Results | PROST

Summary

H0YKK7

Homolog: A6NI86.
Function: Golgin subfamily A member 6-like protein 10.

Statistics

Total GO Annotation: 137
Unique PROST Go: 52
Unique BLAST Go: 78

Total Homologs: 77
Unique PROST Homologs: 31
Unique BLAST Homologs: 34

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was A6NI86 (Golgin subfamily A member 6-like protein 10) with a FATCAT P-Value: 6.96e-14 and RMSD of 3.48 angstrom. The sequence alignment identity is 94.7%.
Structural alignment shown in left. Query protein H0YKK7 colored as red in alignment, homolog A6NI86 colored as blue. Query protein H0YKK7 is also shown in right top, homolog A6NI86 showed in right bottom. They are colored based on secondary structures.

  H0YKK7 MWPQPRLPPHPAMSEKTQQGKLAAAKKKLKAYWQRKSPGIPAGANRKKKVNGSSPDTATSGGYHSPGDSATGVYGEGRASSTTLQDLESQYQELAVALDS 100
  A6NI86 MWPQPRLPPHPAMSEKTQQGKLAAAKKKLKAYWQRKSPGIPAGANRKKKVNGSSPDTATSGGYHSPGDSATGIYGEGRASSTTLQDLESQYQELAVALDS 100

  H0YKK7 SSAIISQLTENINSLVRTSKEEKKHEIHLVQKLGRSLFKLKNQTAEPLAPEPPAGPSKVEQLQDETNHLRKELESVGRQLQAEVENNQMLSLLNRRQEER 200
  A6NI86 SSAIISQLTENINSLVRTSKEEKKHEIHLVQKLGRSLFKLKNQTAEPLAPEPPAGPSKVEQLQDETNHLRKELESVGRQLQAEVENNQMLSLLNRRQEER 200

  H0YKK7 LREQEERLHEQEERLHEQEERLCEQEERLREQEERLCEQEERLREQEERLCEQEERLREQEERLCEQEERLREQEERLCEQEERLREQEERLCEQEERLR 300
  A6NI86 LREQEERLHEQEERLHEQEERLCEQEERLREQEERLCEQEERLREQEERLCEQEERLREQEERLCEQEERLR-------EQEERLREQEERLC------- 286

  H0YKK7 EQEERLCEQEERLREQEERLCEQEERLCEQEERLCEQEERLCEQEERLCEQEKLPGQERLLEEVEKLLEQERRQEEQERLLERERLLDEVEELLEQERLR 400
  A6NI86 EQEERLCEQEERLR--------------EQEERLCEQEERLCEQEERLCEQEKLPGQERLLEEVEKLLEQERRQEEQERLLERERLLDEVEELLEQERLR 372

  H0YKK7 QQDERLWQQETLRELERLRELERLRELERMLELGWEALYEQRAEPRSGFEELNNENKSTLQLEQQVKELEKSGGAEEPRGSESAAAARPVPGAPVPQGAW 500
  A6NI86 QQDERLWQQETLRELERLRELERLRELERMLELGWEALYEQRAEPRSGFEELNNENKSTLQLEQQVKELEKSGGAEEPRGSESAAAARPVPGAPVPQGAW 472

  H0YKK7 MCGQAGWTPQEHPGLSGEAVGTGEAAGGAEEAACHSFRAAENRELNITII 550
  A6NI86 MCGQAGWTPQEHPGLSGEAVGTGEAAGGAEEAACHSFRAAENRELNITII 522

