Summary

H0YM25

Homolog: A8MZA4.
Function: Golgin subfamily A member 6-like protein 6.

Statistics

Total GO Annotation: 195
Unique PROST Go: 118
Unique BLAST Go: 73

Total Homologs: 163
Unique PROST Homologs: 129
Unique BLAST Homologs: 25

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was A8MZA4 (Golgin subfamily A member 6-like protein 6) with a FATCAT P-Value: 3.64e-13 and RMSD of 5.87 angstrom. The sequence alignment identity is 77.1%.
Structural alignment shown in left. Query protein H0YM25 colored as red in alignment, homolog A8MZA4 colored as blue. Query protein H0YM25 is also shown in right top, homolog A8MZA4 showed in right bottom. They are colored based on secondary structures. 

  H0YM25 -------------------------------------MMSKETRQSKLAEAKEQLTDHHPQTNPSVGTAASDTKKKKINNGTSPETTTSGGCHSPEDEQK 63
  A8MZA4 MLMWPQPHLPTHPHLPTHPHLPTHPHLPTHPHLPTHPMMSKETRQSKLAEAKEQLTDHHPQTNPSVGTAASDTKKKKINNGTNPETTTSGGCHSPEDEQK 100

  H0YM25 ASHQHQEALRRELEAQVHTIRILTCQKTELQMALYYSQHAVKQLEGEARDLISRLHDSWKFAGELEQALSAVTTQKKKADRYIEELTKERDALSLELYRN 163
  A8MZA4 ASHQHQEALRRELEAQVHTIRILTCQKTELQMALYYSQHAVKQLEGEARDLISRLHDSWKFAGELEQALSAVATQKKKADRYIEELTKERDALSLELYRN 200

  H0YM25 TITDEELKEKNAKLQEKLQLVESEKSEIQLNVKELKRKLERAKLLLP-QQLQAEADHLGKELQSVSAKLQAQVEENELWNRLNQQQEEKMWRQEEKIQEW 262
  A8MZA4 TITDEELKEKNAELQEKLQLVESEKSEIQLNVKELKRKLERAKLLLPQQQLQAEADHLGKELQSVSAKLQAQVEENELWNRLNQQQEEKMWRQEEKIQEW 300

  H0YM25 EEKIQEQEEKIREQEEKIREQ--------------EEKMRRQEEMMWEKEEKMRRQEEMMWEKEEKIRELEEKMHEQEKIREQEEKRQEEEKIREQEKRQ 348
  A8MZA4 EEKIQEQEEKIREQEEKIREQEEKMRRQEEMMWEKEEKMRRQEEMMWEKEEKMRRQEEMMWEKEEKIRELEEKMHEQEKIREQEEKRQEEEKIREQEKRQ 400

  H0YM25 EQEAKMWRQEEKIREQEEKIREQEKKMWRQEEKIHEQEKIREEEKRQEQEEMWRQEEKIREQEEIWRQKEKMHEQEEKIRKQEEKVWRQEEKMHDQEEKI 448
  A8MZA4 EQEAKMWRQEEKIREQEEKIREQEKKMWRQEEKIHEQEKIREEEKRQEQEEMWRQEEKIREQEEIWRQKEKMHEQEEKIRKQEEKVWR-------QEEKI 493

  H0YM25 REQEEKVWRQEEKIREQEKKREQEEKMWRQEEKIREQEEKIREQEEMWREEEKMHEQEKIWEEEKRQEQEDKMWRQEEKIREQEEKVWRQEEKIREQEEK 548
  A8MZA4 REQEEKI-------------REQEEKMWR-------QEEKIREQEEMWREEEKMHEQEKIWEEEKRQEQEDKMWRQEEKIREQEEKVWRQEEKIREQEEK 573

  H0YM25 RQEQEEKMWKQEEKIREQEEKIREQEEKIREQEEKIREQEEMMQEQEEKMGEQEEKMQEQEKMRRQEEKIREQEEKIREQKEKIREQEEKIWEQEEKIRE 648
  A8MZA4 RQEQEEKMWKQEEKIREQEEKIREQEEKIREQEEKIREQEEMTQEQEEKMGEQEEKM----------------------------------CEQEEK--- 636

