Summary

E5RJM6

Homolog: A2AS55.
Function: Ankyrin repeat domain-containing protein 16.

Statistics

Total GO Annotation: 863
Unique PROST Go: 37
Unique BLAST Go: 745

Total Homologs: 969
Unique PROST Homologs: 40
Unique BLAST Homologs: 861

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was A2AS55 (Ankyrin repeat domain-containing protein 16) with a FATCAT P-Value: 0.0 and RMSD of 1.92 angstrom. The sequence alignment identity is 28.2%.
Structural alignment shown in left. Query protein E5RJM6 colored as red in alignment, homolog A2AS55 colored as blue. Query protein E5RJM6 is also shown in right top, homolog A2AS55 showed in right bottom. They are colored based on secondary structures.

  E5RJM6 MDSQRP-EPRE--EEEEEQELRWMELDSEEAL--GTRTEGPSVVQGWGH-LLQAVWR-GPAGLVTQLLRQ-GASVEE--RDHAGRTPLHLAVLRGHAPLV 90
  A2AS55 M--ALPGDPRRLCRLVQEGRLR--DLQEELAVARGCR--GPA-----GDTLLHCAARHGRQDILAYLVEAWSMDIEATNRDY--KRPLHEAASMGHRDCV 87

  E5RJM6 RLLLQRGAPVGAVDRAGRTALHEAAWHGHSRVAELLLQRGASAAARSGTGLTPLHWAAALGHTLLAARLL-EAPGPGPAAAEAEDARGW-TAAHWAAAGG 188
  A2AS55 RYLLGRGAVVDSLKKADWTPLMMACTRKNLDVIQDLVEHGANPLLKNKDGWNSFHIASREGHPVILRYLLTVCP----------DA--WKTESNI----- 170

  E5RJM6 RLAVLELLAAGGAGLDGALLVAAAAGRGAALRFLLARGARV--DARDGAGATALGLAAALGRSQDIEVLL-GHGADPGIRDRHGRSALHRAAARGHLLAV 285
  A2AS55 RRTPLHT-----AAMHGCL---------EAVQVLLER-CHYEPDCRDNCGVTPFMDAIQCGHVSIAKLLLEQHKACSSAADSMGAQALHRAAVTGQDEAI 255

  E5RJM6 QLLVT-QGAEVDAR-DTLGLTPLHHASREGHVEVAGCLLDRGAQVDATGWLRKTPLHLAAERG-HGPTVGLLLSRG------ASPTL---RTQWAEVAQM 373
  A2AS55 RFLVCGLGIDVDVRAKSSQLTALHYAAKEGQTNTVQTLLSLGADINSTDERNRSVLHLACA-GQHVACTRLLLQSGLKDSEDLTGTLAQQLTRSVDILQD 354

  E5RJM6 PEGDLPQALPELGGGEKECEGIESTG 399
  A2AS55 FDHDVKS------------------- 361

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0036336 dendritic cell migration
1. PB GO:0042994 cytoplasmic sequestering of transcription factor
1. PB GO:0032496 response to lipopolysaccharide
1. PB GO:0050729 positive regulation of inflammatory response
1. PB GO:0071345 cellular response to cytokine stimulus
1. PB GO:0055117 regulation of cardiac muscle contraction
1. PB GO:0042088 T-helper 1 type immune response
1. PB GO:0051059 NF-kappaB binding
1. PB GO:0016567 protein ubiquitination
1. PB GO:0003714 transcription corepressor activity
1. PB GO:0010888 negative regulation of lipid storage
1. PB GO:0010468 regulation of gene expression
1. PB GO:0085020 protein K6-linked ubiquitination
1. PB GO:0036371 protein localization to T-tubule
1. PB GO:0002467 germinal center formation
1. PB GO:0043066 negative regulation of apoptotic process
1. PB GO:0010745 negative regulation of macrophage derived foam cell differentiation
1. PB GO:0051101 regulation of DNA binding
1. PB GO:0055013 cardiac muscle cell development
1. PB GO:0045737 positive regulation of cyclin-dependent protein serine/threonine kinase activity
1. PB GO:0033257 Bcl3/NF-kappaB2 complex
1. PB GO:2000321 positive regulation of T-helper 17 cell differentiation
1. PB GO:0010225 response to UV-C
1. PB GO:0048536 spleen development
1. PB GO:0035994 response to muscle stretch
1. PB GO:0042826 histone deacetylase binding
1. PB GO:0070427 nucleotide-binding oligomerization domain containing 1 signaling pathway
1. PB GO:0045064 T-helper 2 cell differentiation
1. PB GO:0071222 cellular response to lipopolysaccharide
1. PB GO:0035914 skeletal muscle cell differentiation
1. PB GO:0032996 Bcl3-Bcl10 complex
1. PB GO:0071800 podosome assembly
1. PB GO:0034142 toll-like receptor 4 signaling pathway
1. PB GO:0002455 humoral immune response mediated by circulating immunoglobulin
1. PB GO:1901222 regulation of NIK/NF-kappaB signaling
1. PB GO:0043409 negative regulation of MAPK cascade
1. PB GO:0000151 ubiquitin ligase complex
1. PB GO:0005654 nucleoplasm
1. PB GO:0055007 cardiac muscle cell differentiation
1. PB GO:0031625 ubiquitin protein ligase binding
1. PB GO:0003713 transcription coactivator activity
1. PB GO:0007249 I-kappaB kinase/NF-kappaB signaling
1. PB GO:0045638 negative regulation of myeloid cell differentiation
1. PB GO:0033209 tumor necrosis factor-mediated signaling pathway
1. PB GO:0008139 nuclear localization sequence binding
1. PB GO:0090201 negative regulation of release of cytochrome c from mitochondria
1. PB GO:0030496 midbody
1. PB GO:0005634 nucleus
1. PB GO:0001835 blastocyst hatching
1. PB GO:0045732 positive regulation of protein catabolic process
1. PB GO:0007253 cytoplasmic sequestering of NF-kappaB
1. PB GO:0014732 skeletal muscle atrophy
1. PB GO:0019899 enzyme binding
1. PB GO:0010875 positive regulation of cholesterol efflux
1. PB GO:0045746 negative regulation of Notch signaling pathway
1. PB GO:0070531 BRCA1-A complex
1. PB GO:0043518 negative regulation of DNA damage response, signal transduction by p53 class mediator
1. PB GO:0043330 response to exogenous dsRNA
1. PB GO:0071356 cellular response to tumor necrosis factor
1. PB GO:0031663 lipopolysaccharide-mediated signaling pathway
1. PB GO:0002315 marginal zone B cell differentiation
1. PB GO:0070682 proteasome regulatory particle assembly
1. PB GO:0042981 regulation of apoptotic process
1. PB GO:0006915 apoptotic process
1. PB GO:0033256 I-kappaB/NF-kappaB complex
1. PB GO:0032991 protein-containing complex
1. PB GO:0032495 response to muramyl dipeptide
1. PB GO:0005829 cytosol
1. PB GO:0070431 nucleotide-binding oligomerization domain containing 2 signaling pathway
1. PB GO:0002268 follicular dendritic cell differentiation
1. PB GO:0031436 BRCA1-BARD1 complex
1. PB GO:0035556 intracellular signal transduction
1. PB GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process
1. PB GO:0045944 positive regulation of transcription by RNA polymerase II
1. PB GO:0071407 cellular response to organic cyclic compound
1. PB GO:0030307 positive regulation of cell growth
1. PB GO:0045893 positive regulation of transcription, DNA-templated
1. PB GO:0019730 antimicrobial humoral response
1. PB GO:0032270 positive regulation of cellular protein metabolic process
1. PB GO:0032088 negative regulation of NF-kappaB transcription factor activity
1. PB GO:0030674 protein-macromolecule adaptor activity
2. P GO:0030198 extracellular matrix organization
2. P GO:0016593 Cdc73/Paf1 complex
2. P GO:0008134 transcription factor binding
2. P GO:0042771 intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
2. P GO:0032717 negative regulation of interleukin-8 production
2. P GO:0031398 positive regulation of protein ubiquitination
2. P GO:0045111 intermediate filament cytoskeleton
2. P GO:0032311 angiogenin-PRI complex
2. P GO:0032720 negative regulation of tumor necrosis factor production
2. P GO:0006368 transcription elongation from RNA polymerase II promoter
2. P GO:0035327
2. P GO:0031532 actin cytoskeleton reorganization
2. P GO:0080182 histone H3-K4 trimethylation
2. P GO:0045765 regulation of angiogenesis
2. P GO:2001162 positive regulation of histone H3-K79 methylation
2. P GO:0032733 positive regulation of interleukin-10 production
2. P GO:0000502 proteasome complex
2. P GO:0050852 T cell receptor signaling pathway
2. P GO:0033085 negative regulation of T cell differentiation in thymus
2. P GO:0008428 ribonuclease inhibitor activity
2. P GO:0032729 positive regulation of interferon-gamma production
2. P GO:0006606 protein import into nucleus
2. P GO:0055087 Ski complex
2. P GO:0042942 D-serine transport
2. P GO:0030330 DNA damage response, signal transduction by p53 class mediator
2. P GO:0042330 taxis
2. P GO:0070245 positive regulation of thymocyte apoptotic process
2. P GO:0009615 response to virus
2. P GO:0042832 defense response to protozoan
2. P GO:0042127 regulation of cell population proliferation
2. P GO:1904855 proteasome regulatory particle binding
2. P GO:0051571 positive regulation of histone H3-K4 methylation
2. P GO:0140297 DNA-binding transcription factor binding
2. P GO:0039644 suppression by virus of host NF-kappaB cascade
2. P GO:0046426 negative regulation of receptor signaling pathway via JAK-STAT
2. P GO:0048145 regulation of fibroblast proliferation
2. P GO:0002523 leukocyte migration involved in inflammatory response
3. B GO:0005770 late endosome
3. B GO:2000781 positive regulation of double-strand break repair
3. B GO:0008277 regulation of G protein-coupled receptor signaling pathway
3. B GO:0034765 regulation of ion transmembrane transport
3. B GO:0071625 vocalization behavior
3. B GO:0000122 negative regulation of transcription by RNA polymerase II
3. B GO:0035986 obsolete senescence-associated heterochromatin focus assembly
3. B GO:0048337 positive regulation of mesodermal cell fate specification
3. B GO:0090037 positive regulation of protein kinase C signaling
3. B GO:0051835 positive regulation of synapse structural plasticity
3. B GO:0048709 oligodendrocyte differentiation
3. B GO:0006511 ubiquitin-dependent protein catabolic process
3. B GO:0043011 myeloid dendritic cell differentiation
3. B GO:0035148 tube formation
3. B GO:0032456 endocytic recycling
3. B GO:0007205 protein kinase C-activating G protein-coupled receptor signaling pathway
3. B GO:0007507 heart development
3. B GO:0000079 regulation of cyclin-dependent protein serine/threonine kinase activity
3. B GO:0005095 GTPase inhibitor activity
3. B GO:0001701 in utero embryonic development
3. B GO:0072104 glomerular capillary formation
3. B GO:1903779 regulation of cardiac conduction
3. B GO:0070563 negative regulation of vitamin D receptor signaling pathway
3. B GO:0030334 regulation of cell migration
3. B GO:0032421 stereocilium bundle
3. B GO:0003270 Notch signaling pathway involved in regulation of secondary heart field cardioblast proliferation
3. B GO:0010812 negative regulation of cell-substrate adhesion
3. B GO:2001259 positive regulation of cation channel activity
3. B GO:0051247 positive regulation of protein metabolic process
3. B GO:0021514 ventral spinal cord interneuron differentiation
3. B GO:1903522 regulation of blood circulation
3. B GO:0070372 regulation of ERK1 and ERK2 cascade
3. B GO:0014044 Schwann cell development
3. B GO:0006306 DNA methylation
3. B GO:0097190 apoptotic signaling pathway
3. B GO:0106310 protein serine kinase activity
3. B GO:0019903 protein phosphatase binding
3. B GO:0106015 negative regulation of inflammatory response to wounding
3. B GO:0003252 negative regulation of cell proliferation involved in heart valve morphogenesis
3. B GO:0006959 humoral immune response
3. B GO:0004842 ubiquitin-protein transferase activity
3. B GO:0047499 calcium-independent phospholipase A2 activity
3. B GO:0043403 skeletal muscle tissue regeneration
3. B GO:0007140 male meiotic nuclear division
3. B GO:0001837 epithelial to mesenchymal transition
3. B GO:0051494 negative regulation of cytoskeleton organization
3. B GO:0048259 regulation of receptor-mediated endocytosis
3. B GO:0045070 positive regulation of viral genome replication
3. B GO:0003950 NAD+ ADP-ribosyltransferase activity
3. B GO:0035264 multicellular organism growth
3. B GO:0021519 spinal cord association neuron specification
3. B GO:0050885 neuromuscular process controlling balance
3. B GO:0015095 magnesium ion transmembrane transporter activity
3. B GO:0001726 ruffle
3. B GO:0045611 negative regulation of hemocyte differentiation
3. B GO:0051489 regulation of filopodium assembly
3. B GO:0035622 intrahepatic bile duct development
3. B GO:2000822 regulation of behavioral fear response
3. B GO:0045036 protein targeting to chloroplast
3. B GO:0016571 histone methylation
3. B GO:0043254 regulation of protein-containing complex assembly
3. B GO:0045786 negative regulation of cell cycle
3. B GO:0010765 positive regulation of sodium ion transport
3. B GO:0035304 regulation of protein dephosphorylation
3. B GO:0070588 calcium ion transmembrane transport
3. B GO:0071546 pi-body
3. B GO:0010557 positive regulation of macromolecule biosynthetic process
3. B GO:1902367 negative regulation of Notch signaling pathway involved in somitogenesis
3. B GO:0003162 atrioventricular node development
3. B GO:0035690
3. B GO:0007283 spermatogenesis
3. B GO:0007492 endoderm development
3. B GO:0033600 negative regulation of mammary gland epithelial cell proliferation
3. B GO:0048549 positive regulation of pinocytosis
3. B GO:0010956 negative regulation of calcidiol 1-monooxygenase activity
3. B GO:0030534 adult behavior
3. B GO:0086015 SA node cell action potential
3. B GO:0032466 negative regulation of cytokinesis
3. B GO:1990404 protein ADP-ribosylase activity
3. B GO:0005903 brush border
3. B GO:0097107 postsynaptic density assembly
3. B GO:0061073 ciliary body morphogenesis
3. B GO:0051092 positive regulation of NF-kappaB transcription factor activity
3. B GO:0036464 cytoplasmic ribonucleoprotein granule
3. B GO:1902807 negative regulation of cell cycle G1/S phase transition
3. B GO:0003151 outflow tract morphogenesis
3. B GO:0007520 myoblast fusion
3. B GO:0006913 nucleocytoplasmic transport
3. B GO:0072014 proximal tubule development
3. B GO:0002437 inflammatory response to antigenic stimulus
3. B GO:0002039 p53 binding
3. B GO:0002052 positive regulation of neuroblast proliferation
3. B GO:0080173 male-female gamete recognition during double fertilization forming a zygote and endosperm
3. B GO:0071354 cellular response to interleukin-6
3. B GO:0042734 presynaptic membrane
3. B GO:1902309 negative regulation of peptidyl-serine dephosphorylation
3. B GO:0070417 cellular response to cold
3. B GO:0031462 Cul2-RING ubiquitin ligase complex
3. B GO:0048715 negative regulation of oligodendrocyte differentiation
3. B GO:0090398 cellular senescence
3. B GO:0005123 death receptor binding
3. B GO:0032426 stereocilium tip
3. B GO:0008608 attachment of spindle microtubules to kinetochore
3. B GO:1900273 positive regulation of long-term synaptic potentiation
3. B GO:0001886 endothelial cell morphogenesis
3. B GO:0043008 ATP-dependent protein binding
3. B GO:1900119 positive regulation of execution phase of apoptosis
3. B GO:0003160 endocardium morphogenesis
3. B GO:0043086 negative regulation of catalytic activity
3. B GO:0022011 myelination in peripheral nervous system
3. B GO:0033601 positive regulation of mammary gland epithelial cell proliferation
3. B GO:0010313 phytochrome binding
3. B GO:0050894 determination of affect
3. B GO:0001709 cell fate determination
3. B GO:0099562 maintenance of postsynaptic density structure
3. B GO:0000209 protein polyubiquitination
3. B GO:0001947 heart looping
3. B GO:0035985 senescence-associated heterochromatin focus
3. B GO:0016197 endosomal transport
3. B GO:0002027 regulation of heart rate
3. B GO:0097546 ciliary base
3. B GO:2000178 negative regulation of neural precursor cell proliferation
3. B GO:1904970 brush border assembly
