Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 2. P was
P09413
(Gas vesicle protein C) with a FATCAT P-Value: 0.000465 and RMSD of 3.06 angstrom. The sequence alignment identity is 2.8%.
Structural alignment shown in left. Query protein F7VJQ1 colored as red in alignment, homolog P09413 colored as blue.
Query protein F7VJQ1 is also shown in right top, homolog P09413 showed in right bottom. They are colored based on secondary structures.
F7VJQ1 MEHWGQPIPGAGQPWRQPLPTSGRWWLGAASWWWLGAASWWWLGAAPWWWLGTASWWWLGS-----RRWHPQSVEQ--AE-------------------- 73 P09413 ----------------------------------------------------------MISLMAKIRQEH-QSIAEKVAELSLETREFLSVTTAKRQEQA 41 F7VJQ1 ---------------------------------------------------------------------------------------------------- 73 P09413 EKQAQELQAFYKDLQETSQQFLSETAQARIAQAEKQAQELLAFHKELQETSQQFLSATAQARIAQAEKQAQELLAFYQEVRETSQQFLSATAQARIAQAE 141 F7VJQ1 ---------------------------------------------------- 73 P09413 KQAQELLAFHKELQETSQQFLSATADARTAQAKEQKESLLKFRQDLFVSIFG 193
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0005741 | mitochondrial outer membrane |
| 2. P | GO:0008585 | female gonad development |
| 2. P | GO:0005198 | structural molecule activity |
| 2. P | GO:0048471 | perinuclear region of cytoplasm |
| 2. P | GO:0018149 | peptide cross-linking |
| 2. P | GO:0040013 | negative regulation of locomotion |
| 2. P | GO:0005829 | cytosol |
| 2. P | GO:0030216 | keratinocyte differentiation |
| 2. P | GO:0005634 | nucleus |
| 2. P | GO:0030280 | structural constituent of skin epidermis |
| 2. P | GO:0071855 | neuropeptide receptor binding |
| 2. P | GO:0032355 | response to estradiol |
| 2. P | GO:0042151 | nematocyst |
| 2. P | GO:0005882 | intermediate filament |
| 2. P | GO:0008544 | epidermis development |
| 2. P | GO:0033172 | gas vesicle shell |
| 2. P | GO:0005186 | pheromone activity |
| 2. P | GO:0048511 | rhythmic process |
| 2. P | GO:0071944 | cell periphery |
| 2. P | GO:0031424 | keratinization |
| 2. P | GO:0019932 | second-messenger-mediated signaling |
| 2. P | GO:0031412 | gas vesicle organization |
| 2. P | GO:0001533 | cornified envelope |
| 3. B | GO:0016021 | integral component of membrane |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | F7VJQ3 | Alternative prion protein | 5.67e-04 | 3.18e-14 | 2.18e-22 |
| 1. PB | F7VJQ2 | Alternative prion protein | 2.23e-03 | 9.21e-49 | 6.23e-22 |
| 1. PB | F7VJQ1 | Alternative prion protein | 0 | 2.57e-161 | 1.74e-41 |
| 2. P | Q3LI67 | Keratin-associated protein 6-3 | 9.30e-01 | 4.41e-02 | NA |
| 2. P | Q9CQK8 | Small proline-rich protein 2A1 | 7.74e-01 | 1.32e-04 | NA |
| 2. P | P07907 | Rhodotorucin-A peptides type 1 | 9.44e-01 | 6.98e-03 | NA |
| 2. P | A0A286YEX9 | Small cysteine and glycine repeat-containing protein 10 | 7.53e-01 | 2.67e-03 | NA |
| 2. P | P08685 | Uncharacterized 8.4 kDa protein | NA | 3.74e-04 | NA |
| 2. P | Q54BZ8 | UPF0512 protein H | 2.87e-01 | 3.76e-02 | NA |
| 2. P | Q3LI59 | Keratin-associated protein 21-2 | 6.27e-01 | 8.71e-04 | NA |
| 2. P | Q19191 | Uncharacterized protein F08B12.4 | 4.56e-01 | 7.61e-04 | NA |
| 2. P | P19376 | Histone H1, sperm (Fragment) | 8.77e-01 | 3.62e-05 | NA |
| 2. P | P39564 | Uncharacterized protein YAR068W | 4.11e-01 | 1.03e-02 | NA |
| 2. P | P0CL30 | Putative uncharacterized protein YNL339W-A | 1.33e-02 | 1.24e-02 | NA |
| 2. P | Q11116 | Uncharacterized protein C03B1.10 | 5.91e-05 | 3.16e-10 | NA |
| 2. P | P22528 | Cornifin-B | 9.65e-01 | 4.91e-04 | NA |
| 2. P | Q8WNZ0 | Sperm protamine P1 | 1.22e-01 | 1.65e-02 | NA |
| 2. P | P35322 | Cornifin | 8.49e-01 | 4.72e-02 | NA |
| 2. P | Q6JHY2 | Submandibular gland protein C | 6.61e-01 | 1.83e-03 | NA |
