Summary

F7VJQ1

Homolog: P09413.
Function: Gas vesicle protein C.

Statistics

Total GO Annotation: 24
Unique PROST Go: 22
Unique BLAST Go: 1

Total Homologs: 65
Unique PROST Homologs: 62
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was P09413 (Gas vesicle protein C) with a FATCAT P-Value: 0.000465 and RMSD of 3.06 angstrom. The sequence alignment identity is 2.8%.
Structural alignment shown in left. Query protein F7VJQ1 colored as red in alignment, homolog P09413 colored as blue. Query protein F7VJQ1 is also shown in right top, homolog P09413 showed in right bottom. They are colored based on secondary structures. 

  F7VJQ1 MEHWGQPIPGAGQPWRQPLPTSGRWWLGAASWWWLGAASWWWLGAAPWWWLGTASWWWLGS-----RRWHPQSVEQ--AE-------------------- 73
  P09413 ----------------------------------------------------------MISLMAKIRQEH-QSIAEKVAELSLETREFLSVTTAKRQEQA 41

  F7VJQ1 ---------------------------------------------------------------------------------------------------- 73
  P09413 EKQAQELQAFYKDLQETSQQFLSETAQARIAQAEKQAQELLAFHKELQETSQQFLSATAQARIAQAEKQAQELLAFYQEVRETSQQFLSATAQARIAQAE 141

  F7VJQ1 ---------------------------------------------------- 73
  P09413 KQAQELLAFHKELQETSQQFLSATADARTAQAKEQKESLLKFRQDLFVSIFG 193

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0005741 mitochondrial outer membrane
2. P GO:0008585 female gonad development
2. P GO:0005198 structural molecule activity
2. P GO:0048471 perinuclear region of cytoplasm
2. P GO:0018149 peptide cross-linking
2. P GO:0040013 negative regulation of locomotion
2. P GO:0005829 cytosol
2. P GO:0030216 keratinocyte differentiation
2. P GO:0005634 nucleus
2. P GO:0030280 structural constituent of skin epidermis
2. P GO:0071855 neuropeptide receptor binding
2. P GO:0032355 response to estradiol
2. P GO:0042151 nematocyst
2. P GO:0005882 intermediate filament
2. P GO:0008544 epidermis development
2. P GO:0033172 gas vesicle shell
2. P GO:0005186 pheromone activity
2. P GO:0048511 rhythmic process
2. P GO:0071944 cell periphery
2. P GO:0031424 keratinization
2. P GO:0019932 second-messenger-mediated signaling
2. P GO:0031412 gas vesicle organization
2. P GO:0001533 cornified envelope
3. B GO:0016021 integral component of membrane