3. B GO:0044325 transmembrane transporter binding
3. B GO:0008593 regulation of Notch signaling pathway
3. B GO:0098891 extrinsic component of presynaptic active zone membrane
3. B GO:0072574 hepatocyte proliferation
3. B GO:1990760 osmolarity-sensing cation channel activity
3. B GO:0010629 negative regulation of gene expression
3. B GO:0019888 protein phosphatase regulator activity
3. B GO:0046875 ephrin receptor binding
3. B GO:0001953 negative regulation of cell-matrix adhesion
3. B GO:0001763 morphogenesis of a branching structure
3. B GO:0030660 Golgi-associated vesicle membrane
3. B GO:0002789 negative regulation of antifungal peptide production
3. B GO:0072044 collecting duct development
3. B GO:0046826 negative regulation of protein export from nucleus
3. B GO:1900246 positive regulation of RIG-I signaling pathway
3. B GO:1904901 positive regulation of myosin II filament organization
3. B GO:0070528 protein kinase C signaling
3. B GO:0097129 cyclin D2-CDK4 complex
3. B GO:0060999 positive regulation of dendritic spine development
3. B GO:0005516 calmodulin binding
3. B GO:0045603 positive regulation of endothelial cell differentiation
3. B GO:0035774 positive regulation of insulin secretion involved in cellular response to glucose stimulus
3. B GO:0051289 protein homotetramerization
3. B GO:0097604 temperature-gated cation channel activity
3. B GO:0070213 protein auto-ADP-ribosylation
3. B GO:0004672 protein kinase activity
3. B GO:0046427 positive regulation of receptor signaling pathway via JAK-STAT
3. B GO:0055016 hypochord development
3. B GO:0031877 somatostatin receptor binding
3. B GO:0048812 neuron projection morphogenesis
3. B GO:0005769 early endosome
3. B GO:0033292 T-tubule organization
3. B GO:0006967 positive regulation of antifungal peptide biosynthetic process
3. B GO:0002043 blood vessel endothelial cell proliferation involved in sprouting angiogenesis
3. B GO:0045665 negative regulation of neuron differentiation
3. B GO:0045950 negative regulation of mitotic recombination
3. B GO:0071372 cellular response to follicle-stimulating hormone stimulus
3. B GO:0006816 calcium ion transport
3. B GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
3. B GO:1904108 protein localization to ciliary inversin compartment
3. B GO:0042405 nuclear inclusion body
3. B GO:0009950 dorsal/ventral axis specification
3. B GO:0005525 GTP binding
3. B GO:1900245 positive regulation of MDA-5 signaling pathway
3. B GO:0044305 calyx of Held
3. B GO:0045747 positive regulation of Notch signaling pathway
3. B GO:0035898 parathyroid hormone secretion
3. B GO:0097114 NMDA glutamate receptor clustering
3. B GO:0046475 glycerophospholipid catabolic process
3. B GO:0106311
3. B GO:0014832 urinary bladder smooth muscle contraction
3. B GO:0071889 14-3-3 protein binding
3. B GO:0009644 response to high light intensity
3. B GO:1990166 protein localization to site of double-strand break
3. B GO:0040028 regulation of vulval development
3. B GO:0090521 glomerular visceral epithelial cell migration
3. B GO:0050768 negative regulation of neurogenesis
3. B GO:0099092 postsynaptic density, intracellular component
3. B GO:0005249 voltage-gated potassium channel activity
3. B GO:0045211 postsynaptic membrane
3. B GO:0010838 positive regulation of keratinocyte proliferation
3. B GO:0046834 lipid phosphorylation
3. B GO:0014070 response to organic cyclic compound
3. B GO:0090083 regulation of inclusion body assembly
3. B GO:0010976 positive regulation of neuron projection development
3. B GO:0030017 sarcomere
3. B GO:0045581 negative regulation of T cell differentiation
3. B GO:0043491 protein kinase B signaling
3. B GO:0005902 microvillus
3. B GO:0016055 Wnt signaling pathway
3. B GO:0051967 negative regulation of synaptic transmission, glutamatergic
3. B GO:0061195 taste bud formation
3. B GO:0018345 protein palmitoylation
3. B GO:1904106 protein localization to microvillus
3. B GO:0032288 myelin assembly
3. B GO:0021515 cell differentiation in spinal cord
3. B GO:0060058 positive regulation of apoptotic process involved in mammary gland involution
3. B GO:1900127 positive regulation of hyaluronan biosynthetic process
3. B GO:0002011 morphogenesis of an epithelial sheet
3. B GO:0006537 glutamate biosynthetic process
3. B GO:0071212 subsynaptic reticulum
3. B GO:0014807 regulation of somitogenesis
3. B GO:0031670 cellular response to nutrient
3. B GO:0090090 negative regulation of canonical Wnt signaling pathway
3. B GO:0030279 negative regulation of ossification
3. B GO:0048663 neuron fate commitment
3. B GO:0030016 myofibril
3. B GO:0006584 catecholamine metabolic process
3. B GO:0060743 epithelial cell maturation involved in prostate gland development
3. B GO:0003182 coronary sinus valve morphogenesis
3. B GO:1902339 positive regulation of apoptotic process involved in morphogenesis
3. B GO:2000646 positive regulation of receptor catabolic process
3. B GO:0044605 phosphocholine transferase activity
3. B GO:0006929 substrate-dependent cell migration
3. B GO:0030424 axon
3. B GO:0007409 axonogenesis
3. B GO:0051146 striated muscle cell differentiation
3. B GO:0045171 intercellular bridge
3. B GO:0035255 ionotropic glutamate receptor binding
3. B GO:0043069 negative regulation of programmed cell death
3. B GO:1902260 negative regulation of delayed rectifier potassium channel activity
3. B GO:0031013 troponin I binding
3. B GO:0031430 M band
3. B GO:0043046 DNA methylation involved in gamete generation
3. B GO:0070198 protein localization to chromosome, telomeric region
3. B GO:0090238 positive regulation of arachidonic acid secretion
3. B GO:0045751 negative regulation of Toll signaling pathway
3. B GO:0072576 liver morphogenesis
3. B GO:0007030 Golgi organization
3. B GO:0045838 positive regulation of membrane potential
3. B GO:0005929 cilium
3. B GO:1902263 apoptotic process involved in embryonic digit morphogenesis
3. B GO:0003344 pericardium morphogenesis
3. B GO:0006543 glutamine catabolic process
3. B GO:0044030 regulation of DNA methylation
3. B GO:0060076 excitatory synapse
3. B GO:0070742 C2H2 zinc finger domain binding
3. B GO:0140627 ubiquitin-dependent protein catabolic process via the C-end degron rule pathway
3. B GO:0003208 cardiac ventricle morphogenesis
3. B GO:0003214 cardiac left ventricle morphogenesis
3. B GO:0072332 intrinsic apoptotic signaling pathway by p53 class mediator
3. B GO:2000812 regulation of barbed-end actin filament capping
3. B GO:0010424 DNA methylation on cytosine within a CG sequence
3. B GO:0007613 memory
3. B GO:0014731 spectrin-associated cytoskeleton
3. B GO:0044309 neuron spine
3. B GO:0005737 cytoplasm
3. B GO:0098978 glutamatergic synapse
3. B GO:2000001 regulation of DNA damage checkpoint
3. B GO:0071560 cellular response to transforming growth factor beta stimulus
3. B GO:0061630 ubiquitin protein ligase activity
3. B GO:0070534 protein K63-linked ubiquitination
3. B GO:0010882 regulation of cardiac muscle contraction by calcium ion signaling
3. B GO:0043005 neuron projection
3. B GO:0098871 postsynaptic actin cytoskeleton
3. B GO:0097435 supramolecular fiber organization
3. B GO:1904385 cellular response to angiotensin
3. B GO:0046331 lateral inhibition
3. B GO:0014704 intercalated disc
3. B GO:0097113 AMPA glutamate receptor clustering
3. B GO:0042995 cell projection
3. B GO:0030308 negative regulation of cell growth
3. B GO:0019901 protein kinase binding
3. B GO:0046959 habituation
3. B GO:0001955 blood vessel maturation
3. B GO:0009507 chloroplast
3. B GO:0032013 negative regulation of ARF protein signal transduction
3. B GO:0099519 dense core granule cytoskeletal transport
3. B GO:0030907 MBF transcription complex
3. B GO:0007219 Notch signaling pathway
3. B GO:0038023 signaling receptor activity
3. B GO:0060354 negative regulation of cell adhesion molecule production
3. B GO:0031441 negative regulation of mRNA 3'-end processing
3. B GO:0032232 negative regulation of actin filament bundle assembly
3. B GO:0034638 phosphatidylcholine catabolic process
3. B GO:0003332 negative regulation of extracellular matrix constituent secretion
3. B GO:0033280 response to vitamin D
3. B GO:0046976 histone methyltransferase activity (H3-K27 specific)
3. B GO:1905274 regulation of modification of postsynaptic actin cytoskeleton
3. B GO:0045794 negative regulation of cell volume
3. B GO:0005856 cytoskeleton
3. B GO:1904717 regulation of AMPA glutamate receptor clustering
3. B GO:0031047 gene silencing by RNA
3. B GO:0042048 olfactory behavior
3. B GO:0071447 cellular response to hydroperoxide
3. B GO:0032580 Golgi cisterna membrane
3. B GO:0000731 DNA synthesis involved in DNA repair
3. B GO:0016529 sarcoplasmic reticulum
3. B GO:0061743 motor learning
3. B GO:0051497 negative regulation of stress fiber assembly
3. B GO:0140374 antiviral innate immune response
3. B GO:0000082 G1/S transition of mitotic cell cycle
3. B GO:0005096 GTPase activator activity
3. B GO:0030034 microvillar actin bundle assembly
3. B GO:1904743 negative regulation of telomeric DNA binding
3. B GO:0071347 cellular response to interleukin-1
3. B GO:1900383 regulation of synaptic plasticity by receptor localization to synapse
3. B GO:0003241 growth involved in heart morphogenesis
3. B GO:0072660 maintenance of protein location in plasma membrane
3. B GO:0015629 actin cytoskeleton
3. B GO:0009967 positive regulation of signal transduction
3. B GO:0071359 cellular response to dsRNA
3. B GO:0060289 compartment boundary maintenance
3. B GO:0031674 I band
3. B GO:2000134 negative regulation of G1/S transition of mitotic cell cycle
3. B GO:0043197 dendritic spine
3. B GO:0005112 Notch binding
3. B GO:0003198 epithelial to mesenchymal transition involved in endocardial cushion formation
3. B GO:0102991 myristoyl-CoA hydrolase activity
3. B GO:1901187 regulation of ephrin receptor signaling pathway
3. B GO:0008285 negative regulation of cell population proliferation
3. B GO:0061028 establishment of endothelial barrier
3. B GO:0001889 liver development
3. B GO:0045197 establishment or maintenance of epithelial cell apical/basal polarity
3. B GO:0043054 dauer exit
3. B GO:0090063 positive regulation of microtubule nucleation
3. B GO:0060674 placenta blood vessel development
3. B GO:0039529 RIG-I signaling pathway
3. B GO:0036309 protein localization to M-band
3. B GO:0001957 intramembranous ossification
3. B GO:0065001 specification of axis polarity
3. B GO:2000059 negative regulation of ubiquitin-dependent protein catabolic process
3. B GO:0060317 cardiac epithelial to mesenchymal transition
3. B GO:0097117 guanylate kinase-associated protein clustering
3. B GO:0086069 bundle of His cell to Purkinje myocyte communication
3. B GO:0060948 cardiac vascular smooth muscle cell development
3. B GO:0098919 structural constituent of postsynaptic density
3. B GO:0034446 substrate adhesion-dependent cell spreading
3. B GO:0002357 defense response to tumor cell
3. B GO:0002070 epithelial cell maturation
3. B GO:0031432 titin binding
3. B GO:0034112 positive regulation of homotypic cell-cell adhesion
3. B GO:0001967 suckling behavior
3. B GO:0022407 regulation of cell-cell adhesion
3. B GO:2000346 negative regulation of hepatocyte proliferation
3. B GO:0060442 branching involved in prostate gland morphogenesis
3. B GO:0006471 protein ADP-ribosylation
3. B GO:0030154 cell differentiation
3. B GO:0060582 cell fate determination involved in pattern specification
3. B GO:0099171 presynaptic modulation of chemical synaptic transmission
3. B GO:0060842 arterial endothelial cell differentiation
3. B GO:0086070 SA node cell to atrial cardiac muscle cell communication
3. B GO:1900452 regulation of long-term synaptic depression
3. B GO:0003229 ventricular cardiac muscle tissue development
3. B GO:0045955 negative regulation of calcium ion-dependent exocytosis
3. B GO:0070972 protein localization to endoplasmic reticulum
3. B GO:2001027 negative regulation of endothelial cell chemotaxis
3. B GO:0043268 positive regulation of potassium ion transport
3. B GO:0016021 integral component of membrane
3. B GO:0031267 small GTPase binding
3. B GO:0060035 notochord cell development
3. B GO:0002193 MAML1-RBP-Jkappa- ICN1 complex
3. B GO:0046579 positive regulation of Ras protein signal transduction
3. B GO:0030513 positive regulation of BMP signaling pathway
3. B GO:2000737 negative regulation of stem cell differentiation
3. B GO:2001279 regulation of unsaturated fatty acid biosynthetic process
3. B GO:0004861 cyclin-dependent protein serine/threonine kinase inhibitor activity
3. B GO:0010001 glial cell differentiation
3. B GO:0045736 negative regulation of cyclin-dependent protein serine/threonine kinase activity
3. B GO:1902531 regulation of intracellular signal transduction
3. B GO:0000062 fatty-acyl-CoA binding
3. B GO:1900827 positive regulation of membrane depolarization during cardiac muscle cell action potential
3. B GO:0031960 response to corticosteroid
3. B GO:0060074 synapse maturation
3. B GO:0003256 regulation of transcription from RNA polymerase II promoter involved in myocardial precursor cell differentiation
3. B GO:1901201 regulation of extracellular matrix assembly
3. B GO:0048892 lateral line nerve development
3. B GO:0008093 cytoskeletal anchor activity
3. B GO:0010667 negative regulation of cardiac muscle cell apoptotic process
3. B GO:0038061 NIK/NF-kappaB signaling
3. B GO:0003170 heart valve development
3. B GO:0005938 cell cortex
3. B GO:0042802 identical protein binding
3. B GO:0048708 astrocyte differentiation
3. B GO:0046486 glycerolipid metabolic process
3. B GO:0001708 cell fate specification
3. B GO:0003222 ventricular trabecula myocardium morphogenesis
3. B GO:0030326 embryonic limb morphogenesis
3. B GO:0060740 prostate gland epithelium morphogenesis
3. B GO:0030837 negative regulation of actin filament polymerization
3. B GO:0071286 cellular response to magnesium ion
3. B GO:0090309 positive regulation of DNA methylation-dependent heterochromatin assembly
3. B GO:0060411 cardiac septum morphogenesis
3. B GO:0097237 cellular response to toxic substance
3. B GO:1905938 positive regulation of germ cell proliferation
3. B GO:0050775 positive regulation of dendrite morphogenesis
3. B GO:0060113 inner ear receptor cell differentiation
3. B GO:0045967 negative regulation of growth rate
3. B GO:0043034 costamere
3. B GO:0099147 extrinsic component of postsynaptic density membrane
3. B GO:0021986 habenula development
3. B GO:0032791 lead ion binding
3. B GO:0007626 locomotory behavior
3. B GO:0031297 replication fork processing
3. B GO:0030046 parallel actin filament bundle assembly
3. B GO:0046843 dorsal appendage formation
3. B GO:0036166 phenotypic switching
