Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 3. B was
Q96T75
(Down syndrome critical region protein 8) with a FATCAT P-Value: 0.0142 and RMSD of 2.48 angstrom. The sequence alignment identity is 21.4%.
Structural alignment shown in left. Query protein F2Z398 colored as red in alignment, homolog Q96T75 colored as blue.
Query protein F2Z398 is also shown in right top, homolog Q96T75 showed in right bottom. They are colored based on secondary structures.
F2Z398 MTWLDKGVWTQEDENSCSFSESDFPGCRDQINPSIPSIWTAVSGMMISLEVRWWIKGKQGYVISLGHALSPRLECSGTFSAHCILGLPGG---SSYPPAS 97 Q96T75 ------------------MKE---PG---------PNFVTVRKGLH-SFKMA-FVK----HLL-L--FLSPRLECSGSITDHCSLHLPVQEILMSQPPEQ 61 F2Z398 VS-QV-VGTTALYLVEEAWAEAGKMRS------------------ 122 Q96T75 LGLQTNLGN------QES---SGMMKLFMPRPKVLAQYESIQFMP 97
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 3. B | GO:0050687 | negative regulation of defense response to virus |
| 3. B | GO:0045236 | CXCR chemokine receptor binding |
| 3. B | GO:0016538 | cyclin-dependent protein serine/threonine kinase regulator activity |
| 3. B | GO:0043021 | ribonucleoprotein complex binding |
| 3. B | GO:0000307 | cyclin-dependent protein kinase holoenzyme complex |
| 3. B | GO:0070534 | protein K63-linked ubiquitination |
| 3. B | GO:0044389 | ubiquitin-like protein ligase binding |
| 3. B | GO:0031083 | BLOC-1 complex |
| 3. B | GO:0000185 | obsolete activation of MAPKKK activity |
| 3. B | GO:0021549 | cerebellum development |
| 3. B | GO:0046548 | retinal rod cell development |
| 3. B | GO:0004674 | protein serine/threonine kinase activity |
| 3. B | GO:0031870 | thromboxane A2 receptor binding |
| 3. B | GO:0021532 | neural tube patterning |
| 3. B | GO:2001020 | regulation of response to DNA damage stimulus |
| 3. B | GO:0070936 | protein K48-linked ubiquitination |
| 3. B | GO:0021670 | lateral ventricle development |
| 3. B | GO:0051865 | protein autoubiquitination |
| 3. B | GO:0008589 | regulation of smoothened signaling pathway |
| 3. B | GO:2000646 | positive regulation of receptor catabolic process |
| 3. B | GO:0044772 | mitotic cell cycle phase transition |
| 3. B | GO:0021772 | olfactory bulb development |
| 3. B | GO:0032391 | photoreceptor connecting cilium |
| 3. B | GO:0000079 | regulation of cyclin-dependent protein serine/threonine kinase activity |
| 3. B | GO:0005879 | axonemal microtubule |
| 3. B | GO:0001650 | fibrillar center |
| 3. B | GO:0035116 | embryonic hindlimb morphogenesis |
| 3. B | GO:1902036 | regulation of hematopoietic stem cell differentiation |
| 3. B | GO:0001736 | establishment of planar polarity |
| 3. B | GO:0097014 | ciliary plasm |
| 3. B | GO:0090085 | regulation of protein deubiquitination |
| 3. B | GO:0019787 | ubiquitin-like protein transferase activity |
| 3. B | GO:0005813 | centrosome |
| 3. B | GO:0007368 | determination of left/right symmetry |
| 3. B | GO:0006468 | protein phosphorylation |
| 3. B | GO:0046642 | negative regulation of alpha-beta T cell proliferation |
| 3. B | GO:0035115 | embryonic forelimb morphogenesis |
