 NA 3.50e-10
3. B F7ASZ0 BTB/POZ domain-containing protein 3 4.00e-15 NA 4.99e-14
3. B Q5XIU1 Ankyrin repeat and BTB/POZ domain-containing protein 1 3.85e-05 NA 6.92e-07
3. B E0CZ16 Kelch-like protein 3 9.69e-08 NA 1.16e-04
3. B Q9JI74 Kelch-like protein 1 1.06e-07 NA 2.99e-06
3. B Q6GQU2 Kelch-like protein 23 2.88e-06 NA 5.99e-05
3. B Q920Q8 Influenza virus NS1A-binding protein homolog 2.83e-06 NA 3.65e-07
3. B Q8C3F7 Kelch-like protein 30 7.24e-09 NA 0.003
3. B Q5XHZ6 Kelch-like protein 7 2.38e-07 NA 7.47e-10
3. B A1L2U9 Zinc finger and BTB domain-containing protein 8A.1-B 1.78e-03 NA 1.66e-04
3. B Q7T330 Speckle-type POZ protein 9.32e-07 NA 3.23e-10
3. B P24357 Kelch repeat protein F3 NA NA 0.022
3. B B7U179 ARMADILLO BTB ARABIDOPSIS PROTEIN 1 9.02e-04 NA 1.91e-09
3. B Q5ZJU2 Kelch-like protein 15 5.17e-10 NA 9.03e-09
3. B Q56A24 Kelch-like protein 24 7.50e-08 NA 3.69e-07
3. B O93567 Zinc finger and BTB domain-containing protein 7A 1.67e-03 NA 0.007
3. B Q503R4 Kelch-like protein 36 9.82e-08 NA 6.98e-04
3. B P58545 BTB/POZ domain-containing protein 3 1.40e-14 NA 3.74e-14
3. B Q5EB39 Kelch-like protein 40 8.49e-07 NA 0.027
3. B A6QQY2 Kelch-like protein 13 3.89e-08 NA 8.73e-10
3. B Q1ECZ2 Kelch-like ECH-associated protein 1A 1.91e-07 NA 4.25e-10
3. B B4MXW3 Kelch-like protein diablo 1.21e-08 NA 6.40e-09
3. B Q9ZVC2 Regulatory protein NPR5 3.45e-06 NA 1.24e-04
3. B Q0IH98 Zinc finger and BTB domain-containing protein 8A.1-A 6.47e-04 NA 1.65e-04
3. B Q6IQ16 Speckle-type POZ protein-like 3.87e-06 NA 1.40e-07
3. B Q2TBA0 Kelch-like protein 40 7.32e-09 NA 1.22e-07
3. B Q9VFP2 Protein roadkill 3.51e-04 NA 1.80e-11
3. B Q53GT1 Kelch-like protein 22 2.53e-06 NA 4.67e-10
3. B B0WWP2 Kelch-like protein diablo 2.02e-09 NA 3.04e-09
3. B B4QLQ2 Kelch-like protein diablo 4.03e-09 NA 7.24e-09
3. B Q8NFY9 Kelch repeat and BTB domain-containing protein 8 5.63e-06 NA 1.02e-07
3. B Q5R4Q7 Leucine-zipper-like transcriptional regulator 1 1.99e-03 NA 1.70e-06
3. B Q0D2K2 Kelch-like protein 30 9.00e-09 NA 0.004
3. B F1LZF0 Kelch-like protein 2 1.12e-07 NA 3.49e-04
3. B Q2WGJ6 Kelch-like protein 38 1.76e-07 NA 0.017
3. B Q80T74 Kelch-like protein 29 3.66e-06 NA 0.014
3. B P21013 Kelch repeat protein F3 NA NA 0.019
3. B Q9N010 Kelch repeat and BTB domain-containing protein 4 3.68e-07 NA 0.027