3. B GO:0046469 platelet activating factor metabolic process
3. B GO:0007605 sensory perception of sound
3. B GO:0044877 protein-containing complex binding
3. B GO:0070986 left/right axis specification
3. B GO:1990416 cellular response to brain-derived neurotrophic factor stimulus
3. B GO:0005576 extracellular region
3. B GO:0002087 regulation of respiratory gaseous exchange by nervous system process
3. B GO:0019887 protein kinase regulator activity
3. B GO:0046974 histone methyltransferase activity (H3-K9 specific)
3. B GO:0098908 regulation of neuronal action potential
3. B GO:0018024 histone-lysine N-methyltransferase activity
3. B GO:0045814 negative regulation of gene expression, epigenetic
3. B GO:0030018 Z disc
3. B GO:0042805 actinin binding
3. B GO:0098879 structural constituent of postsynaptic specialization
3. B GO:0097431 mitotic spindle pole
3. B GO:0001569 branching involved in blood vessel morphogenesis
3. B GO:0036377 arbuscular mycorrhizal association
3. B GO:0043063 intercellular bridge organization
3. B GO:0061419 positive regulation of transcription from RNA polymerase II promoter in response to hypoxia
3. B GO:0007221 positive regulation of transcription of Notch receptor target
3. B GO:0046473 phosphatidic acid metabolic process
3. B GO:0099612 protein localization to axon
3. B GO:1905456 regulation of lymphoid progenitor cell differentiation
3. B GO:0005524 ATP binding
3. B GO:1902041 regulation of extrinsic apoptotic signaling pathway via death domain receptors
3. B GO:0098703 calcium ion import across plasma membrane
3. B GO:0042686 regulation of cardioblast cell fate specification
3. B GO:0045669 positive regulation of osteoblast differentiation
3. B GO:0046338 phosphatidylethanolamine catabolic process
3. B GO:0071260 cellular response to mechanical stimulus
3. B GO:0090216 positive regulation of 1-phosphatidylinositol-4-phosphate 5-kinase activity
3. B GO:0097422 tubular endosome
3. B GO:0071316 cellular response to nicotine
3. B GO:0018027 peptidyl-lysine dimethylation
3. B GO:0035176 social behavior
3. B GO:0006654 phosphatidic acid biosynthetic process
3. B GO:0010960 magnesium ion homeostasis
3. B GO:0080085 signal recognition particle, chloroplast targeting
3. B GO:2001204 regulation of osteoclast development
3. B GO:0001650 fibrillar center
3. B GO:2000114 regulation of establishment of cell polarity
3. B GO:1990090 cellular response to nerve growth factor stimulus
3. B GO:0140261 BCOR complex
3. B GO:0035418 protein localization to synapse
3. B GO:0005886 plasma membrane
3. B GO:0042325 regulation of phosphorylation
3. B GO:0010614 negative regulation of cardiac muscle hypertrophy
3. B GO:0021675 nerve development
3. B GO:0035646 endosome to melanosome transport
3. B GO:0044232 organelle membrane contact site
3. B GO:0030219 megakaryocyte differentiation
3. B GO:0048899 anterior lateral line development
3. B GO:0033147 negative regulation of intracellular estrogen receptor signaling pathway
3. B GO:0062043 positive regulation of cardiac epithelial to mesenchymal transition
3. B GO:0070208 protein heterotrimerization
3. B GO:0001222 transcription corepressor binding
3. B GO:0045316 negative regulation of compound eye photoreceptor development
3. B GO:0010596 negative regulation of endothelial cell migration
3. B GO:0045607 regulation of inner ear auditory receptor cell differentiation
3. B GO:0043292 contractile fiber
3. B GO:0043517 positive regulation of DNA damage response, signal transduction by p53 class mediator
3. B GO:0019843 rRNA binding
3. B GO:0070212 protein poly-ADP-ribosylation
3. B GO:1900271 regulation of long-term synaptic potentiation
3. B GO:2000300 regulation of synaptic vesicle exocytosis
3. B GO:2000048 negative regulation of cell-cell adhesion mediated by cadherin
3. B GO:1904058 positive regulation of sensory perception of pain
3. B GO:0060979 vasculogenesis involved in coronary vascular morphogenesis
3. B GO:0090399 replicative senescence
3. B GO:0030160 synaptic receptor adaptor activity
3. B GO:2000209 regulation of anoikis
3. B GO:0045662 negative regulation of myoblast differentiation
3. B GO:0072017 distal tubule development
3. B GO:0046339 diacylglycerol metabolic process
3. B GO:0007440 foregut morphogenesis
3. B GO:0048711 positive regulation of astrocyte differentiation
3. B GO:0072073 kidney epithelium development
3. B GO:0045859 regulation of protein kinase activity
3. B GO:0008360 regulation of cell shape
3. B GO:0004622 lysophospholipase activity
3. B GO:0035023 regulation of Rho protein signal transduction
3. B GO:0072357 PTW/PP1 phosphatase complex
3. B GO:0007386 compartment pattern specification
3. B GO:0070316 regulation of G0 to G1 transition
3. B GO:0008022 protein C-terminus binding
3. B GO:0010650 positive regulation of cell communication by electrical coupling
3. B GO:0003181 atrioventricular valve morphogenesis
3. B GO:0090051 negative regulation of cell migration involved in sprouting angiogenesis
3. B GO:1903051 negative regulation of proteolysis involved in cellular protein catabolic process
3. B GO:0021773 striatal medium spiny neuron differentiation
3. B GO:0010638 positive regulation of organelle organization
3. B GO:0060768 regulation of epithelial cell proliferation involved in prostate gland development
3. B GO:0060998 regulation of dendritic spine development
3. B GO:2000811 negative regulation of anoikis
3. B GO:0048102 autophagic cell death
3. B GO:0006897 endocytosis
3. B GO:0045608 negative regulation of inner ear auditory receptor cell differentiation
3. B GO:0055008 cardiac muscle tissue morphogenesis
3. B GO:1901339 regulation of store-operated calcium channel activity
3. B GO:2000630 positive regulation of miRNA metabolic process
3. B GO:0014066 regulation of phosphatidylinositol 3-kinase signaling
3. B GO:0006887 exocytosis
3. B GO:0071314 cellular response to cocaine
3. B GO:0000242 pericentriolar material
3. B GO:2000096 positive regulation of Wnt signaling pathway, planar cell polarity pathway
3. B GO:0003197 endocardial cushion development
3. B GO:0016604 nuclear body
3. B GO:0003723 RNA binding
3. B GO:0098685 Schaffer collateral - CA1 synapse
3. B GO:0042665 regulation of ectodermal cell fate specification
3. B GO:1903589 positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis
3. B GO:0098907 regulation of SA node cell action potential
3. B GO:0003203 endocardial cushion morphogenesis
3. B GO:0008157 protein phosphatase 1 binding
3. B GO:1905667 negative regulation of protein localization to endosome
3. B GO:1905383 protein localization to presynapse
3. B GO:1901981 phosphatidylinositol phosphate binding
3. B GO:1905453 regulation of myeloid progenitor cell differentiation
3. B GO:1900026 positive regulation of substrate adhesion-dependent cell spreading
3. B GO:0035965 cardiolipin acyl-chain remodeling
3. B GO:0003677 DNA binding
3. B GO:0048471 perinuclear region of cytoplasm
3. B GO:0030155 regulation of cell adhesion
3. B GO:0086014 atrial cardiac muscle cell action potential
3. B GO:0016409 palmitoyltransferase activity
3. B GO:0008270 zinc ion binding
3. B GO:0003184 pulmonary valve morphogenesis
3. B GO:0090461 glutamate homeostasis
3. B GO:0030507 spectrin binding
3. B GO:0032695 negative regulation of interleukin-12 production
3. B GO:0003169 coronary vein morphogenesis
3. B GO:1904908 negative regulation of maintenance of mitotic sister chromatid cohesion, telomeric
3. B GO:0060528 secretory columnal luminar epithelial cell differentiation involved in prostate glandular acinus development
3. B GO:0047389 glycerophosphocholine phosphodiesterase activity
3. B GO:0045820 negative regulation of glycolytic process
3. B GO:0010832 negative regulation of myotube differentiation
3. B GO:2000111 positive regulation of macrophage apoptotic process
3. B GO:0071532 ankyrin repeat binding
3. B GO:0070936 protein K48-linked ubiquitination
3. B GO:0070412 R-SMAD binding
3. B GO:0140439 protein-cysteine S-stearoyltransferase activity
3. B GO:0051438 regulation of ubiquitin-protein transferase activity
3. B GO:0045648 positive regulation of erythrocyte differentiation
3. B GO:0031143 pseudopodium
3. B GO:0051017 actin filament bundle assembly
3. B GO:0007368 determination of left/right symmetry
3. B GO:0071244 cellular response to carbon dioxide
3. B GO:0014069 postsynaptic density
3. B GO:0060982 coronary artery morphogenesis
3. B GO:0007616 long-term memory
3. B GO:0045687 positive regulation of glial cell differentiation
3. B GO:0051726 regulation of cell cycle
3. B GO:0014912 negative regulation of smooth muscle cell migration
3. B GO:1903829 positive regulation of protein localization
3. B GO:0031359 integral component of chloroplast outer membrane
3. B GO:0010780 meiotic DNA double-strand break formation involved in reciprocal meiotic recombination
3. B GO:0031867 EP4 subtype prostaglandin E2 receptor binding
3. B GO:1904107 protein localization to microvillus membrane
3. B GO:0015248 sterol transporter activity
3. B GO:0048103 somatic stem cell division
3. B GO:1902412 regulation of mitotic cytokinesis
3. B GO:0043266 regulation of potassium ion transport
3. B GO:0050955 thermoception
3. B GO:0060843 venous endothelial cell differentiation
3. B GO:2000774 positive regulation of cellular senescence
3. B GO:0001838 embryonic epithelial tube formation
3. B GO:2000651 positive regulation of sodium ion transmembrane transporter activity
3. B GO:0006528 asparagine metabolic process
3. B GO:0061399 positive regulation of transcription from RNA polymerase II promoter in response to cobalt ion
3. B GO:0140031 phosphorylation-dependent protein binding
3. B GO:0051306 mitotic sister chromatid separation
3. B GO:0050957 equilibrioception
3. B GO:0003207 cardiac chamber formation
3. B GO:0061384 heart trabecula morphogenesis
3. B GO:0048060 negative gravitaxis
3. B GO:0072015 glomerular visceral epithelial cell development
3. B GO:2000304 positive regulation of ceramide biosynthetic process
3. B GO:0070171 negative regulation of tooth mineralization
3. B GO:0035014 phosphatidylinositol 3-kinase regulator activity
3. B GO:0019208 phosphatase regulator activity
3. B GO:0030315 T-tubule
3. B GO:0050860 negative regulation of T cell receptor signaling pathway
3. B GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
3. B GO:0043280 positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
3. B GO:1905936 regulation of germ cell proliferation
3. B GO:0003209 cardiac atrium morphogenesis
3. B GO:0090263 positive regulation of canonical Wnt signaling pathway
3. B GO:0048052 R1/R6 cell differentiation
3. B GO:1903670 regulation of sprouting angiogenesis
3. B GO:0021531 spinal cord radial glial cell differentiation
3. B GO:0032091 negative regulation of protein binding
3. B GO:0002091 negative regulation of receptor internalization
3. B GO:0010761 fibroblast migration
3. B GO:0005262 calcium channel activity
3. B GO:2000969 positive regulation of AMPA receptor activity
3. B GO:0017020 myosin phosphatase regulator activity
3. B GO:0008290 F-actin capping protein complex
3. B GO:0102545 phosphatidyl phospholipase B activity
3. B GO:0097062 dendritic spine maintenance
3. B GO:0031901 early endosome membrane
3. B GO:0031672 A band
3. B GO:0003213 cardiac right atrium morphogenesis
3. B GO:0045602 negative regulation of endothelial cell differentiation
3. B GO:0045869 negative regulation of single stranded viral RNA replication via double stranded DNA intermediate
3. B GO:0050793 regulation of developmental process
3. B GO:0098910 regulation of atrial cardiac muscle cell action potential
3. B GO:0043194 axon initial segment
3. B GO:0009912 auditory receptor cell fate commitment
3. B GO:0030941 chloroplast targeting sequence binding
3. B GO:0046849 bone remodeling
3. B GO:0033309 SBF transcription complex
3. B GO:2000249 regulation of actin cytoskeleton reorganization
3. B GO:0048265 response to pain
3. B GO:0016279 protein-lysine N-methyltransferase activity
3. B GO:0007165 signal transduction
3. B GO:1904355 positive regulation of telomere capping
3. B GO:0001895 retina homeostasis
3. B GO:0030511 positive regulation of transforming growth factor beta receptor signaling pathway
3. B GO:0031466 Cul5-RING ubiquitin ligase complex
3. B GO:1901223 negative regulation of NIK/NF-kappaB signaling
3. B GO:0097543 ciliary inversin compartment
3. B GO:0017124 SH3 domain binding
3. B GO:0003847 1-alkyl-2-acetylglycerophosphocholine esterase activity
3. B GO:0046822 regulation of nucleocytoplasmic transport
3. B GO:0048170 positive regulation of long-term neuronal synaptic plasticity
3. B GO:0003219 cardiac right ventricle formation
3. B GO:0043235 receptor complex
3. B GO:0001658 branching involved in ureteric bud morphogenesis
3. B GO:0017171 serine hydrolase activity
3. B GO:0072144 glomerular mesangial cell development
3. B GO:0034393 positive regulation of smooth muscle cell apoptotic process
3. B GO:0060956 endocardial cell differentiation
3. B GO:1904632 cellular response to glucoside
3. B GO:1902230 negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage
3. B GO:0042383 sarcolemma
3. B GO:0140036 ubiquitin-dependent protein binding
3. B GO:0071322 cellular response to carbohydrate stimulus
3. B GO:1901189 positive regulation of ephrin receptor signaling pathway
3. B GO:0050931 pigment cell differentiation
3. B GO:0060038 cardiac muscle cell proliferation
3. B GO:0030029 actin filament-based process
3. B GO:0032212 positive regulation of telomere maintenance via telomerase
3. B GO:0042297 vocal learning
3. B GO:0002040 sprouting angiogenesis
3. B GO:0007569 cell aging
3. B GO:0061001 regulation of dendritic spine morphogenesis
3. B GO:0060236 regulation of mitotic spindle organization
3. B GO:2000279 negative regulation of DNA biosynthetic process
3. B GO:0045596 negative regulation of cell differentiation
3. B GO:0051966 regulation of synaptic transmission, glutamatergic
3. B GO:0061025 membrane fusion
3. B GO:0051386 regulation of neurotrophin TRK receptor signaling pathway
3. B GO:0097110 scaffold protein binding
3. B GO:1990393 3M complex
3. B GO:0034184 positive regulation of maintenance of mitotic sister chromatid cohesion
3. B GO:0060803 BMP signaling pathway involved in mesodermal cell fate specification
3. B GO:0045618 positive regulation of keratinocyte differentiation
3. B GO:0003180 aortic valve morphogenesis
3. B GO:1990705 cholangiocyte proliferation
3. B GO:0060013 righting reflex
3. B GO:0007411 axon guidance
3. B GO:0050968 detection of chemical stimulus involved in sensory perception of pain
3. B GO:0042246 tissue regeneration
3. B GO:0003157 endocardium development
