Summary

E9PRG8

Homolog: Q9BKU8.
Function: Modifier of protein aggregation 4.

Statistics

Total GO Annotation: 23
Unique PROST Go: 23
Unique BLAST Go: 0

Total Homologs: 36
Unique PROST Homologs: 34
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was Q9BKU8 (Modifier of protein aggregation 4) with a FATCAT P-Value: 0.00336 and RMSD of 1.78 angstrom. The sequence alignment identity is 20.8%.
Structural alignment shown in left. Query protein E9PRG8 colored as red in alignment, homolog Q9BKU8 colored as blue. Query protein E9PRG8 is also shown in right top, homolog Q9BKU8 showed in right bottom. They are colored based on secondary structures. 

  E9PRG8 MGAPGGKINRPRTELKKKLFKR--RRVLNRERRLRHRVVGAVIDQGLITRHHLKKR--AS--SARANITLSGKKRRKLLQQIRLAQKEKTAMEVEAPSKP 94
  Q9BKU8 -------------------MTRGNQRDLAREKNQK-----KLADQ--------KKRQGASGQDGNAGLSMDARMNRD-ADVMRIKQ-EKAAAKKEAEAAA 66

  E9PRG8 ARTSEPQLKRQKKTKAPQD-VEMKDLEDES 123
  Q9BKU8 AAANA------KKV-AKVDPLKM------- 82

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0019985 translesion synthesis
2. P GO:0007566 embryo implantation
2. P GO:0016586 RSC-type complex
2. P GO:0045296 cadherin binding
2. P GO:0042273 ribosomal large subunit biogenesis
2. P GO:0005096 GTPase activator activity
2. P GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
2. P GO:0006337 nucleosome disassembly
2. P GO:0016514 SWI/SNF complex
2. P GO:0031011 Ino80 complex
2. P GO:0042254 ribosome biogenesis
2. P GO:0005634 nucleus
2. P GO:0034728 nucleosome organization
2. P GO:0006368 transcription elongation from RNA polymerase II promoter
2. P GO:0007098 centrosome cycle
2. P GO:0009411 response to UV
2. P GO:0006338 chromatin remodeling
2. P GO:0031648 protein destabilization
2. P GO:0022625 cytosolic large ribosomal subunit
2. P GO:0005730 nucleolus
2. P GO:0098556 cytoplasmic side of rough endoplasmic reticulum membrane
2. P GO:0002181 cytoplasmic translation
2. P GO:0022626 cytosolic ribosome

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB E9PRG8 Uncharacterized protein C11orf98 0 2.81e-129 1.65e-83
1. PB Q9D937 Uncharacterized protein C11orf98 homolog 5.40e-09 1.15e-64 1.04e-59
2. P Q9BKU8 Modifier of protein aggregation 4 3.36e-03 2.95e-02 NA
2. P Q8HXB8 60S ribosomal protein L29 8.11e-02 3.57e-04 NA
2. P Q0VG62 Ribosomal biogenesis factor 1.36e-01 1.84e-03 NA
2. P B5FFA9 Der GTPase-activating protein YihI 1.24e-01 1.77e-04 NA
2. P A5F4H7 Der GTPase-activating protein YihI 7.31e-02 3.46e-02 NA
2. P Q9CQX4 PCNA-associated factor 4.49e-01 2.15e-02 NA
2. P Q6LLQ8 Der GTPase-activating protein YihI 8.90e-02 2.09e-03 NA
2. P Q6FL80 Ribosome biogenesis protein ALB1 2.84e-02 7.16e-05 NA
2. P Q12247 rRNA-processing protein FYV7 8.13e-02 4.52e-03 NA
2. P B8Y7Y5 INO80 complex subunit 5 4.23e-02 2.78e-04 NA
2. P Q6BLG4 Ribosome biogenesis protein ALB1 8.14e-02 1.37e-03 NA
2. P A7MTV7 Der GTPase-activating protein YihI 8.20e-02 4.77e-05 NA
2. P C4Y2M6 Regulator of rDNA transcription 14 9.96e-02 1.40e-03 NA
2. P Q7MQ19 Der GTPase-activating protein YihI 9.98e-02 1.22e-02 NA
2. P Q8DDR1 Der GTPase-activating protein YihI 6.32e-02 2.56e-02 NA
2. P B7VHD5 Der GTPase-activating protein YihI 6.07e-02 1.36e-04 NA
2. P Q58DW3 60S ribosomal protein L29 3.19e-02 4.08e-03 NA
2. P B3DFA5 50S ribosomal protein L32 5.55e-02 3.14e-02 NA
2. P Q87TF6 Der GTPase-activating protein YihI 8.44e-02 1.11e-02 NA
2. P Q9UNZ5 Leydig cell tumor 10 kDa protein homolog 2.13e-02 4.56e-08 NA
2. P Q8R1F0 Leydig cell tumor 10 kDa protein homolog 5.41e-02 2.80e-03 NA
2. P Q5REM2 Leydig cell tumor 10 kDa protein homolog 2.30e-02 4.64e-07 NA
2. P Q9KVM7 Der GTPase-activating protein YihI 7.13e-02 3.46e-02 NA
2. P Q755M3 Ribosome biogenesis protein ALB1 3.98e-02 8.79e-08 NA
2. P P47914 60S ribosomal protein L29 3.17e-02 2.06e-04 NA
2. P Q24JV4 UPF0390 protein zgc136864 7.53e-02 5.70e-06 NA
2. P Q08687 Translation machinery-associated protein 16 8.22e-02 1.49e-02 NA
2. P Q5E8S3 Der GTPase-activating protein YihI 7.31e-02 6.35e-04 NA
2. P A7THW2 Ribosome biogenesis protein ALB1 2.81e-02 4.48e-03 NA
2. P Q95281 60S ribosomal protein L29 2.53e-02 3.55e-03 NA
2. P P53330 Regulator of Ty1 transposition protein 102 4.73e-01 3.28e-02 NA
2. P Q6CN59 Ribosome biogenesis protein ALB1 2.25e-02 7.01e-05 NA
2. P Q148I0 Leydig cell tumor 10 kDa protein homolog 6.61e-03 1.84e-06 NA
2. P C3LPV6 Der GTPase-activating protein YihI 5.52e-02 3.46e-02 NA