| 3. B | GO:0090102 | cochlea development |
| 3. B | GO:0045744 | negative regulation of G protein-coupled receptor signaling pathway |
| 3. B | GO:0036064 | ciliary basal body |
| 3. B | GO:0008349 | MAP kinase kinase kinase kinase activity |
| 3. B | GO:0007257 | obsolete activation of JUN kinase activity |
| 3. B | GO:0046329 | negative regulation of JNK cascade |
| 3. B | GO:1905515 | non-motile cilium assembly |
| 3. B | GO:0035519 | protein K29-linked ubiquitination |
| 3. B | GO:0045732 | positive regulation of protein catabolic process |
| 3. B | GO:0032480 | negative regulation of type I interferon production |
| 3. B | GO:0043584 | nose development |
| 3. B | GO:1990763 | arrestin family protein binding |
| 3. B | GO:0035253 | ciliary rootlet |
| 3. B | GO:0035869 | ciliary transition zone |
| 3. B | GO:0032088 | negative regulation of NF-kappaB transcription factor activity |
| 3. B | GO:0002669 | positive regulation of T cell anergy |
| 3. B | GO:0022038 | corpus callosum development |
| 3. B | GO:1904628 | cellular response to phorbol 13-acetate 12-myristate |
| 3. B | GO:0001558 | regulation of cell growth |
| 3. B | GO:0007163 | establishment or maintenance of cell polarity |
| 3. B | GO:0070423 | nucleotide-binding oligomerization domain containing signaling pathway |
| 3. B | GO:2000772 | regulation of cellular senescence |
| 3. B | GO:0060039 | pericardium development |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | F2Z398 | LMO7 downstream neighbor protein | 0 | 2.03e-133 | 4.34e-87 |
| 3. B | Q68CZ1 | Protein fantom | 9.44e-01 | NA | 4.23e-05 |
| 3. B | A6NJG6 | Arginine-fifty homeobox | 1.52e-01 | NA | 3.25e-05 |
| 3. B | P51957 | Serine/threonine-protein kinase Nek4 | 8.44e-01 | NA | 1.72e-04 |
| 3. B | Q8IV13 | Cyclin-J-like protein | 4.23e-01 | NA | 0.003 |
| 3. B | Q8N2A0 | Putative uncharacterized protein encoded by LINC00269 | 6.45e-01 | NA | 0.002 |
| 3. B | Q96MD7 | Uncharacterized protein C9orf85 | 4.19e-02 | NA | 0.001 |
| 3. B | A6NIU2 | Putative uncharacterized protein encoded by LINC01549 | 5.29e-02 | NA | 0.002 |
| 3. B | Q8N9N2 | Activating signal cointegrator 1 complex subunit 1 | 6.53e-01 | NA | 4.54e-05 |
| 3. B | Q09FC8 | Zinc finger protein 415 | 7.69e-01 | NA | 3.17e-04 |
| 3. B | Q8TDM0 | Breast carcinoma-amplified sequence 4 | 1.07e-01 | NA | 0.007 |
| 3. B | Q96T75 | Down syndrome critical region protein 8 | 1.42e-02 | NA | 0.008 |
| 3. B | Q5T7P6 | Transmembrane protein 78 | 6.26e-02 | NA | 3.48e-04 |
| 3. B | Q5H9K5 | Zinc finger matrin-type protein 1 | 5.72e-01 | NA | 4.41e-07 |
| 3. B | A0A096LPI5 | Putative uncharacterized protein CCDC28A-AS1 | 8.15e-02 | NA | 7.57e-06 |
| 3. B | Q8WTZ3 | Zinc finger protein ENSP00000375192 | 3.45e-01 | NA | 0.019 |
| 3. B | Q96J02 | E3 ubiquitin-protein ligase Itchy homolog | 9.31e-01 | NA | 0.013 |
| 3. B | Q92918 | Mitogen-activated protein kinase kinase kinase kinase 1 | 9.70e-01 | NA | 5.50e-06 |
| 3. B | Q9BUA6 | Myosin regulatory light chain 10 | 4.11e-01 | NA | 0.005 |