3. B GO:0007229 integrin-mediated signaling pathway
3. B GO:1900451 positive regulation of glutamate receptor signaling pathway
3. B GO:1903343 positive regulation of meiotic DNA double-strand break formation
3. B GO:0090029 negative regulation of pheromone-dependent signal transduction involved in conjugation with cellular fusion
3. B GO:0046533 negative regulation of photoreceptor cell differentiation
3. B GO:0097150 neuronal stem cell population maintenance
3. B GO:0048013 ephrin receptor signaling pathway
3. B GO:1901019 regulation of calcium ion transmembrane transporter activity
3. B GO:0004067 asparaginase activity
3. B GO:1903849 positive regulation of aorta morphogenesis
3. B GO:0045162 clustering of voltage-gated sodium channels
3. B GO:0042633 hair cycle
3. B GO:0060413 atrial septum morphogenesis
3. B GO:0051865 protein autoubiquitination
3. B GO:0050728 negative regulation of inflammatory response
3. B GO:0003192 mitral valve formation
3. B GO:0043065 positive regulation of apoptotic process
3. B GO:0030027 lamellipodium
3. B GO:0000415 negative regulation of histone H3-K36 methylation
3. B GO:0033268 node of Ranvier
3. B GO:0048665 neuron fate specification
3. B GO:1904630 cellular response to diterpene
3. B GO:0003264 regulation of cardioblast proliferation
3. B GO:0019705 protein-cysteine S-myristoyltransferase activity
3. B GO:0010613 positive regulation of cardiac muscle hypertrophy
3. B GO:0043596 nuclear replication fork
3. B GO:0050807 regulation of synapse organization
3. B GO:0061314 Notch signaling involved in heart development
3. B GO:0008361 regulation of cell size
3. B GO:0071709 membrane assembly
3. B GO:0015278 calcium-release channel activity
3. B GO:1990756 ubiquitin ligase-substrate adaptor activity
3. B GO:0060992 response to fungicide
3. B GO:2000463 positive regulation of excitatory postsynaptic potential
3. B GO:0016290 palmitoyl-CoA hydrolase activity
3. B GO:1902647 negative regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate biosynthetic process
3. B GO:0099173 postsynapse organization
3. B GO:0051570 regulation of histone H3-K9 methylation
3. B GO:0034587 piRNA metabolic process
3. B GO:0004857 enzyme inhibitor activity
3. B GO:2000974 negative regulation of pro-B cell differentiation
3. B GO:0060997 dendritic spine morphogenesis
3. B GO:0048845 venous blood vessel morphogenesis
3. B GO:1901018 positive regulation of potassium ion transmembrane transporter activity
3. B GO:0004143 diacylglycerol kinase activity
3. B GO:0050714 positive regulation of protein secretion
3. B GO:0060135 maternal process involved in female pregnancy
3. B GO:2000311 regulation of AMPA receptor activity
3. B GO:0043055 maintenance of dauer
3. B GO:0086066 atrial cardiac muscle cell to AV node cell communication
3. B GO:1901021 positive regulation of calcium ion transmembrane transporter activity
3. B GO:1901224 positive regulation of NIK/NF-kappaB signaling
3. B GO:0060253 negative regulation of glial cell proliferation
3. B GO:0005925 focal adhesion
3. B GO:0050966 detection of mechanical stimulus involved in sensory perception of pain
3. B GO:0006621 protein retention in ER lumen
3. B GO:0021707 cerebellar granule cell differentiation
3. B GO:0014031 mesenchymal cell development
3. B GO:0051151 negative regulation of smooth muscle cell differentiation
3. B GO:0046872 metal ion binding
3. B GO:0001771 immunological synapse formation
3. B GO:0035544 negative regulation of SNARE complex assembly
3. B GO:0035508 positive regulation of myosin-light-chain-phosphatase activity
3. B GO:0097553 calcium ion transmembrane import into cytosol
3. B GO:0048871 multicellular organismal homeostasis
3. B GO:0031668 cellular response to extracellular stimulus
3. B GO:2000821 regulation of grooming behavior
3. B GO:0000139 Golgi membrane
3. B GO:0060708 spongiotrophoblast differentiation
3. B GO:0042326 negative regulation of phosphorylation
3. B GO:0019706 protein-cysteine S-palmitoyltransferase activity
3. B GO:0003273 cell migration involved in endocardial cushion formation
3. B GO:0051572 negative regulation of histone H3-K4 methylation
3. B GO:0030900 forebrain development
3. B GO:1903793 positive regulation of anion transport
3. B GO:0070168 negative regulation of biomineral tissue development
3. B GO:0044354 macropinosome
3. B GO:0035507 regulation of myosin-light-chain-phosphatase activity
3. B GO:1904357 negative regulation of telomere maintenance via telomere lengthening
3. B GO:0031076 embryonic camera-type eye development

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q9H560 Putative ankyrin repeat domain-containing protein 19 1.30e-14 1.31e-07 1.96e-12
1. PB A6NGH8 Ankyrin repeat domain-containing protein 61 8.91e-09 3.57e-04 1.41e-13
1. PB Q8N9B4 Ankyrin repeat domain-containing protein 42 1.12e-12 5.21e-08 5.72e-20
1. PB Q9D504 Ankyrin repeat domain-containing protein 7 1.75e-12 3.66e-06 2.47e-15
1. PB Q15653 NF-kappa-B inhibitor beta 3.99e-07 4.64e-07 7.50e-06
1. PB Q4R3S3 Ankyrin repeat domain-containing protein 7 1.11e-12 1.80e-06 6.38e-16
1. PB P20640 Ankyrin repeat protein M1 NA 7.76e-03 1.46e-04
1. PB Q9D738 Ankyrin repeat and SOCS box protein 12 2.51e-07 4.11e-04 1.43e-08
1. PB Q5UPD9 Putative ankyrin repeat protein L66 NA 3.73e-04 2.73e-04
1. PB A6NK59 Ankyrin repeat and SOCS box protein 14 2.65e-12 3.35e-02 3.90e-19
1. PB Q9Z1E3 NF-kappa-B inhibitor alpha 1.45e-09 2.17e-06 6.73e-08
1. PB Q92527 Ankyrin repeat domain-containing protein 7 5.81e-09 1.60e-04 5.39e-13
1. PB Q5U2S6 Ankyrin repeat and SOCS box protein 2 2.25e-11 8.16e-03 4.54e-22
1. PB Q9HLN1 Putative ankyrin repeat protein Ta0196 1.88e-11 6.41e-03 2.83e-09
1. PB Q91974 NF-kappa-B inhibitor alpha 9.93e-08 8.15e-05 9.61e-08
1. PB Q17QS6 Ankyrin repeat and SOCS box protein 5 5.96e-09 1.31e-06 9.42e-11
1. PB P25963 NF-kappa-B inhibitor alpha 1.71e-07 2.45e-08 3.03e-08
1. PB P0C927 Ankyrin repeat and SOCS box protein 14 0.00e+00 9.33e-05 5.26e-19
1. PB Q502M6 Ankyrin repeat domain-containing protein 29 3.05e-13 4.11e-08 1.46e-18
1. PB P14356 Ankyrin repeat protein M1 NA 2.30e-03 1.59e-04
1. PB Q9CQ31 Ankyrin repeat and SOCS box protein 11 3.63e-08 3.03e-04 4.24e-14
1. PB Q08353 NF-kappa-B inhibitor alpha 1.31e-09 1.17e-07 4.75e-07
1. PB Q8K0L0 Ankyrin repeat and SOCS box protein 2 4.66e-11 2.82e-02 2.64e-21
1. PB Q499M5 Ankyrin repeat domain-containing protein 16 0.00e+00 4.33e-12 5.83e-16
1. PB Q862Z2 Ankyrin repeat and SOCS box protein 5 1.21e-08 7.39e-07 6.17e-10
1. PB Q9D2X0 Ankyrin repeat domain-containing protein 39 5.38e-13 3.58e-02 1.95e-13
1. PB Q9Z2F6 B-cell lymphoma 3 protein homolog 3.60e-09 1.01e-03 1.02e-09
1. PB Q53RE8 Ankyrin repeat domain-containing protein 39 1.33e-15 1.99e-02 2.26e-13
1. PB Q8WXK4 Ankyrin repeat and SOCS box protein 12 3.40e-06 1.85e-04 2.10e-09
1. PB A2AS55 Ankyrin repeat domain-containing protein 16 0.00e+00 1.60e-11 4.89e-19
1. PB Q8WWX0 Ankyrin repeat and SOCS box protein 5 1.23e-08 1.50e-05 9.47e-10
1. PB Q9J4Z8 Putative ankyrin repeat protein FPV242 NA 4.33e-02 1.17e-08
1. PB Q54HW1 26S proteasome non-ATPase regulatory subunit 10 1.44e-13 3.47e-07 1.35e-20
1. PB Q9J5H8 Putative ankyrin repeat protein FPV023 NA 3.89e-06 6.89e-08
1. PB Q8WXH4 Ankyrin repeat and SOCS box protein 11 3.09e-08 8.24e-05 7.44e-13
1. PB Q5UQ06 Putative ankyrin repeat protein R789 NA 1.78e-04 2.61e-07
1. PB Q8ZWC4 Putative ankyrin repeat protein PAE1861 0.00e+00 2.15e-04 8.10e-28
1. PB Q06527 Ankyrin homolog 0.00e+00 9.79e-10 1.50e-28
1. PB A6QPE7 Ankyrin repeat domain-containing protein 65 0.00e+00 4.13e-44 4.64e-169
1. PB Q6P6B7 Ankyrin repeat domain-containing protein 16 0.00e+00 2.45e-17 4.44e-22
1. PB P50086 Probable 26S proteasome regulatory subunit p28 7.99e-15 1.24e-03 2.84e-11
1. PB O54910 NF-kappa-B inhibitor epsilon 2.91e-08 2.60e-06 1.01e-08
1. PB Q641X1 Ankyrin repeat domain-containing protein 61 2.82e-10 1.32e-03 3.72e-13
1. PB Q9JIA3 NF-kappa-B inhibitor beta 5.02e-07 3.14e-09 7.11e-05
1. PB Q2T9W8 Ankyrin repeat domain-containing protein 61 2.03e-09 4.20e-04 4.95e-13
1. PB Q2TB02 NF-kappa-B inhibitor delta 1.58e-08 1.27e-08 5.39e-08
1. PB Q8VHA6 Ankyrin repeat and SOCS box protein 18 5.34e-09 4.86e-02 9.09e-11
1. PB Q60778 NF-kappa-B inhibitor beta 3.54e-07 2.42e-06 1.28e-06
1. PB Q9Z2X3 26S proteasome non-ATPase regulatory subunit 10 5.55e-16 3.62e-05 1.49e-24
1. PB Q9D1A4 Ankyrin repeat and SOCS box protein 5 1.91e-09 1.22e-06 2.60e-09
1. PB Q5UPR3 Putative ankyrin repeat protein R777 NA 2.69e-03 7.26e-09
1. PB Q5RCK5 Ankyrin repeat and SOCS box protein 7 1.72e-12 1.15e-02 2.08e-18
1. PB Q9Z2X2 26S proteasome non-ATPase regulatory subunit 10 5.55e-16 1.29e-04 2.34e-24
1. PB P20749 B-cell lymphoma 3 protein 1.98e-07 3.38e-05 4.00e-10
1. PB Q8N6D5 Ankyrin repeat domain-containing protein 29 0.00e+00 1.53e-09 1.31e-20
1. PB Q63746 NF-kappa-B inhibitor alpha 1.27e-07 1.38e-05 1.04e-07
1. PB Q978J0 Putative ankyrin repeat protein TV1425 6.72e-14 2.98e-02 1.11e-12
1. PB Q3SZE4 Ankyrin repeat and SOCS box protein 11 2.23e-08 4.47e-07 1.02e-11
1. PB Q6ZVZ8 Ankyrin repeat and SOCS box protein 18 1.16e-09 3.90e-02 4.45e-14
1. PB Q5RFS1 Ankyrin repeat and SOCS box protein 11 2.44e-08 3.94e-04 9.92e-13
1. PB E5RJM6 Ankyrin repeat domain-containing protein 65 0 6.42e-153 0.0
1. PB P33825 Ankyrin repeat protein M1 NA 2.48e-02 0.002
1. PB Q91ZT8 Ankyrin repeat and SOCS box protein 9 1.19e-09 3.32e-02 6.23e-09
1. PB Q8NI38 NF-kappa-B inhibitor delta 3.78e-08 1.42e-08 9.88e-08
1. PB Q96DX5 Ankyrin repeat and SOCS box protein 9 8.08e-11 5.47e-05 2.34e-07
1. PB Q10311 Ankyrin repeat-containing protein C6C3.08 5.63e-13 9.54e-06 3.87e-16
1. PB O75832 26S proteasome non-ATPase regulatory subunit 10 3.33e-16 8.13e-08 2.69e-24
1. PB Q9CQM6 Ankyrin repeat domain-containing protein 61 1.69e-09 2.30e-02 3.34e-14
2. P Q5UPS1 Putative ankyrin repeat protein R784 NA 1.34e-04 NA
2. P P0C9S0 Protein MGF 360-19R NA 9.25e-07 NA
2. P P0C9R8 Protein MGF 360-19R NA 6.92e-06 NA
2. P Q65258 Protein MGF 360-16R NA 9.02e-03 NA
2. P Q5UQZ5 Putative ankyrin repeat protein R903 NA 3.72e-02 NA
2. P P26711 Protein MGF 360-5L NA 1.34e-02 NA
2. P Q6ZQY2 Leucine-rich repeat-containing protein 74B 2.89e-01 4.67e-02 NA
2. P Q6PF05 Tetratricopeptide repeat protein 23-like 9.83e-02 1.37e-02 NA
2. P P10775 Ribonuclease inhibitor 2.98e-01 1.64e-05 NA
2. P Q5UP66 Putative ankyrin repeat protein R597 NA 3.04e-02 NA
2. P Q91VI7 Ribonuclease inhibitor 3.07e-01 2.81e-04 NA
2. P Q5I160 I-Kappa-B like protein C1 NA 7.29e-04 NA
2. P Q65122 Protein MGF 360-10L NA 1.04e-02 NA
2. P P0C9R3 Protein MGF 360-16R NA 4.21e-02 NA
2. P Q6P5M2 WD repeat-containing protein 61 9.84e-01 6.88e-03 NA
2. P Q6GMD2 WD repeat-containing protein 61 9.82e-01 1.25e-02 NA
2. P P0C9T9 Protein MGF 505-5R NA 3.76e-02 NA
2. P Q5UP64 Putative ankyrin repeat protein R599 NA 4.79e-04 NA
2. P P0C9R4 Protein MGF 360-16R NA 6.48e-04 NA
2. P P0C9M5 Protein MGF 360-3L NA 6.48e-03 NA
2. P P23164 Protein MGF 360-19R NA 1.70e-03 NA
2. P Q5UR56 Putative ankyrin repeat protein R580 NA 1.75e-04 NA
2. P Q5UP62 Putative ankyrin repeat protein R601 NA 1.54e-02 NA
2. P Q14BP6 Leucine-rich repeat-containing protein 74B 2.81e-01 1.28e-02 NA
2. P Q5I149 I-Kappa-B like protein G1 NA 2.66e-03 NA
2. P P0C9P4 Protein MGF 360-10L NA 5.75e-04 NA
2. P Q4V8D9 Leucine-rich repeat-containing protein 34 3.46e-01 2.09e-02 NA
2. P P0C9T8 Protein MGF 505-5R NA 1.62e-02 NA
2. P P0C9M2 Protein MGF 360-2L NA 1.08e-02 NA
2. P Q5UP34 Putative ankyrin repeat protein R825 NA 1.41e-02 NA
2. P Q5UP65 Putative ankyrin repeat protein R598 NA 2.61e-03 NA
2. P Q5UPB9 Putative ankyrin repeat protein L42 NA 2.38e-04 NA
2. P A5PLI4 LRP2-binding protein 4.83e-02 2.84e-02 NA
2. P Q5ZJH5 WD repeat-containing protein 61 9.84e-01 3.07e-02 NA
2. P Q4V7A0 WD repeat-containing protein 61 9.85e-01 2.25e-02 NA
2. P P0C9M8 Protein MGF 360-4L NA 8.28e-06 NA
2. P P26712 Protein MGF 360-4L NA 1.02e-02 NA
2. P P29315 Ribonuclease inhibitor 3.36e-01 2.82e-02 NA
2. P Q89702 Protein MGF 505-2R NA 3.24e-03 NA
2. P P0C9R5 Protein MGF 360-18R NA 6.92e-06 NA
3. B Q7TQI7 Ankyrin repeat and BTB/POZ domain-containing protein 2 5.26e-04 NA 4.62e-06
3. B Q8N9V6 Ankyrin repeat domain-containing protein 53 1.65e-03 NA 1.28e-08
3. B Q8VHS6 Ankyrin repeat and SOCS box protein 15 4.96e-14 NA 4.60e-17
3. B Q8BX02 KN motif and ankyrin repeat domain-containing protein 2 6.59e-03 NA 6.96e-05
3. B Q5URB9 Putative ankyrin repeat protein R840 NA NA 2.28e-21
3. B Q5UPD5 Putative ankyrin repeat protein L59 NA NA 5.05e-05
3. B Q8IZ07 Ankyrin repeat domain-containing protein 13A 4.43e-02 NA 3.08e-05
3. B Q9J5H9 Putative ankyrin repeat protein FPV022 NA NA 1.06e-09
3. B Q8IUH5 Palmitoyltransferase ZDHHC17 2.12e-06 NA 6.87e-14
3. B Q54KA7 Ankyrin repeat, PH and SEC7 domain containing protein secG 2.08e-12 NA 2.08e-42
3. B Q0V8G2 GA-binding protein subunit beta-2 6.05e-09 NA 5.03e-15
3. B P59672 Ankyrin repeat and SAM domain-containing protein 1A 2.12e-06 NA 1.27e-19
3. B Q6AFL2 Putative ankyrin-containing lipoprotein Lxx09580 2.77e-10 NA 2.50e-06
3. B O14974 Protein phosphatase 1 regulatory subunit 12A 1.36e-04 NA 4.13e-14
3. B Q99NH0 Ankyrin repeat domain-containing protein 17 1.43e-04 NA 9.41e-33
3. B Q7ZYD9 Ankyrin repeat domain-containing protein 13C-B 7.06e-02 NA 5.19e-04
3. B Q2QL84 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 3.38e-06 NA 2.78e-10
3. B A9JR78 Tonsoku-like protein 1.09e-02 NA 5.96e-15
3. B P57078 Receptor-interacting serine/threonine-protein kinase 4 5.49e-11 NA 3.09e-30
3. B Q6P9J5 KN motif and ankyrin repeat domain-containing protein 4 2.13e-02 NA 1.15e-05
3. B Q3TYL0 IQ motif and ankyrin repeat domain-containing protein 1 1.37e-03 NA 4.92e-05
3. B Q9Y575 Ankyrin repeat and SOCS box protein 3 0.00e+00 NA 2.64e-26
3. B Q1LZC5 Ankyrin repeat domain-containing protein 54 6.51e-04 NA 1.90e-13
3. B Q2QLB5 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 3.72e-05 NA 3.31e-12
3. B Q6S5J6 Krev interaction trapped protein 1 2.01e-02 NA 1.64e-04
3. B P0C6P7 Protein fem-1 homolog B 2.36e-07 NA 3.01e-11
3. B Q8CEF1 Protein fem-1 homolog C 4.32e-08 NA 2.76e-13
3. B Q4FE45 E3 ubiquitin-protein ligase XBAT33 2.95e-06 NA 5.01e-10
3. B Q9WV74 Ankyrin repeat and SOCS box protein 1 5.73e-06 NA 4.25e-08
3. B D3J162 Protein VAPYRIN 6.86e-11 NA 1.33e-28
3. B Q0P5B9 Ankyrin repeat domain-containing protein 39 7.49e-10 NA 1.21e-13
3. B Q4UJ75 Putative ankyrin repeat domain-containing protein 20A4 8.82e-07 NA 1.17e-12
3. B Q9UM47 Neurogenic locus notch homolog protein 3 1.73e-02 NA 7.20e-14
3. B Q9JRZ6 Putative ankyrin repeat protein NMB1133/NMB1171 3.31e-03 NA 0.003
3. B Q8N7Z5 Ankyrin repeat domain-containing protein 31 1.16e-01 NA 2.72e-12
3. B Q01317 Ankyrin repeat protein nuc-2 6.65e-07 NA 7.70e-12