  H0YM25 QEEMMQEQEEKMGEQEEKIWEQEEKMQEQEEKMRRQEEKIREQEKKIREQEEKIREQEEMMQEQEEKMGEQEEKMQEQEEKMRRQEEKIREQEKKIREQE 748
  A8MZA4 ----MQEQEETM-------W---------------------------------------------------------------RQEEKIREQEKKIREQE 662

  H0YM25 EKIREQEEMMQEQEEKMWEQEEKMCEQEEKMQEQEEKMRRQEEKMWEQEVRLRQQEEKMQEH 810
  A8MZA4 EKIREQEEMMQEQEEKMWEQEEKMCEQEEKMQEQEEKMRRQEEKMWEQEVRLRQQEEKMQEH 724

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0043198 dendritic shaft
1. PB GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific
1. PB GO:0031514 motile cilium
1. PB GO:0020016 ciliary pocket
2. P GO:0030198 extracellular matrix organization
2. P GO:0001227 DNA-binding transcription repressor activity, RNA polymerase II-specific
2. P GO:0097187 dentinogenesis
2. P GO:0005509 calcium ion binding
2. P GO:0005213 structural constituent of egg chorion
2. P GO:0001515 opioid peptide activity
2. P GO:0042307 positive regulation of protein import into nucleus
2. P GO:0043267 negative regulation of potassium ion transport
2. P GO:1900273 positive regulation of long-term synaptic potentiation
2. P GO:0008015 blood circulation
2. P GO:0050775 positive regulation of dendrite morphogenesis
2. P GO:0000122 negative regulation of transcription by RNA polymerase II
2. P GO:0007530 sex determination
2. P GO:0030216 keratinocyte differentiation
2. P GO:0030430 host cell cytoplasm
2. P GO:0070073 clustering of voltage-gated calcium channels
2. P GO:0035254 glutamate receptor binding
2. P GO:0007193 adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
2. P GO:0043619 regulation of transcription from RNA polymerase II promoter in response to oxidative stress
2. P GO:0005201 extracellular matrix structural constituent
2. P GO:0045095 keratin filament
2. P GO:0012511 monolayer-surrounded lipid storage body
2. P GO:0045948 positive regulation of translational initiation
2. P GO:0006325 chromatin organization
2. P GO:0030238 male sex determination
2. P GO:0030446 hyphal cell wall
2. P GO:0045109 intermediate filament organization
2. P GO:0030346 protein phosphatase 2B binding
2. P GO:0043271 negative regulation of ion transport
2. P GO:0034237 protein kinase A regulatory subunit binding
2. P GO:0007306 eggshell chorion assembly
2. P GO:0045163 clustering of voltage-gated potassium channels
2. P GO:0033150 cytoskeletal calyx
2. P GO:0036170 filamentous growth of a population of unicellular organisms in response to starvation
2. P GO:0005576 extracellular region
2. P GO:0043149 stress fiber assembly
2. P GO:0005634 nucleus
2. P GO:0034090 maintenance of meiotic sister chromatid cohesion
2. P GO:0009653 anatomical structure morphogenesis
2. P GO:0031012 extracellular matrix
2. P GO:0070935 3'-UTR-mediated mRNA stabilization
2. P GO:0009530 primary cell wall
2. P GO:0007304 chorion-containing eggshell formation
2. P GO:0050817 coagulation
2. P GO:0010524 positive regulation of calcium ion transport into cytosol
2. P GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding
2. P GO:1900190 regulation of single-species biofilm formation
2. P GO:0070886 positive regulation of calcineurin-NFAT signaling cascade
2. P GO:0042311 vasodilation
2. P GO:0060076 excitatory synapse
2. P GO:0006952 defense response
2. P GO:0099139 cheating during chimeric sorocarp development
2. P GO:0005516 calmodulin binding
2. P GO:0007194 negative regulation of adenylate cyclase activity
2. P GO:0003730 mRNA 3'-UTR binding
2. P GO:0071417 cellular response to organonitrogen compound