| 2. P | Q55FX9 | Putative uncharacterized protein DDB_G0268542 | 9.40e-01 | 1.32e-02 | NA |
| 2. P | Q8WY50 | Placenta-specific protein 4 | 8.98e-01 | 8.75e-05 | NA |
| 2. P | A0A139GI49 | Kawaguchipeptin peptide | 9.12e-01 | 1.50e-03 | NA |
| 2. P | Q8TGM4 | Putative uncharacterized protein YLR286W-A | 9.10e-01 | 5.48e-03 | NA |
| 2. P | P39221 | Protein YabQ | 1.82e-02 | 2.53e-03 | NA |
| 2. P | Q925H6 | Keratin-associated protein 19-3 | 8.67e-01 | 2.84e-05 | NA |
| 2. P | Q62266 | Cornifin-A | 9.86e-01 | 3.50e-02 | NA |
| 2. P | Q26287 | Period circadian protein (Fragment) | 9.43e-01 | 4.29e-03 | NA |
| 2. P | P41722 | Major envelope glycoprotein (Fragment) | NA | 2.40e-03 | NA |
| 2. P | O70555 | Small proline-rich protein 2D | 8.58e-01 | 5.65e-03 | NA |
| 2. P | Q04537 | Period circadian protein (Fragment) | 9.43e-01 | 9.97e-03 | NA |
| 2. P | P84730 | Putative leucine-rich repeat protein PS14 (Fragments) | 4.31e-02 | 4.77e-05 | NA |
| 2. P | P09413 | Gas vesicle protein C | 4.65e-04 | 9.87e-03 | NA |
| 2. P | P20465 | Rhodotorucin-A peptides type 2 | 9.33e-01 | 1.28e-02 | NA |
| 2. P | O70554 | Small proline-rich protein 2B | 8.88e-01 | 4.72e-02 | NA |
| 2. P | P36042 | Putative uncharacterized protein YKL202W | 9.36e-01 | 5.99e-05 | NA |
| 2. P | Q7KWP9 | UPF0512 protein A | 3.23e-01 | 1.69e-02 | NA |
| 2. P | P0CL28 | Putative uncharacterized protein YGR296C-A | 2.36e-02 | 1.24e-02 | NA |
| 2. P | Q63532 | Cornifin-A | 9.83e-01 | 1.31e-02 | NA |
| 2. P | P0CL27 | Putative uncharacterized protein YER190C-A | 4.13e-02 | 1.24e-02 | NA |
| 2. P | C9JFL3 | Proline, histidine and glycine-rich protein 1 | 9.02e-01 | 3.58e-06 | NA |
| 2. P | Q84WP3 | B3 domain-containing protein REM17 | 9.49e-01 | 4.24e-03 | NA |
| 2. P | Q54R01 | Putative uncharacterized protein DDB_G0283527 | 2.62e-04 | 1.18e-02 | NA |
| 2. P | P0CL29 | Putative uncharacterized protein YML133W-A | 1.33e-02 | 1.24e-02 | NA |
| 2. P | P0CL31 | Putative uncharacterized protein YPL283W-A | 1.37e-02 | 1.24e-02 | NA |
| 2. P | Q55D13 | UPF0512 protein F | 1.12e-01 | 3.17e-02 | NA |
| 2. P | P07784 | Small, acid-soluble spore protein gamma-type | 7.05e-03 | 3.81e-03 | NA |
| 2. P | Q8N9U9 | Putative uncharacterized protein SPANXA2-OT1 | 1.39e-01 | 8.90e-13 | NA |
| 2. P | R4ZCU1 | Precursor protein UG | 2.03e-01 | 8.35e-03 | NA |
| 2. P | Q28658 | Small proline-rich protein 3 | 9.88e-01 | 1.13e-02 | NA |
| 2. P | Q1PFS7 | Uncharacterized protein At1g24060 | 5.12e-01 | 2.39e-02 | NA |
| 2. P | Q3LI63 | Keratin-associated protein 20-1 | 8.15e-01 | 4.28e-02 | NA |
| 2. P | G5EEC2 | FMRFamide-like neuropeptides 7 | 7.49e-02 | 3.95e-02 | NA |
| 2. P | Q02400 | Late embryogenesis abundant protein B19.3 | 8.34e-03 | 1.35e-02 | NA |
| 2. P | Q5UP96 | Putative ankyrin repeat protein L14 (Fragment) | NA | 5.73e-07 | NA |
| 2. P | P20466 | Rhodotorucin-A peptides type 3 | 8.59e-01 | 1.01e-02 | NA |
| 2. P | O13534 | Putative uncharacterized protein YHR214W-A | 3.53e-01 | 1.85e-02 | NA |
| 2. P | Q3LHN0 | Keratin-associated protein 25-1 | 8.62e-01 | 4.07e-02 | NA |
| 2. P | Q4KL71 | Small proline-rich protein 2A3 | 8.15e-01 | 1.32e-04 | NA |
| 2. P | Q6GZT0 | Uncharacterized protein 046L | NA | 1.09e-03 | NA |
| 2. P | Q925H2 | Keratin-associated protein 19-1 | 9.00e-01 | 2.18e-04 | NA |
| 2. P | O95177 | Uncharacterized protein GAS8-AS1 | 3.07e-01 | 8.42e-06 | NA |
| 2. P | P35321 | Cornifin-A | 8.26e-01 | 6.29e-04 | NA |
| 2. P | P22532 | Small proline-rich protein 2D | 7.46e-01 | 2.87e-02 | NA |
| 2. P | Q05191 | Late embryogenesis abundant protein B19.4 | 1.90e-02 | 1.40e-03 | NA |
| 2. P | P35323 | Cornifin | 9.53e-01 | 5.59e-03 | NA |