3. B Q566C8 Ankyrin repeat domain-containing protein 54 4.07e-04 NA 3.54e-14
3. B P14585 Protein lin-12 2.27e-04 NA 3.91e-09
3. B Q96T49 Protein phosphatase 1 regulatory inhibitor subunit 16B 2.29e-08 NA 1.32e-15
3. B O14593 DNA-binding protein RFXANK 1.09e-10 NA 1.25e-09
3. B Q8LSQ2 Probable signal recognition particle 43 kDa protein, chloroplastic 3.07e-03 NA 0.002
3. B Q9UPQ3 Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 5.71e-02 NA 0.006
3. B Q99466 Neurogenic locus notch homolog protein 4 8.11e-03 NA 1.73e-14
3. B P13264 Glutaminase kidney isoform, mitochondrial 3.34e-02 NA 0.001
3. B P0DJE5 Alpha-latroinsectotoxin-Lh1a (Fragments) 1.91e-02 NA 0.001
3. B Q8K4M9 Oxysterol-binding protein-related protein 1 4.44e-05 NA 5.46e-11
3. B Q07E41 Cortactin-binding protein 2 8.92e-04 NA 8.31e-13
3. B Q00PJ3 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 2.48e-05 NA 4.65e-10
3. B Q9Y576 Ankyrin repeat and SOCS box protein 1 3.86e-06 NA 1.95e-08
3. B P62774 Myotrophin 2.45e-11 NA 1.40e-06
3. B Q95N27 Protein phosphatase 1 regulatory inhibitor subunit 16B 5.05e-07 NA 6.66e-15
3. B P97819 85/88 kDa calcium-independent phospholipase A2 5.92e-07 NA 1.20e-18
3. B Q8N6S4 Ankyrin repeat domain-containing protein 13C 1.68e-01 NA 3.68e-04
3. B Q9WV06 Ankyrin repeat domain-containing protein 2 7.00e-08 NA 7.03e-15
3. B Q02357 Ankyrin-1 3.47e-07 NA 7.93e-39
3. B O44997 Death-associated protein kinase dapk-1 1.22e-06 NA 1.03e-16
3. B Q14161 ARF GTPase-activating protein GIT2 3.16e-01 NA 0.030
3. B Q5FVC7 Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 1.62e-02 NA 7.64e-07
3. B Q2QLC6 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 1.36e-05 NA 3.43e-10
3. B Q4ULZ2 Putative ankyrin repeat protein RF_0580 1.28e-10 NA 3.47e-12
3. B Q8N8A2 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B 5.12e-12 NA 9.93e-42
3. B Q9NU02 Ankyrin repeat and EF-hand domain-containing protein 1 1.35e-07 NA 1.36e-09
3. B Q29RM5 Protein fem-1 homolog A 9.22e-08 NA 2.73e-12
3. B Q9ZU96 Ankyrin repeat-containing protein At2g01680 1.31e-08 NA 4.71e-04
3. B Q5ZK62 Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 2.85e-04 NA 1.56e-05
3. B Q5TYM7 CARD- and ANK-domain containing inflammasome adapter protein 7.77e-16 NA 8.90e-31
3. B B2FKA7 Actin-binding protein Smlt3054 3.93e-04 NA 1.28e-05
3. B Q5U312 Ankycorbin 1.49e-06 NA 3.38e-25
3. B Q21920 Ankyrin repeat and KH domain-containing protein mask-1 3.01e-05 NA 3.20e-24
3. B Q65XV2 E3 ubiquitin-protein ligase XB3 1.41e-06 NA 1.50e-10
3. B Q5R6D7 Ankyrin repeat and SOCS box protein 8 8.92e-08 NA 4.92e-15
3. B S0DPL8 Apicidin F cluster transcription factor apf2 1.04e-06 NA 1.52e-08
3. B Q8WUF5 RelA-associated inhibitor 6.47e-04 NA 2.38e-04
3. B Q8IV38 Ankyrin repeat and MYND domain-containing protein 2 1.39e-03 NA 0.004
3. B A1ZBY1 Protein fem-1 homolog B 1.50e-07 NA 6.82e-12
3. B Q554E7 Putative ZDHHC-type palmitoyltransferase 5 8.29e-06 NA 1.72e-11
3. B Q14DN9 Ankyrin repeat and death domain-containing protein 1B 5.55e-16 NA 6.85e-22
3. B Q4JHE0 Probable E3 ubiquitin-protein ligase XBOS36 6.71e-07 NA 4.83e-11
3. B Q9VUX2 E3 ubiquitin-protein ligase mind-bomb 2.47e-06 NA 1.97e-18
3. B A6QL64 Ankyrin repeat domain-containing protein 36A 3.30e-03 NA 2.57e-08
3. B P53356 Tyrosine-protein kinase HTK16 8.63e-03 NA 1.33e-06
3. B Q5UQC4 Putative ankyrin repeat protein R229 NA NA 5.62e-05
3. B Q9SQK3 Ankyrin repeat domain-containing protein EMB506, chloroplastic 1.33e-09 NA 1.37e-07
3. B Q7T0Q1 Myotrophin 1.50e-11 NA 9.18e-08
3. B Q4UL00 Putative ankyrin repeat protein RF_0922 4.34e-12 NA 7.42e-05
3. B Q6NRD0 Ankyrin repeat domain-containing protein 13C-A 6.13e-02 NA 0.001
3. B A2AQH4 BCL-6 corepressor-like protein 1 3.22e-01 NA 7.47e-06
3. B O70511 Ankyrin-3 4.77e-05 NA 4.67e-42
3. B Q90623 Protein phosphatase 1 regulatory subunit 12A 4.75e-05 NA 8.94e-12
3. B Q3U0D9 E3 ubiquitin-protein ligase HACE1 1.16e-05 NA 1.55e-19
3. B Q5R8C8 Ankyrin repeat domain-containing protein 46 9.09e-05 NA 7.04e-11
3. B Q5UQJ0 Putative ankyrin repeat protein R835 NA NA 4.88e-11
3. B Q9TXQ1 Poly [ADP-ribose] polymerase tankyrase 2.56e-05 NA 1.61e-14
3. B P24769 Ankyrin repeat protein B4 NA NA 4.75e-10
3. B Q7Z8U2 Palmitoyltransferase akr1 1.34e-06 NA 6.11e-12
3. B Q5UPE2 Putative ankyrin repeat protein L63 NA NA 2.55e-13
3. B Q7T163 Kinase D-interacting substrate of 220 kDa B 9.99e-08 NA 1.09e-27
3. B Q68DC2 Ankyrin repeat and SAM domain-containing protein 6 5.76e-09 NA 8.21e-15
3. B Q9J505 Putative ankyrin repeat protein FPV230 NA NA 5.82e-05
3. B A1X154 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 9.72e-06 NA 9.56e-12
3. B Q7XUW4 Potassium channel KOR2 9.26e-05 NA 2.38e-13
3. B Q6RI86 Transient receptor potential cation channel subfamily A member 1 6.24e-08 NA 3.60e-16
3. B Q15057 Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 2.34e-03 NA 2.56e-06
3. B Q1RMI3 GA-binding protein subunit beta-1 6.70e-10 NA 8.79e-16
3. B Q9WV48 SH3 and multiple ankyrin repeat domains protein 1 9.98e-03 NA 1.90e-10
3. B Q8N2N9 Ankyrin repeat domain-containing protein 36B 5.89e-04 NA 8.94e-12
3. B Q6BP80 Palmitoyltransferase AKR1 2.56e-05 NA 8.82e-07
3. B Q63369 Nuclear factor NF-kappa-B p105 subunit (Fragment) 1.60e-07 NA 3.22e-09
3. B Q5I156 I-Kappa-B like protein F1 NA NA 1.68e-05
3. B Q4UJY2 Putative ankyrin repeat protein RF_1306 5.02e-09 NA 1.03e-06
3. B D3J163 Protein VAPYRIN-LIKE 1.02e-08 NA 2.48e-20
3. B Q28C34 Ankyrin repeat domain-containing protein 13C 6.77e-02 NA 3.57e-05
3. B A2A690 Protein TANC2 3.21e-05 NA 1.58e-28
3. B A5A3E0 POTE ankyrin domain family member F 4.76e-04 NA 6.67e-15
3. B Q07DW4 Cortactin-binding protein 2 6.66e-04 NA 7.57e-12
3. B Q6KAE5 Probable E3 ubiquitin-protein ligase XBOS32 6.36e-07 NA 2.91e-09
3. B Q6FJ70 Palmitoyltransferase AKR1 1.87e-06 NA 1.28e-08
3. B Q38898 Potassium channel AKT2/3 5.19e-03 NA 8.98e-08
3. B Q8VHH5 Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 1.31e-01 NA 2.64e-06
3. B Q8CGN4 BCL-6 corepressor 1.05e-01 NA 5.36e-06
3. B Q61982 Neurogenic locus notch homolog protein 3 1.62e-02 NA 1.84e-13
3. B Q7T3X9 Notch-regulated ankyrin repeat-containing protein B 1.88e-05 NA 2.27e-04
3. B Q7T3P8 Protein fem-1 homolog C 5.95e-09 NA 2.02e-13
3. B Q80UP3 Diacylglycerol kinase zeta 2.70e-02 NA 9.97e-07
3. B Q5UPX1 Putative ankyrin repeat protein L289 NA NA 2.45e-09
3. B Q5UQI8 Putative ankyrin repeat protein R837 NA NA 1.33e-04
3. B P17221 Sex-determining protein fem-1 1.22e-05 NA 3.38e-08
3. B Q13574 Diacylglycerol kinase zeta 2.37e-02 NA 1.15e-06
3. B Q8BXP5 Photoreceptor ankyrin repeat protein 2.10e-05 NA 0.013
3. B O83515 Putative ankyrin repeat-containing protein TP_0502 1.02e-05 NA 1.11e-05
3. B A7MB89 Protein fem-1 homolog C 7.07e-09 NA 3.05e-13
3. B Q9WTT2 Caseinolytic peptidase B protein homolog 1.81e-02 NA 7.44e-08
3. B Q80T11 Usher syndrome type-1G protein homolog 1.77e-03 NA 2.57e-05
3. B Q9D2J7 Ankyrin repeat and EF-hand domain-containing protein 1 1.75e-07 NA 2.04e-09
3. B Q5UQF1 Putative ankyrin repeat protein L483 NA NA 9.24e-15
3. B Q9D119 Protein phosphatase 1 regulatory subunit 27 3.84e-07 NA 2.26e-06
3. B Q9H2K2 Poly [ADP-ribose] polymerase tankyrase-2 8.20e-09 NA 6.97e-36
3. B Q9D061 Acyl-CoA-binding domain-containing protein 6 2.65e-04 NA 4.44e-09
3. B Q9BXX2 Ankyrin repeat domain-containing protein 30B 1.52e-04 NA 2.67e-11
3. B Q06547 GA-binding protein subunit beta-1 6.53e-10 NA 9.77e-16
3. B A6NHY2 Ankyrin repeat and death domain-containing protein 1B 3.11e-15 NA 8.27e-24
3. B Q91ZT7 Ankyrin repeat and SOCS box protein 10 1.08e-11 NA 9.21e-14
3. B P55273 Cyclin-dependent kinase 4 inhibitor D 2.40e-11 NA 4.41e-09
3. B Q62415 Apoptosis-stimulating of p53 protein 1 4.30e-03 NA 1.50e-04
3. B Q8UVC1 Inversin 1.21e-08 NA 6.74e-28
3. B Q5SQ80 Putative ankyrin repeat domain-containing protein 20A2 6.55e-07 NA 6.06e-13
3. B Q8GSP8 Zygote-specific protein 3 1.66e-02 NA 0.004
3. B Q2IBD4 Cortactin-binding protein 2 6.88e-04 NA 1.28e-11
3. B P0CG39 POTE ankyrin domain family member J 2.89e-04 NA 1.19e-14
3. B P46530 Neurogenic locus notch homolog protein 1 9.28e-03 NA 1.34e-14
3. B Q6GQW0 Ankyrin repeat and BTB/POZ domain-containing protein BTBD11 2.09e-03 NA 5.79e-06
3. B Q6TGW5 Osteoclast-stimulating factor 1 4.44e-07 NA 1.51e-06
3. B Q2IBE3 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 5.45e-06 NA 1.13e-10
3. B Q63618 Espin 9.77e-11 NA 2.15e-18
3. B Q1RIZ4 Putative ankyrin repeat protein RBE_0589 2.16e-05 NA 1.53e-07
3. B B9EJA2 Cortactin-binding protein 2 2.25e-05 NA 4.61e-12
3. B Q8MJ50 Osteoclast-stimulating factor 1 3.99e-07 NA 1.63e-06
3. B Q8CGB3 Uveal autoantigen with coiled-coil domains and ankyrin repeats 3.65e-06 NA 2.42e-15
3. B Q8IWB6 Inactive serine/threonine-protein kinase TEX14 2.75e-01 NA 1.38e-06
3. B Q3UES3 Poly [ADP-ribose] polymerase tankyrase-2 5.83e-09 NA 2.41e-35
3. B A5WVX9 Palmitoyltransferase ZDHHC17 4.85e-06 NA 5.14e-13
3. B Q9J504 Putative ankyrin repeat protein FPV231 NA NA 3.07e-15
3. B Q91ZT9 Ankyrin repeat and SOCS box protein 8 1.39e-06 NA 4.83e-15
3. B P40578 Protein MGA2 7.63e-02 NA 1.10e-10
3. B Q6W2J9 BCL-6 corepressor 2.90e-01 NA 6.38e-06
3. B P0DSS9 Ankyrin repeat protein B4 NA NA 4.18e-07
3. B Q9Y2G4 Ankyrin repeat domain-containing protein 6 9.72e-11 NA 6.29e-22
3. B Q58CT0 Dynein axonemal heavy chain 12 4.02e-09 NA 4.23e-07
3. B F1LTE0 Protein TANC2 2.37e-05 NA 6.39e-27
3. B O08764 Ankyrin repeat and BTB/POZ domain-containing protein 2 1.19e-03 NA 1.04e-05
3. B B1AK53 Espin 1.39e-10 NA 2.46e-15
3. B Q495M9 Usher syndrome type-1G protein 1.16e-02 NA 2.30e-05
3. B Q9ERC1 Unconventional myosin-XVI 1.23e-02 NA 2.18e-08
3. B Q9P2R3 Rabankyrin-5 4.75e-07 NA 6.79e-17
3. B Q8BZ25 Ankyrin repeat and protein kinase domain-containing protein 1 5.87e-12 NA 3.82e-30
3. B Q8UVC3 Inversin 2.01e-08 NA 4.80e-30
3. B P13508 Protein glp-1 8.13e-06 NA 9.40e-11
3. B Q9SCX5 Probable potassium channel AKT5 5.79e-04 NA 1.75e-12
3. B Q2QLG0 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 6.30e-06 NA 1.34e-11
3. B Q05823 2-5A-dependent ribonuclease 1.88e-07 NA 4.42e-17
3. B P40418 Regulatory protein SWI6 1.90e-02 NA 0.032
3. B P57044 Integrin-linked protein kinase 5.60e-04 NA 3.20e-09
3. B Q91XL9 Oxysterol-binding protein-related protein 1 1.41e-04 NA 1.13e-10
3. B Q75HP9 Potassium channel AKT2 5.67e-03 NA 1.47e-06
3. B Q4X251 Palmitoyltransferase akr1 1.60e-07 NA 2.08e-12
3. B Q8WMX7 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 1.66e-05 NA 1.86e-10
3. B Q12013 Probable palmitoyltransferase AKR2 1.14e-05 NA 3.84e-08
3. B Q08E43 Ankyrin repeat and SOCS box protein 8 6.85e-07 NA 3.81e-15
3. B Q5UPG6 Putative ankyrin repeat protein L92 NA NA 3.82e-09
3. B Q1RK82 Putative ankyrin repeat protein RBE_0151 4.00e-05 NA 0.002
3. B Q8VBX0 Ankyrin repeat and SOCS box protein 13 4.31e-11 NA 4.47e-14
3. B B7WN72 Protein shank 1.61e-03 NA 2.61e-10
3. B Q9BXW6 Oxysterol-binding protein-related protein 1 1.04e-04 NA 3.17e-10
3. B Q9Z205 DNA-binding protein RFXANK 2.55e-14 NA 7.09e-09
3. B Q14678 KN motif and ankyrin repeat domain-containing protein 1 3.45e-02 NA 2.43e-05
3. B Q00653 Nuclear factor NF-kappa-B p100 subunit 3.41e-05 NA 4.58e-07
3. B Q6NPP4 Calmodulin-binding transcription activator 2 6.42e-02 NA 0.006
3. B P46683 Ankyrin repeat-containing protein YAR1 8.81e-06 NA 0.030
3. B Q5ZLC8 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C 8.14e-14 NA 7.87e-41
3. B Q9ULT8 E3 ubiquitin-protein ligase HECTD1 1.44e-01 NA 1.94e-07
3. B P40560 Ankyrin repeat-containing protein YIL001W 3.21e-02 NA 0.005
3. B Q68LP1 E3 ubiquitin-protein ligase MIB2 1.29e-08 NA 1.24e-17
3. B Q01484 Ankyrin-2 NA NA 1.31e-43
3. B Q9UK73 Protein fem-1 homolog B 4.05e-07 NA 2.75e-11
3. B F8W2M1 E3 ubiquitin-protein ligase HACE1 3.57e-05 NA 1.76e-18
3. B Q2QLH1 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 1.72e-05 NA 2.05e-10
3. B Q9WV71 Ankyrin repeat and SOCS box protein 4 1.68e-09 NA 1.32e-07
3. B Q4R739 Ankyrin repeat domain-containing protein 53 1.08e-03 NA 2.03e-08
3. B Q9J513 Putative ankyrin repeat protein FPV222 NA NA 9.49e-17
3. B Q9DBR7 Protein phosphatase 1 regulatory subunit 12A 2.66e-04 NA 3.95e-14
3. B Q9U518 L-asparaginase 6.66e-06 NA 3.05e-06
3. B Q9Y283 Inversin 1.66e-10 NA 1.54e-30
3. B Q9J512 Putative ankyrin repeat protein FPV223 NA NA 5.64e-10
3. B Q495B1 Ankyrin repeat and death domain-containing protein 1A 0.00e+00 NA 4.27e-27
3. B Q9M8S6 Potassium channel SKOR 4.97e-04 NA 1.44e-10
3. B Q29Q26 Ankyrin repeat domain-containing protein 2B 4.85e-04 NA 9.60e-09
3. B Q9ULH0 Kinase D-interacting substrate of 220 kDa 2.72e-05 NA 5.14e-30
3. B G3I6Z6 Neurogenic locus notch homolog protein 1 NA NA 4.78e-14
3. B Q9BGT9 Ankyrin repeat and SOCS box protein 7 4.24e-14 NA 5.82e-19
3. B Q5XJ13 Ankyrin repeat and SAM domain-containing protein 6 4.99e-06 NA 4.82e-07
3. B P14360 Putative ankyrin repeat protein FPV240 NA NA 4.11e-08
3. B Q5UPB4 Putative ankyrin repeat protein L36 NA NA 1.93e-07
3. B O70445 BRCA1-associated RING domain protein 1 2.19e-02 NA 1.08e-12
3. B Q4UKJ3 Putative ankyrin repeat protein RF_1087 5.20e-07 NA 3.13e-07
3. B Q3U0L2 Ankyrin repeat domain-containing protein 33B 6.13e-04 NA 0.001
3. B Q09YK6 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 2.26e-05 NA 1.08e-10
3. B Q9WV72 Ankyrin repeat and SOCS box protein 3 0.00e+00 NA 3.17e-27
3. B Q5UPG5 Putative ankyrin repeat protein L93 NA NA 4.03e-27
3. B Q86SG2 Ankyrin repeat domain-containing protein 23 4.72e-07 NA 2.20e-13
3. B Q91WK7 Ankyrin repeat domain-containing protein 54 8.16e-05 NA 4.57e-14
3. B Q876L4 Probable palmitoyltransferase AKR2 1.19e-05 NA 9.58e-12
3. B Q9J502 Putative ankyrin repeat protein FPV233 NA NA 2.25e-11
3. B Q5UP15 Putative ankyrin repeat protein R844 NA NA 4.56e-05
3. B Q80SY4 E3 ubiquitin-protein ligase MIB1 7.05e-09 NA 5.17e-24
3. B Q876L5 Palmitoyltransferase AKR1 3.53e-05 NA 6.15e-10
3. B Q4I8B6 Palmitoyltransferase AKR1 4.17e-07 NA 6.23e-12
3. B P16157 Ankyrin-1 4.47e-07 NA 7.44e-42
3. B Q5VUR7 Putative ankyrin repeat domain-containing protein 20A3 1.79e-06 NA 5.64e-13
3. B O88202 60 kDa lysophospholipase 7.70e-04 NA 3.10e-05
3. B A4II29 Notch-regulated ankyrin repeat-containing protein 5.34e-05 NA 1.08e-04
3. B Q337A0 Probable E3 ubiquitin-protein ligase XBOS33 5.61e-06 NA 9.69e-10
3. B Q6S8J3 POTE ankyrin domain family member E 4.17e-04 NA 4.57e-15
3. B Q96I34 Protein phosphatase 1 regulatory subunit 16A 1.36e-07 NA 2.11e-11
3. B Q0VGY8 Protein TANC1 1.55e-05 NA 1.18e-25
3. B P0C0T2 Ankyrin repeat and SAM domain-containing protein 6 6.65e-09 NA 2.09e-15
3. B O95271 Poly [ADP-ribose] polymerase tankyrase-1 3.63e-08 NA 2.07e-34
3. B Q5UPI6 Putative ankyrin repeat protein L112 NA NA 2.54e-05