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB F7VJQ3 Alternative prion protein 5.67e-04 3.18e-14 2.18e-22
1. PB F7VJQ2 Alternative prion protein 2.23e-03 9.21e-49 6.23e-22
1. PB F7VJQ1 Alternative prion protein 0 2.57e-161 1.74e-41
2. P Q3LI67 Keratin-associated protein 6-3 9.30e-01 4.41e-02 NA
2. P Q9CQK8 Small proline-rich protein 2A1 7.74e-01 1.32e-04 NA
2. P P07907 Rhodotorucin-A peptides type 1 9.44e-01 6.98e-03 NA
2. P A0A286YEX9 Small cysteine and glycine repeat-containing protein 10 7.53e-01 2.67e-03 NA
2. P P08685 Uncharacterized 8.4 kDa protein NA 3.74e-04 NA
2. P Q54BZ8 UPF0512 protein H 2.87e-01 3.76e-02 NA
2. P Q3LI59 Keratin-associated protein 21-2 6.27e-01 8.71e-04 NA
2. P Q19191 Uncharacterized protein F08B12.4 4.56e-01 7.61e-04 NA
2. P P19376 Histone H1, sperm (Fragment) 8.77e-01 3.62e-05 NA
2. P P39564 Uncharacterized protein YAR068W 4.11e-01 1.03e-02 NA
2. P P0CL30 Putative uncharacterized protein YNL339W-A 1.33e-02 1.24e-02 NA
2. P Q11116 Uncharacterized protein C03B1.10 5.91e-05 3.16e-10 NA
2. P P22528 Cornifin-B 9.65e-01 4.91e-04 NA
2. P Q8WNZ0 Sperm protamine P1 1.22e-01 1.65e-02 NA
2. P P35322 Cornifin 8.49e-01 4.72e-02 NA
2. P Q6JHY2 Submandibular gland protein C 6.61e-01 1.83e-03 NA
2. P Q55FX9 Putative uncharacterized protein DDB_G0268542 9.40e-01 1.32e-02 NA
2. P Q8WY50 Placenta-specific protein 4 8.98e-01 8.75e-05 NA
2. P A0A139GI49 Kawaguchipeptin peptide 9.12e-01 1.50e-03 NA
2. P Q8TGM4 Putative uncharacterized protein YLR286W-A 9.10e-01 5.48e-03 NA
2. P P39221 Protein YabQ 1.82e-02 2.53e-03 NA
2. P Q925H6 Keratin-associated protein 19-3 8.67e-01 2.84e-05 NA
2. P Q62266 Cornifin-A 9.86e-01 3.50e-02 NA
2. P Q26287 Period circadian protein (Fragment) 9.43e-01 4.29e-03 NA
2. P P41722 Major envelope glycoprotein (Fragment) NA 2.40e-03 NA
2. P O70555 Small proline-rich protein 2D 8.58e-01 5.65e-03 NA
2. P Q04537 Period circadian protein (Fragment) 9.43e-01 9.97e-03 NA
2. P P84730 Putative leucine-rich repeat protein PS14 (Fragments) 4.31e-02 4.77e-05 NA
2. P P09413 Gas vesicle protein C 4.65e-04 9.87e-03 NA
2. P P20465 Rhodotorucin-A peptides type 2 9.33e-01 1.28e-02 NA
2. P O70554 Small proline-rich protein 2B 8.88e-01 4.72e-02 NA
2. P P36042 Putative uncharacterized protein YKL202W 9.36e-01 5.99e-05 NA
2. P Q7KWP9 UPF0512 protein A 3.23e-01 1.69e-02 NA
2. P P0CL28 Putative uncharacterized protein YGR296C-A 2.36e-02 1.24e-02 NA
2. P Q63532 Cornifin-A 9.83e-01 1.31e-02 NA
2. P P0CL27 Putative uncharacterized protein YER190C-A 4.13e-02 1.24e-02 NA
2. P C9JFL3 Proline, histidine and glycine-rich protein 1 9.02e-01 3.58e-06 NA
2. P Q84WP3 B3 domain-containing protein REM17 9.49e-01 4.24e-03 NA
2. P Q54R01 Putative uncharacterized protein DDB_G0283527 2.62e-04 1.18e-02 NA
2. P P0CL29 Putative uncharacterized protein YML133W-A 1.33e-02 1.24e-02 NA
2. P P0CL31 Putative uncharacterized protein YPL283W-A 1.37e-02 1.24e-02 NA
2. P Q55D13 UPF0512 protein F 1.12e-01 3.17e-02 NA
2. P P07784 Small, acid-soluble spore protein gamma-type 7.05e-03 3.81e-03 NA
2. P Q8N9U9 Putative uncharacterized protein SPANXA2-OT1 1.39e-01 8.90e-13 NA
2. P R4ZCU1 Precursor protein UG 2.03e-01 8.35e-03 NA
2. P Q28658 Small proline-rich protein 3 9.88e-01 1.13e-02 NA
2. P Q1PFS7 Uncharacterized protein At1g24060 5.12e-01 2.39e-02 NA
2. P Q3LI63 Keratin-associated protein 20-1 8.15e-01 4.28e-02 NA
2. P G5EEC2 FMRFamide-like neuropeptides 7 7.49e-02 3.95e-02 NA
2. P Q02400 Late embryogenesis abundant protein B19.3 8.34e-03 1.35e-02 NA
2. P Q5UP96 Putative ankyrin repeat protein L14 (Fragment) NA 5.73e-07 NA
2. P P20466 Rhodotorucin-A peptides type 3 8.59e-01 1.01e-02 NA
2. P O13534 Putative uncharacterized protein YHR214W-A 3.53e-01 1.85e-02 NA
2. P Q3LHN0 Keratin-associated protein 25-1 8.62e-01 4.07e-02 NA
2. P Q4KL71 Small proline-rich protein 2A3 8.15e-01 1.32e-04 NA
2. P Q6GZT0 Uncharacterized protein 046L NA 1.09e-03 NA
2. P Q925H2 Keratin-associated protein 19-1 9.00e-01 2.18e-04 NA
2. P O95177 Uncharacterized protein GAS8-AS1 3.07e-01 8.42e-06 NA
2. P P35321 Cornifin-A 8.26e-01 6.29e-04 NA
2. P P22532 Small proline-rich protein 2D 7.46e-01 2.87e-02 NA
2. P Q05191 Late embryogenesis abundant protein B19.4 1.90e-02 1.40e-03 NA
2. P P35323 Cornifin 9.53e-01 5.59e-03 NA