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
1. PB	GO:0043524	negative regulation of neuron apoptotic process
1. PB	GO:0032091	negative regulation of protein binding
1. PB	GO:0032580	Golgi cisterna membrane
1. PB	GO:0090307	mitotic spindle assembly
1. PB	GO:0007030	Golgi organization
1. PB	GO:0000137	Golgi cis cisterna
1. PB	GO:0005801	cis-Golgi network
2. P	GO:0018149	peptide cross-linking
2. P	GO:0019215	intermediate filament binding
2. P	GO:0000182	rDNA binding
2. P	GO:2000781	positive regulation of double-strand break repair
2. P	GO:0072089	stem cell proliferation
2. P	GO:0051656	establishment of organelle localization
2. P	GO:0007094	mitotic spindle assembly checkpoint signaling
2. P	GO:0007420	brain development
2. P	GO:0030844	positive regulation of intermediate filament depolymerization
2. P	GO:0030216	keratinocyte differentiation
2. P	GO:0048858	cell projection morphogenesis
2. P	GO:0031639	plasminogen activation
2. P	GO:0044548	S100 protein binding
2. P	GO:1900006	positive regulation of dendrite development
2. P	GO:0008286	insulin receptor signaling pathway
2. P	GO:0007399	nervous system development
2. P	GO:0043086	negative regulation of catalytic activity
2. P	GO:0031424	keratinization
2. P	GO:0106333	subcortical maternal complex
2. P	GO:0040010	positive regulation of growth rate
2. P	GO:0030016	myofibril
2. P	GO:0042790	nucleolar large rRNA transcription by RNA polymerase I
2. P	GO:0031297	replication fork processing
2. P	GO:0018153	isopeptide cross-linking via N6-(L-isoglutamyl)-L-lysine
2. P	GO:2000179	positive regulation of neural precursor cell proliferation
2. P	GO:0001042	RNA polymerase I core binding
2. P	GO:0020003	symbiont-containing vacuole
2. P	GO:0040024	dauer larval development
2. P	GO:0000086	G2/M transition of mitotic cell cycle
2. P	GO:1905168	positive regulation of double-strand break repair via homologous recombination
2. P	GO:0051017	actin filament bundle assembly
2. P	GO:0005813	centrosome
2. P	GO:0006936	muscle contraction
2. P	GO:0110143	magnetosome
2. P	GO:0031730	CCR5 chemokine receptor binding
2. P	GO:0045179	apical cortex
2. P	GO:0010224	response to UV-B
2. P	GO:0040019	positive regulation of embryonic development
2. P	GO:0005882	intermediate filament
2. P	GO:0045159	myosin II binding
2. P	GO:0017022	myosin binding
2. P	GO:0010212	response to ionizing radiation
2. P	GO:0061187	regulation of ribosomal DNA heterochromatin assembly
2. P	GO:0039644	suppression by virus of host NF-kappaB cascade
2. P	GO:0031667	response to nutrient levels
2. P	GO:0050769	positive regulation of neurogenesis
2. P	GO:0009303	rRNA transcription
2. P	GO:1903611	negative regulation of calcium-dependent ATPase activity
2. P	GO:0031076	embryonic camera-type eye development
2. P	GO:0033018	sarcoplasmic reticulum lumen
2. P	GO:0110148	biomineralization
2. P	GO:0001533	cornified envelope
3. B	GO:1990535	neuron projection maintenance
3. B	GO:0050772	positive regulation of axonogenesis
3. B	GO:0005096	GTPase activator activity
3. B	GO:0043198	dendritic shaft
3. B	GO:0060050	positive regulation of protein glycosylation
3. B	GO:0090161	Golgi ribbon formation
3. B	GO:0005874	microtubule
3. B	GO:0150001	primary dendrite
3. B	GO:0016358	dendrite development
3. B	GO:1901588	dendritic microtubule
3. B	GO:0048156	tau protein binding
3. B	GO:1990225	rhoptry neck
3. B	GO:0098880	maintenance of postsynaptic specialization structure
3. B	GO:0050803	regulation of synapse structure or activity
3. B	GO:0045168	cell-cell signaling involved in cell fate commitment
3. B	GO:0072686	mitotic spindle
3. B	GO:0007026	negative regulation of microtubule depolymerization
3. B	GO:0007265	Ras protein signal transduction
3. B	GO:0007409	axonogenesis
3. B	GO:0030134	COPII-coated ER to Golgi transport vesicle
3. B	GO:0006486	protein glycosylation
3. B	GO:0035255	ionotropic glutamate receptor binding
3. B	GO:0002224	toll-like receptor signaling pathway
3. B	GO:0008306	associative learning
3. B	GO:0032435	negative regulation of proteasomal ubiquitin-dependent protein catabolic process
3. B	GO:0000226	microtubule cytoskeleton organization
3. B	GO:0043408	regulation of MAPK cascade
3. B	GO:0008017	microtubule binding
3. B	GO:0043194	axon initial segment
3. B	GO:0007020	microtubule nucleation
3. B	GO:0051645	Golgi localization
3. B	GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport
3. B	GO:0031114	regulation of microtubule depolymerization
3. B	GO:0006997	nucleus organization
3. B	GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane
3. B	GO:0090166	Golgi disassembly
3. B	GO:0007613	memory
3. B	GO:0099642	retrograde axonal protein transport
3. B	GO:0050882	voluntary musculoskeletal movement
3. B	GO:0098978	glutamatergic synapse
3. B	GO:0070050	neuron cellular homeostasis
3. B	GO:0051289	protein homotetramerization
3. B	GO:0044307	dendritic branch
3. B	GO:0017124	SH3 domain binding
3. B	GO:0099641	anterograde axonal protein transport
3. B	GO:0008356	asymmetric cell division
3. B	GO:0010507	negative regulation of autophagy
3. B	GO:0048169	regulation of long-term neuronal synaptic plasticity
3. B	GO:0043113	receptor clustering
3. B	GO:0007098	centrosome cycle
3. B	GO:0019901	protein kinase binding
3. B	GO:0043087	regulation of GTPase activity
3. B	GO:0000922	spindle pole
3. B	GO:0005794	Golgi apparatus
3. B	GO:0043025	neuronal cell body
3. B	GO:1904115	axon cytoplasm
3. B	GO:0044647	host-symbiont bicellular tight junction
3. B	GO:0008542	visual learning
3. B	GO:2000010	positive regulation of protein localization to cell surface
3. B	GO:0005875	microtubule associated complex
3. B	GO:0048167	regulation of synaptic plasticity
3. B	GO:0005652	nuclear lamina
3. B	GO:0090306	meiotic spindle assembly
3. B	GO:0014069	postsynaptic density
3. B	GO:0045202	synapse
3. B	GO:0061676	importin-alpha family protein binding
3. B	GO:0015631	tubulin binding
3. B	GO:1903829	positive regulation of protein localization
3. B	GO:1902817	negative regulation of protein localization to microtubule
3. B	GO:0050208	polysialic-acid O-acetyltransferase activity
3. B	GO:0043655	host extracellular space
3. B	GO:0008093	cytoskeletal anchor activity
3. B	GO:0099092	postsynaptic density, intracellular component
3. B	GO:0019905	syntaxin binding
3. B	GO:0046580	negative regulation of Ras protein signal transduction
3. B	GO:0050771	negative regulation of axonogenesis
3. B	GO:0051225	spindle assembly
3. B	GO:0007389	pattern specification process