3. B A6QL63 Ankyrin repeat and BTB/POZ domain-containing protein BTBD11 1.97e-03 NA 5.58e-06
3. B Q9UI32 Glutaminase liver isoform, mitochondrial 2.68e-02 NA 0.004
3. B G0LXV8 Alpha-latrotoxin-Lh1a (Fragment) 3.54e-08 NA 1.47e-21
3. B Q15027 Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 8.11e-03 NA 4.61e-06
3. B Q9Y566 SH3 and multiple ankyrin repeat domains protein 1 1.23e-02 NA 3.45e-10
3. B Q653P0 Potassium channel KOR1 1.37e-03 NA 3.35e-12
3. B Q6PFX9 Poly [ADP-ribose] polymerase tankyrase-1 4.26e-08 NA 2.14e-35
3. B Q9J5I3 Putative ankyrin repeat protein FPV018 NA NA 4.02e-14
3. B Q2IBG0 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 2.07e-05 NA 2.45e-11
3. B Q94B55 Putative E3 ubiquitin-protein ligase XBAT31 9.57e-09 NA 7.69e-11
3. B Q6P1S6 Myotrophin 3.24e-11 NA 2.70e-08
3. B Q6PD24 Ankyrin repeat domain-containing protein 13D 6.22e-02 NA 0.002
3. B C7B178 Protein VAPYRIN 3.31e-12 NA 1.32e-26
3. B Q5R4M7 Ankyrin repeat and SOCS box protein 6 2.48e-07 NA 7.11e-05
3. B Q875M2 Palmitoyltransferase AKR1 1.58e-06 NA 8.12e-04
3. B Q71S21 Inversin-B 3.60e-09 NA 2.40e-32
3. B Q8VHK2 Caskin-1 1.08e-03 NA 4.97e-19
3. B Q9R172 Neurogenic locus notch homolog protein 3 1.90e-02 NA 1.19e-13
3. B Q7Z020 Transient receptor potential cation channel subfamily A member 1 4.43e-08 NA 1.63e-18
3. B Q6DGX3 Ankyrin repeat domain-containing protein 54 4.87e-04 NA 1.92e-15
3. B Q4P6L3 Palmitoyltransferase AKR1 9.25e-05 NA 2.14e-10
3. B Q9P0K7 Ankycorbin 7.03e-05 NA 7.02e-25
3. B Q3V096 Ankyrin repeat domain-containing protein 42 0.00e+00 NA 5.67e-26
3. B O13987 Ankyrin and IPT/TIG repeat-containing protein C26H5.05 4.78e-02 NA 4.98e-10
3. B Q5JPF3 Ankyrin repeat domain-containing protein 36C 2.49e-03 NA 1.00e-09
3. B Q8R3P9 SMC5-SMC6 complex localization factor protein 1 1.84e-02 NA 2.46e-06
3. B Q96AX9 E3 ubiquitin-protein ligase MIB2 1.02e-08 NA 1.77e-17
3. B A0A3L7I2I8 85/88 kDa calcium-independent phospholipase A2 7.06e-07 NA 6.47e-19
3. B Q5DU14 Unconventional myosin-XVI 6.47e-03 NA 4.24e-10
3. B Q5UPH0 Putative ankyrin repeat protein L100 NA NA 3.64e-07
3. B Q86YR6 POTE ankyrin domain family member D 8.79e-06 NA 7.62e-14
3. B Q5UPE3 Putative ankyrin repeat protein L62 NA NA 7.59e-09
3. B Q6NRS1 Inhibitor of Bruton tyrosine kinase 3.24e-01 NA 0.007
3. B Q923M0 Protein phosphatase 1 regulatory subunit 16A 1.06e-07 NA 1.74e-11
3. B Q6F3J0 Nuclear factor NF-kappa-B p105 subunit 6.32e-05 NA 7.52e-10
3. B Q5UQY4 Putative ankyrin repeat protein R886 (Fragment) NA NA 4.49e-07
3. B Q94527 Nuclear factor NF-kappa-B p110 subunit 2.47e-03 NA 2.89e-05
3. B O77617 Cyclin-dependent kinase inhibitor 2A 2.25e-06 NA 1.57e-07
3. B O00522 Krev interaction trapped protein 1 2.57e-02 NA 0.001
3. B Q07E28 Cortactin-binding protein 2 7.68e-04 NA 5.32e-13
3. B Q5H9F3 BCL-6 corepressor-like protein 1 3.15e-01 NA 1.82e-04
3. B Q8WXK3 Ankyrin repeat and SOCS box protein 13 4.70e-11 NA 5.26e-14
3. B Q96P64 Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 4 2.35e-02 NA 0.030
3. B Q55A55 Probable serine/threonine-protein kinase DDB_G0272092 2.75e-03 NA 1.24e-08
3. B Q5GIG6 Serine/threonine-protein kinase TNNI3K 3.00e-12 NA 6.77e-21
3. B Q5TYW2 Ankyrin repeat domain-containing protein 20A1 2.10e-05 NA 7.57e-13
3. B Q92625 Ankyrin repeat and SAM domain-containing protein 1A 5.04e-05 NA 9.61e-20
3. B Q3UUF8 Ankyrin repeat domain-containing protein 34B 5.16e-04 NA 6.90e-04
3. B Q09YI3 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 1.07e-05 NA 5.46e-12
3. B A0M8T5 Cortactin-binding protein 2 9.84e-04 NA 1.39e-12
3. B Q9J5I9 Putative ankyrin repeat protein FPV012 NA NA 1.65e-07
3. B Q5ZM55 Protein fem-1 homolog B 2.87e-08 NA 9.98e-11
3. B Q2KI79 Ankyrin repeat family A protein 2 2.42e-06 NA 1.05e-09
3. B Q6UB98 Ankyrin repeat domain-containing protein 12 1.08e-01 NA 4.26e-14
3. B Q07E15 Cortactin-binding protein 2 4.48e-03 NA 6.94e-13
3. B Q9XZC0 Alpha-latrocrustotoxin-Lt1a (Fragment) 5.18e-07 NA 3.71e-28
3. B Q9NVP4 Double zinc ribbon and ankyrin repeat-containing protein 1 1.22e-02 NA 0.016
3. B O75912 Diacylglycerol kinase iota 6.01e-02 NA 0.005
3. B P55272 Cyclin-dependent kinase 4 inhibitor B 8.97e-11 NA 2.01e-07
3. B Q94A76 Potassium channel GORK 8.00e-04 NA 6.36e-12
3. B Q9V7A7 G patch domain and ankyrin repeat-containing protein 1 homolog 7.93e-03 NA 0.009
3. B Q80UP5 Ankyrin repeat domain-containing protein 13A 4.01e-02 NA 0.002
3. B Q8Q0U0 Putative ankyrin repeat protein MM_0045 7.27e-12 NA 4.62e-27
3. B Q8N961 Ankyrin repeat and BTB/POZ domain-containing protein 2 5.30e-04 NA 4.34e-06
3. B Q7EZ44 Probable E3 ubiquitin-protein ligase XBOS35 8.53e-07 NA 1.48e-12
3. B Q54KH3 Ankyrin repeat domain-containing protein 39 homolog 8.91e-08 NA 9.05e-09
3. B O35516 Neurogenic locus notch homolog protein 2 1.51e-02 NA 4.17e-20
3. B A6NCL7 Ankyrin repeat domain-containing protein 33B 1.27e-03 NA 1.77e-05
3. B Q5VYY1 Ankyrin repeat domain-containing protein 22 3.80e-07 NA 6.01e-09
3. B Q755Y0 Palmitoyltransferase AKR1 1.38e-06 NA 9.91e-13
3. B Q6XJU9 Osteoclast-stimulating factor 1 3.80e-05 NA 1.23e-06
3. B Q7XI08 Probable E3 ubiquitin-protein ligase XBOS34 5.67e-04 NA 0.003
3. B Q3UHD9 Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 1.69e-01 NA 0.002
3. B Q9XX14 Arf-GAP with ANK repeat and PH domain-containing protein cnt-2 1.02e-01 NA 7.91e-05
3. B Q03017 NF-kappa-B inhibitor cactus 2.47e-08 NA 2.28e-06
3. B Q6P686 Osteoclast-stimulating factor 1 2.13e-07 NA 3.43e-06
3. B B8N0E6 Ankyrin-repeat domain containing transcription coregulator asaA 1.07e-04 NA 3.62e-07
3. B O75762 Transient receptor potential cation channel subfamily A member 1 1.96e-07 NA 7.15e-20
3. B Q91WD2 Transient receptor potential cation channel subfamily V member 6 9.30e-05 NA 0.031
3. B Q5M9H0 Ankyrin repeat and SAM domain-containing protein 3 1.35e-05 NA 2.35e-12
3. B Q8VD46 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 1.56e-05 NA 1.48e-11
3. B Q5UPA0 Putative ankyrin repeat protein L25 NA NA 2.01e-18
3. B Q6NY19 KN motif and ankyrin repeat domain-containing protein 3 1.34e-03 NA 2.23e-07
3. B P19838 Nuclear factor NF-kappa-B p105 subunit 2.00e-04 NA 4.18e-09
3. B A0M8S4 Cortactin-binding protein 2 8.79e-04 NA 1.06e-09
3. B Q24145 Tyrosine-protein kinase Shark 5.67e-03 NA 4.58e-05
3. B A6NIR3 Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 5 5.41e-02 NA 0.031
3. B Q9TU71 Ankyrin repeat domain-containing protein 1 8.06e-07 NA 3.72e-14
3. B E9Q4F7 Ankyrin repeat domain-containing protein 11 3.31e-01 NA 9.38e-14
3. B Q18297 Transient receptor potential cation channel subfamily A member 1 homolog 1.52e-09 NA 3.98e-13
3. B Q8WWH4 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 1.86e-06 NA 1.06e-11
3. B Q1RJN6 Putative ankyrin repeat protein RBE_0347 5.97e-05 NA 1.82e-09
3. B A6QR20 SMC5-SMC6 complex localization factor protein 1 2.17e-02 NA 3.65e-05
3. B P98150 Nuclear factor NF-kappa-B p100 subunit 5.30e-05 NA 3.89e-08
3. B Q9XSM3 Transient receptor potential cation channel subfamily V member 5 2.71e-04 NA 0.044
3. B Q5UQZ7 Putative ankyrin repeat protein R901 NA NA 1.63e-15
3. B Q5RF15 Serine/threonine-protein kinase TNNI3K 0.00e+00 NA 4.10e-22
3. B Q8C008 Double zinc ribbon and ankyrin repeat-containing protein 1 2.76e-02 NA 0.034
3. B Q9VFD5 Protein fem-1 homolog CG6966 1.16e-06 NA 1.47e-14
3. B Q6P9K8 Caskin-1 7.98e-05 NA 4.58e-19
3. B Q7ZUV0 Ankyrin repeat domain-containing protein 13C 8.11e-02 NA 3.49e-05
3. B Q5UQ04 Putative ankyrin repeat protein R791 NA NA 1.83e-06
3. B Q9BZL4 Protein phosphatase 1 regulatory subunit 12C 3.98e-06 NA 1.20e-07
3. B Q2KJD8 Cyclin-dependent kinase 4 inhibitor B 3.09e-10 NA 5.98e-06
3. B Q2IBA2 Cortactin-binding protein 2 1.21e-03 NA 9.41e-10
3. B Q5UR04 Putative ankyrin repeat protein R911 NA NA 1.94e-15
3. B Q5UPA3 Putative ankyrin repeat protein L22 NA NA 1.39e-04
3. B Q812A3 Ankyrin repeat domain-containing protein 23 9.02e-09 NA 1.96e-14
3. B Q5UPF3 Putative ankyrin repeat protein L81 NA NA 0.005
3. B Q3SWY2 Integrin-linked protein kinase 6.92e-04 NA 3.64e-09
3. B A5PMU4 Ankyrin repeat and sterile alpha motif domain-containing protein 1B 2.87e-05 NA 5.27e-18
3. B Q876A6 Palmitoyltransferase AKR1 3.14e-05 NA 7.32e-11
3. B P0C7A6 Ankyrin repeat and BTB/POZ domain-containing protein BTBD11-B 1.86e-03 NA 8.63e-07
3. B Q5UP13 Putative ankyrin repeat protein R846 NA NA 0.008
3. B Q5UR87 Putative ankyrin repeat protein R634 NA NA 9.11e-13
3. B Q96KQ7 Histone-lysine N-methyltransferase EHMT2 6.04e-05 NA 8.82e-22
3. B Q9HFE7 Ankyrin repeat-containing protein P16F5.05c 1.50e-12 NA 4.37e-07
3. B P25799 Nuclear factor NF-kappa-B p105 subunit 5.26e-05 NA 1.13e-08
3. B Q92882 Osteoclast-stimulating factor 1 2.81e-07 NA 4.33e-06
3. B Q99LW0 Ankyrin repeat domain-containing protein 10 9.84e-07 NA 8.70e-08
3. B Q6GNY1 E3 ubiquitin-protein ligase mib1 2.10e-05 NA 4.39e-24
3. B Q91ZU0 Ankyrin repeat and SOCS box protein 7 8.38e-12 NA 2.45e-18
3. B Q9JLU4 SH3 and multiple ankyrin repeat domains protein 3 1.19e-02 NA 4.60e-09
3. B Q5UPV1 Putative ankyrin repeat protein L271 NA NA 5.12e-08
3. B Q9BYH8 NF-kappa-B inhibitor zeta 4.09e-05 NA 2.13e-08
3. B O74881 BTB/POZ domain-containing protein 1 4.60e-02 NA 4.58e-04
3. B Q5UPU4 Putative ankyrin repeat protein R267 NA NA 2.42e-14
3. B A2A2Z9 Ankyrin repeat domain-containing protein 18B 1.38e-05 NA 2.55e-14
3. B Q9J5H7 Putative ankyrin repeat protein FPV024 NA NA 3.48e-19
3. B Q09701 Palmitoyltransferase akr1 7.74e-06 NA 1.27e-14
3. B Q8WXI3 Ankyrin repeat and SOCS box protein 10 8.20e-12 NA 5.86e-13
3. B Q01705 Neurogenic locus notch homolog protein 1 1.48e-02 NA 4.78e-14
3. B Q9Z2G1 Protein fem-1 homolog A-A 4.48e-07 NA 6.45e-11
3. B P0C550 Potassium channel AKT1 9.08e-04 NA 2.09e-14
3. B X1WE18 KN motif and ankyrin repeat domain-containing protein 2 1.53e-02 NA 2.43e-06
3. B G5EGA3 Ankyrin repeat and LEM domain-containing protein 1 homolog 1.36e-01 NA 6.04e-04
3. B Q8TF27 Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 11 1.14e-02 NA 0.025
3. B D3Z7P3 Glutaminase kidney isoform, mitochondrial 3.34e-02 NA 0.001
3. B Q13625 Apoptosis-stimulating of p53 protein 2 3.92e-03 NA 2.61e-07
3. B Q5UQI7 Putative ankyrin repeat protein R838 NA NA 1.56e-07
3. B Q5VUJ5 Putative Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 7 4.06e-02 NA 0.032
3. B Q8WXK1 Ankyrin repeat and SOCS box protein 15 6.05e-13 NA 2.06e-14
3. B Q2IBF8 Cortactin-binding protein 2 7.85e-04 NA 3.86e-11
3. B Q2T9K6 Protein fem-1 homolog C 2.03e-07 NA 3.53e-15
3. B Q9ULJ7 Ankyrin repeat domain-containing protein 50 2.82e-07 NA 2.28e-40
3. B Q07DX6 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 4.09e-06 NA 3.53e-10
3. B Q8VHK1 Caskin-2 4.98e-05 NA 3.01e-13
3. B Q9Y6X6 Unconventional myosin-XVI 3.24e-03 NA 4.37e-08
3. B Q9ZCL3 Putative ankyrin repeat protein RP714 4.92e-13 NA 1.38e-09
3. B Q8K2H4 Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 3.22e-03 NA 3.03e-06
3. B A5PK26 Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 1.22e-02 NA 7.21e-05
3. B P46531 Neurogenic locus notch homolog protein 1 2.92e-02 NA 1.89e-13
3. B Q2IBE6 Cortactin-binding protein 2 8.96e-04 NA 6.23e-11
3. B Q3ZBX7 Ankyrin repeat domain-containing protein 1 4.62e-07 NA 8.08e-16
3. B Q4V869 Acyl-CoA-binding domain-containing protein 6 2.11e-05 NA 1.37e-06
3. B Q09YG9 Cortactin-binding protein 2 1.11e-03 NA 4.53e-10
3. B Q8HXA6 Ankyrin repeat and SOCS box protein 15 4.67e-14 NA 1.81e-13
3. B Q0P5G1 Tonsoku-like protein 1.53e-02 NA 1.10e-13
3. B Q91ZU1 Ankyrin repeat and SOCS box protein 6 1.07e-06 NA 0.006
3. B Q96NS5 Ankyrin repeat and SOCS box protein 16 1.96e-10 NA 8.35e-11
3. B Q52T38 Protein S-acyltransferase 24 2.81e-06 NA 5.77e-17
3. B P0C6S7 Ankyrin repeat and sterile alpha motif domain-containing protein 1B 6.58e-06 NA 2.76e-16
3. B Q96JP0 Protein fem-1 homolog C 6.94e-09 NA 2.94e-13
3. B Q5U464 Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3 6.72e-02 NA 1.33e-06
3. B Q9C6C3 ADP-ribosylation factor GTPase-activating protein AGD2 2.29e-02 NA 1.14e-05
3. B Q1RJ94 Putative ankyrin repeat protein RBE_0489 2.73e-05 NA 6.69e-05
3. B P0C6C1 Ankyrin repeat domain-containing protein 34C 5.74e-04 NA 0.003
3. B D3YWQ0 Diacylglycerol kinase iota 6.60e-02 NA 0.013
3. B F1N6G5 E3 ubiquitin-protein ligase HACE1 3.56e-05 NA 1.19e-19
3. B Q8NFD2 Ankyrin repeat and protein kinase domain-containing protein 1 7.40e-11 NA 2.42e-30
3. B Q865U8 Ankyrin repeat domain-containing protein 1 1.96e-06 NA 1.11e-14
3. B Q9DF58 Integrin-linked protein kinase 7.70e-04 NA 1.86e-10
3. B Q6NZL6 Tonsoku-like protein 6.09e-03 NA 7.45e-15
3. B O60237 Protein phosphatase 1 regulatory subunit 12B 6.83e-05 NA 8.13e-12
3. B Q9SMX5 ADP-ribosylation factor GTPase-activating protein AGD4 2.75e-02 NA 1.73e-05
3. B Q1LZH7 KN motif and ankyrin repeat domain-containing protein 2 6.57e-03 NA 2.36e-06
3. B Q569N2 Ankyrin repeat domain-containing protein 37 7.73e-05 NA 0.009
3. B P17442 Phosphate system positive regulatory protein PHO81 1.05e-04 NA 9.29e-08
3. B Q8WVL7 Ankyrin repeat domain-containing protein 49 3.47e-10 NA 1.01e-11
3. B Q3UX43 Ankyrin repeat domain-containing protein 13C 8.35e-02 NA 3.37e-04
3. B A2VDR2 Acyl-CoA-binding domain-containing protein 6 8.10e-04 NA 2.13e-10
3. B Q95RG8 ARF GTPase-activating protein Git 2.52e-01 NA 1.20e-04
3. B Q00PJ1 Cortactin-binding protein 2 6.49e-04 NA 2.05e-10
3. B Q54BA2 Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 4.11e-04 NA 1.14e-15
3. B Q9VCA8 Ankyrin repeat and KH domain-containing protein mask NA NA 5.64e-29
3. B Q04861 Nuclear factor NF-kappa-B p105 subunit 1.44e-04 NA 1.75e-12
3. B A2ARS0 Ankyrin repeat domain-containing protein 63 3.29e-06 NA 2.18e-11
3. B F1MJR8 Inactive serine/threonine-protein kinase TEX14 1.83e-01 NA 6.34e-07
3. B Q25338 Delta-latroinsectotoxin-Lt1a 1.51e-08 NA 1.71e-19
3. B Q15327 Ankyrin repeat domain-containing protein 1 6.75e-08 NA 2.75e-14
3. B Q5EA33 Ankyrin repeat domain-containing protein 49 1.56e-09 NA 8.70e-12
3. B O94925 Glutaminase kidney isoform, mitochondrial 3.62e-02 NA 0.001
3. B Q5UPB6 Putative ankyrin repeat protein L45 NA NA 1.20e-05
3. B Q86YT6 E3 ubiquitin-protein ligase MIB1 1.75e-08 NA 6.46e-24
3. B Q9BXX3 Ankyrin repeat domain-containing protein 30A 1.52e-04 NA 3.61e-08
3. B Q94CT7 Probable E3 ubiquitin-protein ligase XBOS31 1.09e-07 NA 4.90e-09
3. B Q9TZC4 Integrin-linked protein kinase homolog pat-4 7.95e-06 NA 1.61e-10
3. B O89019 Inversin 2.44e-10 NA 4.59e-30
3. B Q66JD7 Acyl-CoA-binding domain-containing protein 6 1.30e-04 NA 2.97e-06
3. B Q69ZU8 Ankyrin repeat domain-containing protein 6 1.02e-09 NA 3.88e-22
3. B Q8WMX8 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 1.31e-05 NA 8.25e-12
