Summary

H0UI37

Homolog: Q8NFU3.
Function: Thiosulfate:glutathione sulfurtransferase.

Statistics

Total GO Annotation: 13
Unique PROST Go: 6
Unique BLAST Go: 7

Total Homologs: 8
Unique PROST Homologs: 2
Unique BLAST Homologs: 5

Structures and Sequence Alignment

The best structural homolog that predicted by 3. B was Q8NFU3 (Thiosulfate:glutathione sulfurtransferase) with a FATCAT P-Value: 9.09e-11 and RMSD of 1.15 angstrom. The sequence alignment identity is 19.4%.
Structural alignment shown in left. Query protein H0UI37 colored as red in alignment, homolog Q8NFU3 colored as blue. Query protein H0UI37 is also shown in right top, homolog Q8NFU3 showed in right bottom. They are colored based on secondary structures. 

  H0UI37 MKIEKCGWSEGLTSIKGNCHNFYTAISKDVTYKELKNLLNSKNIMLIDVREIWEILEYQKIPESINVPLDEVGEALQMNPRDFKEKYNEVKPSKSDS--- 97
  Q8NFU3 -----------------------MAGAPTVSLPELRSLLASGRARLFDVRSREEAAA-GTIPGALNIPVSELESALQMEPAAFQALYSAEKPKLEDEHLV 76

  H0UI37 --------------------------------------- 97
  Q8NFU3 FFCQMGKRGLQATQLARSLGYTGARNYAGAYREWLEKES 115

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0009611 response to wounding
2. P GO:0009579 thylakoid
2. P GO:0009753 response to jasmonic acid
2. P GO:0009507 chloroplast
2. P GO:0007568 aging
2. P GO:0006979 response to oxidative stress
3. B GO:0004792 thiosulfate sulfurtransferase activity
3. B GO:0036464 cytoplasmic ribonucleoprotein granule
3. B GO:0048471 perinuclear region of cytoplasm
3. B GO:0050337 thiosulfate-thiol sulfurtransferase activity
3. B GO:0070221 sulfide oxidation, using sulfide:quinone oxidoreductase
3. B GO:0005739 mitochondrion
3. B GO:0005741 mitochondrial outer membrane

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB H0UI37 Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3 0 1.89e-150 3.30e-67
2. P P27626 Senescence-associated protein DIN1 2.10e-02 4.05e-02 NA
2. P Q38853 Rhodanese-like domain-containing protein 15, chloroplastic 2.30e-02 1.79e-02 NA
3. B P22978 Rhodanese domain-containing protein CG4456 5.30e-09 NA 8.37e-11
3. B Q08742 Thiosulfate sulfurtransferase RDL2, mitochondrial 3.93e-04 NA 1.42e-05
3. B Q12305 Thiosulfate:glutathione sulfurtransferase 1.75e-05 NA 0.012
3. B Q9D0B5 Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3 1.88e-05 NA 2.39e-33
3. B Q8NFU3 Thiosulfate:glutathione sulfurtransferase 9.09e-11 NA 2.09e-07