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	A6NEF3	Golgin subfamily A member 6-like protein 4	6.78e-12	1.27e-89	8.36e-123
1. PB	H0YKK7	Putative golgin subfamily A member 6-like protein 19	0	1.55e-161	0.0
1. PB	Q9NYA3	Golgin subfamily A member 6A	1.50e-05	5.02e-04	8.78e-40
1. PB	A6NEY3	Putative golgin subfamily A member 6-like protein 3	2.40e-12	6.19e-30	7.12e-125
1. PB	Q8N9W4	Golgin subfamily A member 6-like protein 2	1.00e-06	9.30e-03	2.33e-23
1. PB	H0YM25	Golgin subfamily A member 6-like protein 22	2.29e-06	1.83e-04	2.09e-32
1. PB	A6NI86	Golgin subfamily A member 6-like protein 10	6.96e-14	1.38e-113	0.0
1. PB	A0A1B0GV03	Golgin subfamily A member 6-like protein 7	1.48e-05	4.09e-14	2.74e-24
1. PB	A6NEM1	Golgin subfamily A member 6-like protein 9	4.78e-05	1.50e-34	2.41e-126
1. PB	A6NDN3	Golgin subfamily A member 6B	1.23e-06	7.21e-03	3.85e-39
1. PB	P0CG33	Golgin subfamily A member 6D	1.75e-07	1.50e-03	9.75e-40
1. PB	A6NDK9	Golgin subfamily A member 6C	6.23e-07	1.83e-03	6.10e-40
2. P	Q0II65	Coiled-coil domain-containing protein 70	2.07e-06	1.40e-02	NA
2. P	P24710	Involucrin	9.12e-05	6.72e-05	NA
2. P	Q9CAP9	Filament-like plant protein 1	1.22e-06	1.33e-05	NA
2. P	P24712	Involucrin	4.09e-04	1.27e-03	NA
2. P	Q9QR71	Protein LANA1	NA	4.36e-03	NA
2. P	Q9XVS4	Nucleolar protein dao-5	8.37e-01	3.86e-02	NA
2. P	D3ZVV1	KH domain-containing protein 3	5.26e-01	1.68e-02	NA
2. P	Q2W8Q7	Magnetosome-associated protein MamJ	8.74e-01	3.99e-04	NA
2. P	Q2KI51	Protein phosphatase 1 regulatory subunit 15A	5.84e-01	9.37e-05	NA
2. P	P9WG30	Resuscitation-promoting factor RpfA	7.36e-01	2.49e-03	NA
2. P	Q80YD3	Protein FAM205C	8.37e-03	1.57e-05	NA
2. P	Q66HF9	Leucine-rich repeat flightless-interacting protein 1	6.02e-04	1.75e-03	NA
2. P	Q54L50	Putative uncharacterized protein DDB_G0286901	1.18e-01	2.35e-02	NA
2. P	Q5SP85	Coiled-coil domain-containing protein 85A	1.31e-02	9.11e-03	NA
2. P	P17941	Involucrin	1.36e-02	4.64e-05	NA
2. P	P07476	Involucrin	1.19e-02	7.94e-04	NA
2. P	P21263	Nestin	6.44e-02	3.47e-03	NA
2. P	Q9U0M8	Uncharacterized protein PFA0635c	1.33e-03	3.53e-04	NA
2. P	P49054	Plasminogen-binding group A streptococcal M-like protein PAM (Fragment)	1.05e-10	5.36e-04	NA
2. P	V6F519	Magnetosome-associated protein MamJ	5.25e-01	2.13e-02	NA
2. P	Q95337	Involucrin	7.28e-11	8.94e-04	NA
2. P	P18175	Involucrin	2.90e-07	1.36e-02	NA
2. P	P14591	Involucrin	5.14e-02	4.43e-05	NA
2. P	Q6P5H2	Nestin	1.08e-01	4.05e-02	NA
2. P	Q54G05	Putative leucine-rich repeat-containing protein DDB_G0290503	8.76e-03	1.36e-05	NA