3. B Q07DZ7 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 1.18e-05 NA 2.27e-10
3. B Q0JKV1 Potassium channel AKT1 3.68e-03 NA 2.07e-14
3. B Q19013 Putative glutaminase 2 1.93e-02 NA 1.47e-04
3. B Q09YH1 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 1.58e-05 NA 8.80e-11
3. B F1MAB7 Diacylglycerol kinase iota 4.77e-02 NA 0.015
3. B Q60773 Cyclin-dependent kinase 4 inhibitor D 1.33e-14 NA 2.33e-10
3. B Q2IBB2 Cortactin-binding protein 2 8.08e-04 NA 7.08e-13
3. B Q5UPG7 Putative ankyrin repeat protein L91 NA NA 1.71e-09
3. B Q5UP12 Putative ankyrin repeat protein R847 (Fragment) NA NA 1.29e-04
3. B Q9EQG6 Kinase D-interacting substrate of 220 kDa 1.56e-05 NA 2.05e-32
3. B Q5ZLC6 Ankyrin repeat domain-containing protein 10 1.55e-06 NA 1.67e-08
3. B Q4KL97 Ankyrin repeat domain-containing protein 1 4.83e-08 NA 1.69e-14
3. B P14368 Putative ankyrin repeat protein FPV234 NA NA 3.77e-09
3. B Q91955 Myotrophin 4.08e-11 NA 1.12e-06
3. B P58546 Myotrophin 2.64e-11 NA 2.90e-06
3. B Q2QLG9 Cortactin-binding protein 2 8.89e-04 NA 1.20e-11
3. B Q4R544 Ankyrin repeat and SOCS box protein 8 2.06e-06 NA 1.21e-14
3. B Q9J4Z6 Putative ankyrin repeat protein FPV244 NA NA 2.31e-23
3. B Q9J5A7 Putative ankyrin repeat protein FPV115 NA NA 7.27e-16
3. B Q5ZJJ9 Osteoclast-stimulating factor 1 1.85e-07 NA 4.30e-06
3. B B2RU33 POTE ankyrin domain family member C 1.10e-06 NA 1.39e-14
3. B Q5I1X5 RelA-associated inhibitor 8.14e-04 NA 0.001
3. B Q07E17 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 1.33e-05 NA 3.71e-11
3. B Q9UVH3 Palmitoyltransferase AKR1 (Fragment) 5.88e-03 NA 5.23e-08
3. B Q60772 Cyclin-dependent kinase 4 inhibitor C 4.84e-14 NA 1.14e-07
3. B O08560 Diacylglycerol kinase zeta 2.68e-02 NA 1.30e-07
3. B Q6NSI1 Putative ankyrin repeat domain-containing protein 26-like protein 2.07e-10 NA 4.17e-11
3. B Q68FF6 ARF GTPase-activating protein GIT1 2.07e-01 NA 0.011
3. B P0CG38 POTE ankyrin domain family member I 2.26e-05 NA 1.51e-14
3. B A0JP26 POTE ankyrin domain family member B3 2.43e-06 NA 6.61e-15
3. B Q5UPA2 Putative ankyrin repeat protein L23 NA NA 1.53e-08
3. B O74205 Transcription factor TOXE 4.53e-03 NA 1.51e-05
3. B Q09YJ5 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 1.23e-05 NA 7.12e-11
3. B Q8WMX6 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 1.21e-05 NA 1.31e-10
3. B Q6S5H5 POTE ankyrin domain family member G 6.44e-09 NA 2.15e-14
3. B P77736 Putative ankyrin repeat protein YahD 2.57e-12 NA 8.31e-05
3. B Q5F478 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B 4.10e-13 NA 1.33e-41
3. B Q8K3X6 Ankyrin repeat and SAM domain-containing protein 4B 1.03e-03 NA 1.69e-07
3. B Q5UP14 Putative ankyrin repeat protein R845 NA NA 3.19e-10
3. B Q9EST8 NF-kappa-B inhibitor zeta 4.62e-05 NA 3.21e-08
3. B Q62422 Osteoclast-stimulating factor 1 2.74e-05 NA 3.31e-06
3. B Q9J507 Putative ankyrin repeat protein FPV228 NA NA 2.27e-22
3. B Q7TQP6 Serine/threonine-protein kinase TNNI3K 4.87e-12 NA 8.55e-23
3. B P28492 Glutaminase liver isoform, mitochondrial 2.51e-02 NA 0.006
3. B P0CS67 Palmitoyltransferase AKR1 2.75e-06 NA 1.31e-13
3. B Q9Z2G0 Protein fem-1 homolog B 5.64e-08 NA 2.95e-11
3. B Q9XXH8 Arf-GAP with ANK repeat and PH domain-containing protein cnt-1 5.23e-02 NA 9.23e-08
3. B Q5UP11 Putative ankyrin repeat protein R848 NA NA 2.42e-09
3. B B4E2M5 Ankyrin repeat domain-containing protein 66 1.86e-04 NA 2.31e-06
3. B G5E8K5 Ankyrin-3 1.18e-08 NA 3.69e-43
3. B Q4UJC0 Putative ankyrin repeat protein RF_p42/RF_pd42 1.02e-07 NA 3.11e-05
3. B A0PJZ0 Putative ankyrin repeat domain-containing protein 20A5 6.10e-09 NA 2.55e-08
3. B V6CLA2 E3 ubiquitin-protein ligase hecd-1 1.55e-01 NA 4.22e-04
3. B Q6DD51 Caskin-2 2.25e-04 NA 8.42e-16
3. B Q5VW22 Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 6 2.52e-02 NA 0.032
3. B Q3TYA6 M-phase phosphoprotein 8 7.36e-04 NA 3.96e-09
3. B P21783 Neurogenic locus notch homolog protein 1 1.02e-02 NA 9.54e-11
3. B Q8TF21 Ankyrin repeat domain-containing protein 24 1.90e-04 NA 1.81e-16
3. B A0A0A6YYL3 POTE ankyrin domain family member B 2.17e-07 NA 3.50e-15
3. B Q9Z272 ARF GTPase-activating protein GIT1 1.46e-01 NA 0.010
3. B G4NID8 Transcription factor SWI6 4.11e-02 NA 0.037
3. B A0A0R4IQZ2 Putative palmitoyltransferase ZDHHC13 2.82e-06 NA 1.81e-08
3. B Q96HA7 Tonsoku-like protein 1.01e-02 NA 3.98e-15
3. B Q5CZ79 Ankyrin repeat domain-containing protein 20B 9.03e-05 NA 1.41e-12
3. B Q9H765 Ankyrin repeat and SOCS box protein 8 3.59e-08 NA 4.56e-15
3. B Q3KP44 Ankyrin repeat domain-containing protein 55 3.13e-11 NA 3.55e-15
3. B Q99549 M-phase phosphoprotein 8 9.71e-03 NA 1.74e-09
3. B Q9R0Z3 Cyclin-dependent kinase inhibitor 2A 3.20e-07 NA 1.09e-06
3. B Q54HC6 Ankyrin repeat-containing protein kinase A 1.56e-02 NA 2.05e-05
3. B Q8NAG6 Ankyrin repeat and LEM domain-containing protein 1 1.18e-04 NA 3.22e-04
3. B Q1RJR6 Putative ankyrin repeat protein RBE_0317 8.02e-07 NA 8.60e-07
3. B Q10728 Protein phosphatase 1 regulatory subunit 12A 9.34e-05 NA 3.81e-14
3. B Q9R186 Transient receptor potential cation channel subfamily V member 6 6.61e-04 NA 0.031
3. B P07207 Neurogenic locus Notch protein NA NA 1.11e-16
3. B Q07DV1 Cortactin-binding protein 2 9.09e-04 NA 3.93e-10
3. B Q9W0T5 Transient receptor potential channel pyrexia 1.49e-08 NA 3.95e-18
3. B Q9CWU2 Palmitoyltransferase ZDHHC13 1.06e-07 NA 6.32e-11
3. B Q5W7F2 ADP-ribosylation factor GTPase-activating protein AGD3 1.09e-01 NA 3.17e-08
3. B Q9FNP4 Phytochrome-interacting ankyrin-repeat protein 2 1.56e-08 NA 4.55e-09
3. B Q9NWX5 Ankyrin repeat and SOCS box protein 6 1.95e-07 NA 5.36e-05
3. B Q9STP8 Acyl-CoA-binding domain-containing protein 2 4.47e-04 NA 1.10e-11
3. B Q04749 Target of rapamycin complex 2 subunit AVO2 3.28e-05 NA 2.57e-04
3. B A2CIR5 Ankyrin repeat-containing protein NPR4 1.91e-10 NA 2.23e-07
3. B P51480 Cyclin-dependent kinase inhibitor 2A 2.06e-06 NA 1.31e-07
3. B Q7XHR2 Calmodulin-binding transcription activator CBT 8.22e-02 NA 4.01e-04
3. B Q63ZY3 KN motif and ankyrin repeat domain-containing protein 2 1.05e-02 NA 4.84e-04
3. B Q07DX4 Cortactin-binding protein 2 6.73e-04 NA 1.03e-10
3. B Q9CR42 Ankyrin repeat domain-containing protein 1 6.80e-08 NA 2.61e-13
3. B Q8BTZ5 Ankyrin repeat domain-containing protein 46 1.06e-04 NA 2.07e-10
3. B Q8BLA8 Transient receptor potential cation channel subfamily A member 1 3.55e-09 NA 1.82e-19
3. B Q8H569 Potassium channel AKT3 2.18e-03 NA 1.39e-10
3. B Q5UQ08 Putative ankyrin repeat protein R787 NA NA 1.34e-15
3. B A8VU90 Ankyrin repeat and LEM domain-containing protein 1 6.95e-05 NA 0.006
3. B O73630 Nuclear factor NF-kappa-B p100 subunit 1.50e-04 NA 2.37e-08
3. B A6NI47 Putative POTE ankyrin domain family member M 2.73e-07 NA 3.98e-14
3. B Q5UQV3 Putative ankyrin repeat protein L371 NA NA 1.09e-09
3. B Q6C520 Palmitoyltransferase AKR1 5.89e-07 NA 3.08e-13
3. B Q2QLA2 Cortactin-binding protein 2 9.20e-04 NA 2.53e-11
3. B Q74ZH9 Glycerophosphocholine phosphodiesterase GDE1 2.14e-03 NA 8.10e-06
3. B O75179 Ankyrin repeat domain-containing protein 17 6.82e-05 NA 1.06e-33
3. B Q5UQJ2 Putative ankyrin repeat protein R863 NA NA 4.20e-15
3. B Q86AT8 Stress-activated protein kinase alpha 1.93e-05 NA 7.10e-10
3. B Q9HYV6 Putative ankyrin repeat protein PA3287 5.66e-15 NA 2.52e-09
3. B Q5ZMD2 Ankyrin repeat and MYND domain-containing protein 2 1.40e-03 NA 0.008
3. B Q09YM8 Cortactin-binding protein 2 8.00e-04 NA 1.65e-10
3. B Q9WTK5 Nuclear factor NF-kappa-B p100 subunit 4.26e-05 NA 9.14e-06
3. B Q6GPE5 Protein fem-1 homolog B 2.03e-07 NA 1.69e-10
3. B Q8WXE0 Caskin-2 1.06e-05 NA 3.35e-13
3. B Q69ZR2 E3 ubiquitin-protein ligase HECTD1 2.06e-01 NA 2.01e-07
3. B Q8BXK8 Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 5.37e-02 NA 0.010
3. B Q07E30 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 1.18e-05 NA 4.32e-11
3. B Q4R690 Palmitoyltransferase ZDHHC13 1.17e-07 NA 5.35e-09
3. B P55271 Cyclin-dependent kinase 4 inhibitor B 7.59e-10 NA 2.13e-07
3. B Q5DW34 Histone-lysine N-methyltransferase EHMT1 9.53e-05 NA 1.91e-18
3. B Q86YJ7 Ankyrin repeat domain-containing protein 13B 7.25e-02 NA 2.77e-04
3. B Q80YE7 Death-associated protein kinase 1 8.79e-07 NA 1.03e-25
3. B Q4UMP3 Putative ankyrin repeat protein RF_0314 2.34e-03 NA 1.96e-04
3. B E9PTT0 Palmitoyltransferase ZDHHC17 6.82e-07 NA 3.26e-13
3. B P0DJE3 Alpha-latrotoxin-Lhe1a 3.20e-07 NA 2.40e-20
3. B Q5F259 Ankyrin repeat domain-containing protein 13B 7.85e-02 NA 3.27e-04
3. B Q7Z6K4 Notch-regulated ankyrin repeat-containing protein 4.45e-07 NA 6.60e-05
3. B O00221 NF-kappa-B inhibitor epsilon 3.71e-07 NA 2.72e-06
3. B Q2IBF5 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 3.20e-05 NA 1.12e-10
3. B Q9VSA4 Tonsoku-like protein 1.69e-02 NA 7.67e-11
3. B I1S2J8 Transcription regulator FGM4 3.09e-02 NA 7.80e-08
3. B Q3UYR4 Espin-like protein 1.18e-09 NA 2.46e-19
3. B Q5URA9 Putative ankyrin repeat protein R875 NA NA 1.59e-05
3. B P42772 Cyclin-dependent kinase 4 inhibitor B 1.99e-10 NA 7.24e-08
3. B Q8IWZ3 Ankyrin repeat and KH domain-containing protein 1 9.90e-05 NA 5.46e-32
3. B Q4V890 Protein fem-1 homolog A 1.11e-07 NA 4.21e-11
3. B Q8IVF6 Ankyrin repeat domain-containing protein 18A 1.72e-07 NA 1.80e-13
3. B Q9J5H5 Putative ankyrin repeat protein FPV026 NA NA 7.19e-07
3. B Q9J4Z4 Putative ankyrin repeat protein FPV246 NA NA 1.77e-20
3. B A6NC57 Ankyrin repeat domain-containing protein 62 1.63e-06 NA 1.70e-10
3. B Q4ACU6 SH3 and multiple ankyrin repeat domains protein 3 1.12e-02 NA 4.72e-09
3. B Q29RV0 Cyclin-dependent kinase 4 inhibitor D 1.74e-11 NA 5.82e-09
3. B B0G124 Ankyrin repeat-containing protein DDB_G0279043 1.39e-10 NA 2.88e-08
3. B Q6TNJ1 Krev interaction trapped protein 1 2.72e-02 NA 6.55e-04
3. B Q9XVN3 Apoptotic enhancer 1 protein 1.51e-02 NA 8.10e-04
3. B Q8CGU4 Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 2.00e-01 NA 0.002
3. B Q8C6Y6 Ankyrin repeat and SOCS box protein 14 1.11e-15 NA 4.63e-18
3. B Q5UPJ9 Putative ankyrin repeat protein L122 NA NA 1.80e-20
3. B Q5AL27 Palmitoyltransferase AKR1 6.69e-06 NA 7.65e-07
3. B Q54F46 Homeobox protein Wariai 2.86e-09 NA 4.31e-27
3. B Q108T9 Cortactin-binding protein 2 8.77e-04 NA 4.01e-11
3. B Q9H672 Ankyrin repeat and SOCS box protein 7 6.20e-12 NA 2.33e-18
3. B Q9ET47 Espin 1.63e-10 NA 9.48e-18
3. B Q5ZIJ9 E3 ubiquitin-protein ligase MIB2 9.08e-10 NA 4.56e-26
3. B Q9GKW8 Ankyrin repeat and death domain-containing protein 1A (Fragment) 0.00e+00 NA 4.57e-24
3. B Q05921 2-5A-dependent ribonuclease 2.48e-08 NA 1.98e-21
3. B Q8CG79 Apoptosis-stimulating of p53 protein 2 5.33e-03 NA 3.48e-07
3. B Q9FY74 Calmodulin-binding transcription activator 1 3.49e-02 NA 0.041
3. B Q5UP19 Putative ankyrin repeat protein R864 NA NA 1.83e-06
3. B Q07DV3 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 2.54e-05 NA 7.29e-11
3. B Q99490 Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 1.71e-01 NA 0.002
3. B Q80VM7 Ankyrin repeat domain-containing protein 24 5.29e-06 NA 1.51e-16
3. B Q5UQY9 Putative ankyrin repeat protein R896 NA NA 4.78e-10
3. B P42771 Cyclin-dependent kinase inhibitor 2A 3.84e-08 NA 5.17e-06
3. B Q1RHT6 Putative ankyrin repeat protein RBE_0997 3.97e-10 NA 3.77e-13
3. B Q9LSP8 Calmodulin-binding transcription activator 6 8.89e-02 NA 0.033
3. B Q02979 Glycerophosphocholine phosphodiesterase GDE1 1.29e-03 NA 7.26e-05
3. B Q505D1 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A 4.39e-11 NA 3.83e-39
3. B O90760 Putative ankyrin repeat protein FPV031 NA NA 2.72e-09
3. B Q8IUH4 Palmitoyltransferase ZDHHC13 6.68e-08 NA 1.58e-10
3. B P81069 GA-binding protein subunit beta-2 7.17e-09 NA 1.63e-15
3. B Q54GC8 Acyl-CoA-binding domain-containing protein 6 homolog 4.66e-04 NA 2.69e-06
3. B Q9VUW9 Palmitoyltransferase Hip14 1.09e-06 NA 3.47e-11
3. B Q9UPS8 Ankyrin repeat domain-containing protein 26 5.20e-03 NA 5.01e-08
3. B Q9NXR5 Ankyrin repeat domain-containing protein 10 3.17e-06 NA 5.34e-07
3. B Q96Q27 Ankyrin repeat and SOCS box protein 2 1.62e-14 NA 1.08e-23
3. B Q00420 GA-binding protein subunit beta-1 1.11e-16 NA 1.10e-15
3. B Q6NLQ8 E3 ubiquitin-protein ligase XBAT32 2.45e-06 NA 1.08e-08
3. B Q5UP39 Putative ankyrin repeat protein R873 NA NA 1.40e-16
3. B Q9J508 Putative ankyrin repeat protein FPV227 NA NA 2.85e-08
3. B Q86WC6 Protein phosphatase 1 regulatory subunit 27 2.79e-06 NA 4.65e-07
3. B Q96P47 Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 1.25e-01 NA 2.21e-06
3. B Q1RI12 Putative ankyrin repeat protein RBE_0921 2.44e-10 NA 2.05e-15
3. B Q4UKI1 Putative ankyrin repeat protein RF_1099 9.29e-07 NA 9.40e-05
3. B A4D7T3 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 1.70e-06 NA 3.21e-13
3. B Q8R516 E3 ubiquitin-protein ligase MIB2 1.25e-09 NA 5.71e-17
3. B Q5ZXN6 Phosphocholine transferase AnkX 6.10e-09 NA 1.59e-13
3. B Q8BG95 Protein phosphatase 1 regulatory subunit 12B 2.09e-05 NA 4.95e-11
3. B Q6ZVH7 Espin-like protein 8.67e-10 NA 1.27e-18
3. B Q13418 Integrin-linked protein kinase 6.85e-04 NA 3.70e-09
3. B Q9BE45 NF-kappa-B inhibitor zeta 3.43e-05 NA 2.78e-08
3. B P83757 NF-kappa-B inhibitor cactus NA NA 3.26e-06
3. B Q9Y6H5 Synphilin-1 8.81e-03 NA 0.006
3. B Q9FF09 Phytochrome-interacting ankyrin-repeat protein 1 5.29e-05 NA 8.18e-11
3. B F1REV3 Krev interaction trapped protein 1 3.53e-02 NA 4.27e-05
3. B Q9C0D5 Protein TANC1 2.17e-05 NA 4.31e-23
3. B Q9GKS9 Double zinc ribbon and ankyrin repeat-containing protein 1 2.06e-02 NA 0.025
3. B Q5UNU1 Putative ankyrin repeat protein L675 NA NA 2.64e-07
3. B Q5BKI6 Ankyrin repeat domain-containing protein 1 4.65e-07 NA 4.76e-15
3. B Q9Z1P7 KN motif and ankyrin repeat domain-containing protein 3 7.58e-04 NA 5.46e-05
3. B Q9J516 Putative ankyrin repeat protein FPV219 NA NA 8.43e-15
3. B Q6ZQK5 Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 1.54e-02 NA 7.71e-07
3. B Q07DZ5 Cortactin-binding protein 2 7.27e-04 NA 2.88e-12
3. B Q09YN0 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 4.09e-05 NA 3.92e-11
3. B Q2TXF6 Ankyrin repeat domain-containing protein oryK 4.60e-07 NA 0.006
3. B D3YZU1 SH3 and multiple ankyrin repeat domains protein 1 2.16e-02 NA 2.02e-10
3. B Q02989 Alpha-latroinsectotoxin-Lt1a (Fragment) 7.40e-06 NA 2.13e-20
3. B Q1LVW0 Ankyrin repeat and BTB/POZ domain-containing protein BTBD11-A 1.21e-03 NA 1.48e-05
3. B Q60J38 Ankyrin repeat and KH domain-containing protein CBG24701 6.10e-05 NA 6.69e-24
3. B D3ZD05 KN motif and ankyrin repeat domain-containing protein 2 6.83e-03 NA 0.007
3. B Q8T2Q0 Putative ZDHHC-type palmitoyltransferase 6 5.55e-06 NA 2.24e-11
3. B B2RXR6 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B 1.18e-11 NA 3.40e-42
3. B Q502K3 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C 1.77e-12 NA 3.30e-42