2. P GO:1901318 negative regulation of flagellated sperm motility
2. P GO:0001533 cornified envelope
2. P GO:0036394 amylase secretion
2. P GO:0042600 egg chorion
2. P GO:0018149 peptide cross-linking
2. P GO:0003682 chromatin binding
2. P GO:0009898 cytoplasmic side of plasma membrane
2. P GO:0017124 SH3 domain binding
2. P GO:0099149 regulation of postsynaptic neurotransmitter receptor internalization
2. P GO:0042121 alginic acid biosynthetic process
2. P GO:0030154 cell differentiation
2. P GO:0006357 regulation of transcription by RNA polymerase II
2. P GO:0060090 molecular adaptor activity
2. P GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
2. P GO:0034053 modulation by symbiont of host defense-related programmed cell death
2. P GO:0031492 nucleosomal DNA binding
2. P GO:0032590 dendrite membrane
2. P GO:0043113 receptor clustering
2. P GO:0098837 postsynaptic recycling endosome
2. P GO:1905751 positive regulation of endosome to plasma membrane protein transport
2. P GO:0033234 negative regulation of protein sumoylation
2. P GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
2. P GO:0060135 maternal process involved in female pregnancy
2. P GO:0032591 dendritic spine membrane
2. P GO:0007283 spermatogenesis
2. P GO:0009415 response to water
2. P GO:0032279 asymmetric synapse
2. P GO:1901329 regulation of odontoblast differentiation
2. P GO:0031424 keratinization
2. P GO:1903078 positive regulation of protein localization to plasma membrane
2. P GO:0001501 skeletal system development
2. P GO:0031527 filopodium membrane
2. P GO:0021762 substantia nigra development
2. P GO:0071895 odontoblast differentiation
2. P GO:0018153 isopeptide cross-linking via N6-(L-isoglutamyl)-L-lysine
2. P GO:0050811 GABA receptor binding
2. P GO:0010738 regulation of protein kinase A signaling
2. P GO:0008179 adenylate cyclase binding
2. P GO:0039503 suppression by virus of host innate immune response
2. P GO:0019900 kinase binding
2. P GO:0045296 cadherin binding
2. P GO:0001664 G protein-coupled receptor binding
2. P GO:0010628 positive regulation of gene expression
2. P GO:0045762 positive regulation of adenylate cyclase activity
2. P GO:0032991 protein-containing complex
2. P GO:0051092 positive regulation of NF-kappaB transcription factor activity
2. P GO:0008494 translation activator activity
2. P GO:0043624
2. P GO:0006355 regulation of transcription, DNA-templated
2. P GO:0010224 response to UV-B
2. P GO:0036180 filamentous growth of a population of unicellular organisms in response to biotic stimulus
2. P GO:0005856 cytoskeleton
2. P GO:0048660 regulation of smooth muscle cell proliferation
2. P GO:0099092 postsynaptic density, intracellular component
2. P GO:0031698 beta-2 adrenergic receptor binding
2. P GO:0007548 sex differentiation
2. P GO:0097110 scaffold protein binding
2. P GO:1990393 3M complex
2. P GO:0005577 fibrinogen complex
2. P GO:0070307 lens fiber cell development
2. P GO:0003180 aortic valve morphogenesis
2. P GO:0071953 elastic fiber
3. B GO:1990535 neuron projection maintenance
3. B GO:0050772 positive regulation of axonogenesis
3. B GO:0010737 protein kinase A signaling
3. B GO:0060050 positive regulation of protein glycosylation
3. B GO:0090161 Golgi ribbon formation
3. B GO:0005874 microtubule
3. B GO:0150001 primary dendrite
3. B GO:0016358 dendrite development
3. B GO:1901588 dendritic microtubule
3. B GO:0045859 regulation of protein kinase activity
3. B GO:0031674 I band