2. P	Q03400	S-antigen protein	9.24e-01	4.21e-02	NA
2. P	Q9JJL0	Testis-specific gene A8 protein	5.90e-01	1.08e-02	NA
2. P	P9WG31	Resuscitation-promoting factor RpfA	9.53e-01	2.49e-03	NA
2. P	P12957	Caldesmon	1.33e-05	2.33e-02	NA
2. P	Q01133	Antho-RFamide neuropeptides	3.22e-01	1.99e-02	NA
2. P	P16230	Sarcoplasmic reticulum histidine-rich calcium-binding protein	9.25e-01	6.49e-11	NA
3. B	I6L899	Golgin subfamily A member 8R	9.87e-08	NA	1.17e-24
3. B	A6NMD2	Golgin subfamily A member 8J	1.44e-06	NA	7.47e-24
3. B	F8WBI6	Golgin subfamily A member 8N	2.08e-07	NA	9.25e-25
3. B	D1FNJ9	CLAVATA3/ESR (CLE)-related protein 4A-1	5.46e-01	NA	0.012
3. B	Q08379	Golgin subfamily A member 2	3.96e-05	NA	1.53e-24
3. B	Q8N7Z2	Golgin subfamily A member 6-like protein 1	1.12e-09	NA	1.61e-20
3. B	Q0DY81	Nuclear matrix constituent protein 1a	1.80e-05	NA	0.006
3. B	H3BV12	Golgin subfamily A member 8Q	1.95e-06	NA	8.30e-25
3. B	F6SEU4	Ras/Rap GTPase-activating protein SynGAP	2.10e-01	NA	9.44e-05
3. B	Q8IDX6	Reticulocyte-binding protein homolog 2a	NA	NA	1.80e-16
3. B	H3BPF8	Golgin subfamily A member 8S	2.08e-07	NA	2.60e-35
3. B	A6NN73	Golgin subfamily A member 8C	6.47e-08	NA	2.53e-22
3. B	A8MQT2	Golgin subfamily A member 8B	9.75e-08	NA	1.98e-15
3. B	Q0D2H9	Putative golgin subfamily A member 8D	2.51e-06	NA	2.57e-07
3. B	D6RF30	Golgin subfamily A member 8K	8.03e-04	NA	7.49e-24
3. B	Q6ZQQ6	WD repeat-containing protein 87	NA	NA	1.60e-09
3. B	P34926	Microtubule-associated protein 1A	NA	NA	0.004
3. B	H3BQL2	Golgin subfamily A member 8T	3.63e-07	NA	7.66e-24
3. B	A6NCC3	Golgin subfamily A member 8O	3.59e-08	NA	8.68e-25
3. B	P78559	Microtubule-associated protein 1A	NA	NA	4.15e-10
3. B	Q8ILR9	Protein PF14_0175	NA	NA	1.00e-07
3. B	A1ADJ6	Polysialic acid O-acetyltransferase	1.68e-06	NA	4.70e-16
3. B	Q62839	Golgin subfamily A member 2	7.89e-06	NA	5.62e-08
3. B	Q96PV0	Ras/Rap GTPase-activating protein SynGAP	2.43e-01	NA	1.04e-04
3. B	Q08AF8	Putative golgin subfamily A member 8F/8G	1.01e-05	NA	9.99e-07
3. B	A8MZA4	Golgin subfamily A member 6-like protein 6	2.97e-08	NA	5.23e-39
3. B	A7E2F4	Golgin subfamily A member 8A	2.97e-06	NA	2.64e-15
3. B	D1FNK0	CLAVATA3/ESR (CLE)-related protein 4A-2	4.65e-01	NA	0.008
3. B	A6NC78	Putative golgin subfamily A member 8I	6.93e-06	NA	1.34e-25
3. B	Q1KXH4	Protein TIC 214	2.36e-01	NA	7.83e-04
3. B	Q921M4	Golgin subfamily A member 2	4.79e-07	NA	4.59e-09
3. B	P0CJ92	Golgin subfamily A member 8H	1.23e-06	NA	3.89e-25
3. B	Q9QUH6	Ras/Rap GTPase-activating protein SynGAP	2.17e-01	NA	0.001
3. B	H3BSY2	Golgin subfamily A member 8M	2.39e-07	NA	1.55e-25