3. B Q66H07 Fibronectin type 3 and ankyrin repeat domains 1 protein 3.77e-15 NA 4.18e-18
3. B Q69YU3 Ankyrin repeat domain-containing protein 34A 4.14e-04 NA 2.86e-07
3. B Q3TPE9 Ankyrin repeat and MYND domain-containing protein 2 1.50e-03 NA 0.003
3. B Q9C104 Glycerophosphocholine phosphodiesterase gde1 7.70e-04 NA 4.13e-04
3. B Q7M6U3 Inactive serine/threonine-protein kinase TEX14 3.54e-01 NA 2.54e-06
3. B Q20500 Intracellular phospholipase A2 7.64e-05 NA 1.84e-05
3. B Q571F8 Glutaminase liver isoform, mitochondrial 2.75e-02 NA 0.008
3. B Q9EP71 Ankycorbin 9.65e-07 NA 7.47e-26
3. B Q9FIT8 ADP-ribosylation factor GTPase-activating protein AGD1 9.95e-02 NA 3.16e-05
3. B Q5PQ89 Ankyrin repeat domain-containing protein 34B 4.83e-04 NA 1.48e-04
3. B Q8HYY4 Uveal autoantigen with coiled-coil domains and ankyrin repeats protein 1.09e-08 NA 1.43e-14
3. B Q2QLB3 Cortactin-binding protein 2 1.36e-03 NA 2.30e-11
3. B Q05753 Ankyrin repeat domain-containing protein, chloroplastic 2.95e-05 NA 2.59e-09
3. B Q09655 G patch domain and ankyrin repeat-containing protein 1 homolog 1.10e-02 NA 3.44e-04
3. B Q6UB99 Ankyrin repeat domain-containing protein 11 6.25e-01 NA 2.11e-13
3. B O22265 Signal recognition particle 43 kDa protein, chloroplastic 1.40e-03 NA 8.98e-04
3. B O55222 Integrin-linked protein kinase 6.09e-04 NA 3.51e-09
3. B Q9J569 Putative ankyrin repeat protein FPV162 NA NA 4.23e-25
3. B Q3SX45 Ankyrin repeat and SOCS box protein 2 7.97e-11 NA 2.05e-26
3. B Q8MJ49 Osteoclast-stimulating factor 1 2.23e-07 NA 4.18e-06
3. B Q08DV6 Ankyrin repeat and SOCS box protein 3 0.00e+00 NA 9.09e-28
3. B Q9SAR5 Ankyrin repeat domain-containing protein 2A 3.07e-04 NA 4.00e-10
3. B Q76K24 Ankyrin repeat domain-containing protein 46 5.38e-05 NA 2.50e-10
3. B Q09103 Eye-specific diacylglycerol kinase 2.08e-01 NA 0.003
3. B Q4V8X4 Acyl-CoA-binding domain-containing protein 6 4.69e-05 NA 4.78e-09
3. B Q9JUF2 Putative ankyrin repeat protein NMA1343 1.83e-02 NA 0.046
3. B Q04721 Neurogenic locus notch homolog protein 2 2.50e-02 NA 3.50e-20
3. B Q09YI1 Cortactin-binding protein 2 1.77e-03 NA 1.11e-13
3. B Q9C7A2 Ankyrin repeat-containing protein ITN1 2.46e-09 NA 3.34e-09
3. B Q3UMT1 Protein phosphatase 1 regulatory subunit 12C 2.14e-06 NA 1.66e-08
3. B O15084 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A 5.16e-12 NA 6.50e-39
3. B Q5NVB9 Palmitoyltransferase ZDHHC13 1.15e-07 NA 1.68e-10
3. B Q7T2B9 Myotrophin 1.39e-11 NA 1.80e-09
3. B P0DST0 Ankyrin repeat protein B4 NA NA 4.18e-07
3. B Q9J4Z5 Putative ankyrin repeat protein FPV245 NA NA 2.62e-17
3. B Q8BTI7 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C 2.22e-16 NA 3.81e-36
3. B Q108U1 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 1.57e-05 NA 4.86e-13
3. B Q9QW30 Neurogenic locus notch homolog protein 2 9.81e-03 NA 4.32e-20
3. B Q6GQX6 Ankyrin repeat and SAM domain-containing protein 6 9.37e-09 NA 7.20e-17
3. B Q9GZV1 Ankyrin repeat domain-containing protein 2 3.67e-07 NA 1.78e-15
3. B Q6P9Z4 Protein fem-1 homolog A 6.79e-08 NA 6.97e-12
3. B Q86U10 60 kDa lysophospholipase 3.56e-04 NA 1.64e-06
3. B Q3SX00 Ankyrin repeat domain-containing protein 46 1.01e-03 NA 6.41e-11
3. B Q2IBB1 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 1.68e-05 NA 1.86e-10
3. B Q60649 Caseinolytic peptidase B protein homolog 7.73e-03 NA 1.97e-10
3. B Q6IVG4 Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 7.33e-04 NA 2.17e-06
3. B Q6NRL1 Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 9.63e-02 NA 5.99e-04
3. B Q59H18 Serine/threonine-protein kinase TNNI3K 1.11e-16 NA 2.03e-22
3. B Q8VHQ3 Protein phosphatase 1 regulatory inhibitor subunit 16B 9.71e-07 NA 2.38e-15
3. B Q9SM23 Acyl-CoA-binding domain-containing protein 1 1.98e-04 NA 3.24e-09
3. B Q3S405 Transcription factor SWI6 4.37e-02 NA 0.037
3. B Q99PE2 Ankyrin repeat family A protein 2 1.12e-07 NA 1.97e-09
3. B Q7ZYG4 Osteoclast-stimulating factor 1 3.73e-07 NA 3.70e-06
3. B Q9BSK4 Protein fem-1 homolog A 3.14e-07 NA 3.38e-11
3. B Q9H9B1 Histone-lysine N-methyltransferase EHMT1 1.78e-06 NA 4.14e-18
3. B Q99ME3 Synphilin-1 4.13e-03 NA 0.002
3. B P35210 Protein SPT23 6.94e-02 NA 5.64e-04
3. B P42773 Cyclin-dependent kinase 4 inhibitor C 4.00e-15 NA 2.22e-08
3. B A0JNU3 60 kDa lysophospholipase 2.58e-04 NA 2.94e-05
3. B Q21209 BRCA1-associated RING domain protein 1 2.44e-02 NA 2.95e-04
3. B Q28BK1 E3 ubiquitin-protein ligase HACE1 1.75e-05 NA 5.15e-20
3. B D4A615 Tonsoku-like protein 5.83e-03 NA 7.87e-15
3. B Q9J5I7 Putative ankyrin repeat protein FPV014 NA NA 5.32e-16
3. B H3BUK9 POTE ankyrin domain family member B2 7.60e-07 NA 3.50e-15
3. B Q9BZF9 Uveal autoantigen with coiled-coil domains and ankyrin repeats 9.73e-05 NA 4.89e-14
3. B Q96KQ4 Apoptosis-stimulating of p53 protein 1 5.18e-03 NA 1.58e-04
3. B Q9DAM9 Fibronectin type 3 and ankyrin repeat domains 1 protein 3.89e-15 NA 8.23e-18
3. B Q8N283 Ankyrin repeat domain-containing protein 35 9.30e-07 NA 1.22e-19
3. B O60733 85/88 kDa calcium-independent phospholipase A2 1.40e-06 NA 1.80e-17
3. B Q8BLB8 Ankyrin repeat domain-containing protein 34C 1.70e-05 NA 0.003
3. B Q9ERK0 Receptor-interacting serine/threonine-protein kinase 4 5.07e-12 NA 1.15e-29
3. B Q810B6 Rabankyrin-5 1.45e-07 NA 4.13e-18
3. B A0A1D8PNZ7 Glycerophosphocholine phosphodiesterase GDE1 4.08e-04 NA 1.27e-07
3. B Q9J517 Putative ankyrin repeat protein FPV218 NA NA 1.55e-12
3. B Q09YJ3 Cortactin-binding protein 2 8.81e-04 NA 7.93e-13
3. B Q12955 Ankyrin-3 NA NA 3.05e-43
3. B Q8VHS5 Ankyrin repeat and SOCS box protein 16 8.76e-13 NA 8.50e-11
3. B Q6TNT2 Ankyrin repeat domain-containing protein 46 4.37e-04 NA 2.42e-11
3. B Q8C0T1 Protein fem-1 homolog A-B 4.18e-07 NA 1.22e-11
3. B A2RUV0 Neurogenic locus notch homolog protein 1 3.74e-02 NA 6.85e-12
3. B Q38998 Potassium channel AKT1 5.06e-04 NA 4.97e-09
3. B Q80TN5 Palmitoyltransferase ZDHHC17 5.65e-06 NA 2.83e-13
3. B Q54LF0 NAD-dependent deacetylase sir2B 3.41e-11 NA 3.86e-15
3. B C9JTQ0 Ankyrin repeat domain-containing protein 63 3.10e-06 NA 1.60e-10
3. B Q7S3M5 Palmitoyltransferase akr1 4.38e-07 NA 2.10e-13
3. B Q3V0J4 Ankyrin repeat domain-containing protein 53 1.79e-03 NA 9.17e-07
3. B Q7Z6G8 Ankyrin repeat and sterile alpha motif domain-containing protein 1B 3.20e-05 NA 3.18e-17
3. B Q9BQI6 SMC5-SMC6 complex localization factor protein 1 8.22e-03 NA 1.67e-05
3. B A1Z7A6 ArfGAP with SH3 domain, ANK repeat and PH domain-containing protein 7.14e-02 NA 0.003
3. B A5PLL1 Ankyrin repeat domain-containing protein 34B 3.62e-04 NA 0.013
3. B Q5R5V4 Integrin-linked protein kinase 9.14e-04 NA 3.64e-09
3. B Q4UKX2 Putative ankyrin repeat protein RF_0950 5.02e-09 NA 1.26e-05
3. B P62775 Myotrophin 1.81e-11 NA 1.40e-06
3. B Q5UPP7 Putative ankyrin repeat protein R760 NA NA 2.63e-06
3. B F1M5M3 Inactive serine/threonine-protein kinase TEX14 NA NA 2.41e-05
3. B Q8GSA7 Calmodulin-binding transcription activator 3 1.96e-01 NA 0.015
3. B Q6ZW76 Ankyrin repeat and SAM domain-containing protein 3 1.50e-04 NA 2.57e-12
3. B Q2IBB4 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 4.65e-06 NA 1.50e-11
3. B Q9BYB0 SH3 and multiple ankyrin repeat domains protein 3 1.56e-02 NA 8.72e-09
3. B Q9TZM3 Leucine-rich repeat serine/threonine-protein kinase 1 3.92e-03 NA 1.81e-08
3. B P31695 Neurogenic locus notch homolog protein 4 2.40e-02 NA 5.06e-15
3. B Q8GXE6 Potassium channel AKT6 8.52e-04 NA 2.85e-13
3. B A0A140LI88 Ankyrin repeat domain-containing protein 31 4.19e-02 NA 4.65e-10
3. B Q9N3Q8 Dauer abnormal formation protein 25 6.91e-04 NA 0.008
3. B Q5E9N5 Caseinolytic peptidase B protein homolog 1.35e-02 NA 2.06e-07
3. B Q09YK4 Cortactin-binding protein 2 8.05e-04 NA 2.74e-11
3. B Q8C8R3 Ankyrin-2 NA NA 3.68e-42
3. B E1C656 E3 ubiquitin-protein ligase HACE1 5.23e-06 NA 1.27e-19
3. B Q6F6B3 Protein TANC1 1.50e-05 NA 1.50e-25
3. B Q86W74 Ankyrin repeat domain-containing protein 46 6.67e-05 NA 6.41e-11
3. B Q07DY6 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 5.65e-06 NA 4.00e-10
3. B Q8N8V4 Ankyrin repeat and SAM domain-containing protein 4B 4.93e-04 NA 4.22e-06
3. B Q7T3Y0 Notch-regulated ankyrin repeat-containing protein A 1.06e-07 NA 1.15e-04
3. B Q6ZPR6 Inhibitor of Bruton tyrosine kinase 1.71e-01 NA 0.003
3. B P40480 Protein HOS4 2.74e-04 NA 5.79e-18
3. B Q9Y574 Ankyrin repeat and SOCS box protein 4 1.27e-11 NA 6.95e-08
3. B Q9UU77 Ankyrin repeat-containing protein P1E11.10 2.55e-05 NA 2.70e-06
3. B Q9H9E1 Ankyrin repeat family A protein 2 1.17e-06 NA 1.40e-09
3. B Q6NXT1 Ankyrin repeat domain-containing protein 54 2.49e-04 NA 6.30e-14
3. B Q55FM5 Myotrophin homolog 1.61e-10 NA 0.002
3. B Q4FE47 Putative E3 ubiquitin-protein ligase XBAT35 1.09e-03 NA 0.002
3. B Q8BIZ1 Ankyrin repeat and sterile alpha motif domain-containing protein 1B 7.65e-06 NA 2.35e-16
3. B Q6AWW5 Ankyrin repeat-containing protein At5g02620 1.66e-09 NA 1.04e-10
3. B Q9QZH2 BRCA1-associated RING domain protein 1 1.44e-02 NA 4.37e-13
3. B Q8TDY4 Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3 1.21e-02 NA 4.31e-04
3. B Q5T7N3 KN motif and ankyrin repeat domain-containing protein 4 2.19e-03 NA 5.19e-04
3. B Q7ZT11 Ankyrin repeat domain-containing protein 1 1.14e-07 NA 1.16e-14
3. B Q07E43 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 1.21e-05 NA 2.66e-10
3. B Q8TC84 Fibronectin type 3 and ankyrin repeat domains protein 1 2.55e-15 NA 1.07e-18
3. B Q54HT1 Protein tirA 4.55e-02 NA 0.037
3. B Q96P50 Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 3 4.52e-02 NA 4.49e-05
3. B Q91ZA8 Notch-regulated ankyrin repeat-containing protein 4.02e-07 NA 6.60e-05
3. B Q9J503 Putative ankyrin repeat protein FPV232 NA NA 8.26e-10
3. B Q99728 BRCA1-associated RING domain protein 1 2.60e-02 NA 6.08e-14
3. B P97570 85/88 kDa calcium-independent phospholipase A2 1.67e-07 NA 4.70e-19
3. B Q6S8J7 POTE ankyrin domain family member A 1.33e-07 NA 1.82e-15
3. B Q3UMR0 Ankyrin repeat domain-containing protein 27 1.57e-08 NA 3.91e-22
3. B Q07008 Neurogenic locus notch homolog protein 1 1.64e-02 NA 4.78e-14
3. B A3AYR1 Acyl-CoA-binding domain-containing protein 4 1.29e-04 NA 5.37e-09
3. B Q9H078 Caseinolytic peptidase B protein homolog 4.28e-02 NA 0.009
3. B Q3T0F7 Myotrophin 2.26e-11 NA 2.90e-06
3. B Q811D2 Ankyrin repeat domain-containing protein 26 2.78e-04 NA 4.78e-10
3. B Q07DY4 Cortactin-binding protein 2 1.19e-03 NA 1.22e-09
3. B Q9VL06 E3 ubiquitin-protein ligase Ufd4 NA NA 2.87e-05
3. B Q9HCD6 Protein TANC2 2.54e-05 NA 1.89e-27
3. B A1X157 Cortactin-binding protein 2 3.97e-03 NA 1.21e-10
3. B Q9D3J5 Ankyrin repeat domain-containing protein 22 4.75e-07 NA 4.74e-07
3. B Q9Z148 Histone-lysine N-methyltransferase EHMT2 8.97e-05 NA 1.18e-20
3. B Q9GL21 Uveal autoantigen with coiled-coil domains and ankyrin repeats 3.38e-04 NA 2.85e-15
3. B Q6S545 POTE ankyrin domain family member H 6.45e-07 NA 2.27e-14
3. B Q1RK13 Putative ankyrin repeat protein RBE_0220 2.32e-09 NA 8.12e-14
3. B Q54XX5 Probable serine/threonine-protein kinase DDB_G0278535 2.69e-05 NA 2.97e-09
3. B Q9CZK6 Ankyrin repeat and SAM domain-containing protein 3 7.34e-06 NA 4.00e-13
3. B Q5UPF8 Putative ankyrin repeat protein L88 NA NA 7.64e-24
3. B Q8TAK5 GA-binding protein subunit beta-2 7.51e-09 NA 5.10e-15
3. B Q99J82 Integrin-linked protein kinase 2.61e-04 NA 3.51e-09
3. B Q2IBF7 Cortactin-binding protein 2 2.14e-04 NA 6.81e-11
3. B Q2QLF8 Cortactin-binding protein 2 1.53e-03 NA 1.14e-10
3. B P18954 Protein PhlB 5.56e-08 NA 2.39e-05
3. B Q71S22 Inversin-A 5.08e-09 NA 9.13e-30
3. B Q1RK83 Putative ankyrin repeat protein RBE_0150 1.48e-09 NA 2.70e-05
3. B Q9BZ19 Ankyrin repeat domain-containing protein 60 1.62e-03 NA 4.24e-06
3. B A0M8T3 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 1.97e-05 NA 7.59e-11
3. B Q5BJT1 Ankyrin repeat domain-containing protein 34A 3.29e-04 NA 2.83e-07
3. B Q4UMH6 Putative ankyrin repeat protein RF_0381 2.31e-09 NA 7.76e-34
3. B P53355 Death-associated protein kinase 1 3.19e-06 NA 8.35e-26
3. B Q804S5 E3 ubiquitin-protein ligase mib1 1.26e-08 NA 6.81e-22
3. B Q8IYU2 E3 ubiquitin-protein ligase HACE1 1.26e-05 NA 1.57e-19
3. B Q875S9 Palmitoyltransferase AKR1 1.41e-05 NA 4.92e-08
3. B A8MXQ7 IQ motif and ankyrin repeat domain-containing protein 1 1.64e-03 NA 0.007
3. B P0CS66 Palmitoyltransferase AKR1 3.49e-05 NA 1.31e-13
3. B Q6B858 Fibronectin type 3 and ankyrin repeat domains protein 1 4.33e-15 NA 1.12e-17
3. B Q8NB46 Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C 8.38e-11 NA 2.79e-36
3. B P21001 Ankyrin repeat protein B4 NA NA 2.62e-10
3. B Q0VCS9 Ankyrin repeat and MYND domain-containing protein 2 1.18e-03 NA 0.007
3. B Q5REW9 Ankyrin repeat domain-containing protein 27 9.93e-09 NA 8.35e-15
3. B Q863Z4 Myotrophin 2.00e-11 NA 2.90e-06
3. B Q6JAN1 Inversin 2.60e-08 NA 8.06e-31
3. B G3V8T1 M-phase phosphoprotein 8 1.46e-03 NA 3.77e-09
3. B F4IS56 Integrin-linked protein kinase 1 1.92e-02 NA 2.48e-09
3. B Q5RJK8 Acyl-CoA-binding domain-containing protein 6 3.56e-04 NA 2.78e-09
3. B D3ZBM7 E3 ubiquitin-protein ligase HACE1 1.47e-05 NA 2.20e-19
3. B Q9J5G9 Putative ankyrin repeat protein FPV034 NA NA 4.91e-18
3. B Q9Y2X7 ARF GTPase-activating protein GIT1 2.48e-01 NA 0.010
3. B Q2QLA4 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 2.21e-05 NA 8.55e-12
3. B P23631 Alpha-latrotoxin-Lt1a 9.39e-08 NA 2.52e-21
3. B Q5U5A6 Notch-regulated ankyrin repeat-containing protein 2.45e-07 NA 1.04e-04
3. B P39010 Palmitoyltransferase AKR1 1.03e-06 NA 1.30e-11
3. B Q8WXD9 Caskin-1 6.74e-05 NA 5.70e-19
3. B Q8R560 Ankyrin repeat domain-containing protein 1 8.33e-08 NA 1.59e-13
3. B Q9FPH0 Putative E3 ubiquitin-protein ligase XBAT34 1.51e-04 NA 3.24e-04
3. B Q9FY48 E3 ubiquitin-protein ligase KEG 2.48e-05 NA 2.63e-16
3. B Q54XY6 Probable serine/threonine-protein kinase DDB_G0278521 9.14e-03 NA 9.13e-09
3. B A0A084B9Z8 Ankyrin repeat domain-containing protein SAT10 9.58e-05 NA 4.13e-10
3. B Q8WZ74 Cortactin-binding protein 2 1.30e-03 NA 6.69e-11
3. B Q3EC11 Probable protein S-acyltransferase 23 6.51e-06 NA 1.20e-14
3. B Q8BLD6 Ankyrin repeat domain-containing protein 55 2.65e-13 NA 1.07e-15
3. B Q5B0V6 Palmitoyltransferase akr1 3.13e-07 NA 4.60e-11
3. B Q6DRG7 Protein phosphatase 1 regulatory subunit 12A 3.30e-04 NA 1.34e-14
3. B Q9VBP3 Poly [ADP-ribose] polymerase tankyrase 9.02e-09 NA 3.89e-30
3. B Q6DCL5 E3 ubiquitin-protein ligase HACE1 4.14e-05 NA 4.73e-20
3. B Q9BR61 Acyl-CoA-binding domain-containing protein 6 2.86e-04 NA 9.70e-09
3. B Q2QL82 Cortactin-binding protein 2 1.06e-03 NA 2.76e-11
3. B Q96NW4 Ankyrin repeat domain-containing protein 27 6.02e-10 NA 1.16e-21
3. B A7E2S9 Putative ankyrin repeat domain-containing protein 30B-like 3.49e-08 NA 1.05e-11
3. B Q8VE42 Ankyrin repeat domain-containing protein 49 3.02e-08 NA 3.30e-11