3. B GO:0006941 striated muscle contraction
3. B GO:0048156 tau protein binding
3. B GO:0008307 structural constituent of muscle
3. B GO:0007076 mitotic chromosome condensation
3. B GO:0072686 mitotic spindle
3. B GO:0030134 COPII-coated ER to Golgi transport vesicle
3. B GO:0051371 muscle alpha-actinin binding
3. B GO:0006486 protein glycosylation
3. B GO:0032091 negative regulation of protein binding
3. B GO:0008306 associative learning
3. B GO:0031430 M band
3. B GO:0055008 cardiac muscle tissue morphogenesis
3. B GO:0007030 Golgi organization
3. B GO:0032435 negative regulation of proteasomal ubiquitin-dependent protein catabolic process
3. B GO:0008017 microtubule binding
3. B GO:0045214 sarcomere organization
3. B GO:0007020 microtubule nucleation
3. B GO:0051645 Golgi localization
3. B GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport
3. B GO:0043194 axon initial segment
3. B GO:0031114 regulation of microtubule depolymerization
3. B GO:0030240 skeletal muscle thin filament assembly
3. B GO:0090307 mitotic spindle assembly
3. B GO:0042805 actinin binding
3. B GO:0033116 endoplasmic reticulum-Golgi intermediate compartment membrane
3. B GO:0003300 cardiac muscle hypertrophy
3. B GO:0090166 Golgi disassembly
3. B GO:0099642 retrograde axonal protein transport
3. B GO:0097493 structural molecule activity conferring elasticity
3. B GO:0050882 voluntary musculoskeletal movement
3. B GO:0031433 telethonin binding
3. B GO:0055013 cardiac muscle cell development
3. B GO:0070050 neuron cellular homeostasis
3. B GO:0051289 protein homotetramerization
3. B GO:0044307 dendritic branch
3. B GO:0099641 anterograde axonal protein transport
3. B GO:0008356 asymmetric cell division
3. B GO:0048769 sarcomerogenesis
3. B GO:0010507 negative regulation of autophagy
3. B GO:0007098 centrosome cycle
3. B GO:0019901 protein kinase binding
3. B GO:0060048 cardiac muscle contraction
3. B GO:0000922 spindle pole
3. B GO:0000794 condensed nuclear chromosome
3. B GO:0005794 Golgi apparatus
3. B GO:0055003 cardiac myofibril assembly
3. B GO:0043025 neuronal cell body
3. B GO:2000010 positive regulation of protein localization to cell surface
3. B GO:0030241 skeletal muscle myosin thick filament assembly
3. B GO:0005865 striated muscle thin filament
3. B GO:0090306 meiotic spindle assembly
3. B GO:0000137 Golgi cis cisterna
3. B GO:0005801 cis-Golgi network
3. B GO:0061676 importin-alpha family protein binding
3. B GO:0035995 detection of muscle stretch
3. B GO:0000139 Golgi membrane
3. B GO:1903829 positive regulation of protein localization
3. B GO:0032580 Golgi cisterna membrane
3. B GO:1902817 negative regulation of protein localization to microtubule
3. B GO:0008093 cytoskeletal anchor activity
3. B GO:0019905 syntaxin binding
3. B GO:0051225 spindle assembly

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB A6NEF3 Golgin subfamily A member 6-like protein 4 8.15e-08 4.67e-05 8.22e-05
1. PB Q8N9W4 Golgin subfamily A member 6-like protein 2 1.80e-02 1.25e-16 7.09e-131
1. PB H0YM25 Golgin subfamily A member 6-like protein 22 0 1.27e-155 0.0
1. PB A6NI86 Golgin subfamily A member 6-like protein 10 6.43e-07 8.81e-04 4.10e-05
1. PB C9ZN16 Flagellar attachment zone protein 1 7.57e-06 1.83e-03 0.005
1. PB Q8N7Z2 Golgin subfamily A member 6-like protein 1 2.15e-12 2.81e-21 0.0
1. PB Q585H6 Flagellar attachment zone protein 1 1.01e-05 7.00e-04 0.002
1. PB A0A1B0GV03 Golgin subfamily A member 6-like protein 7 3.05e-10 3.79e-15 1.67e-107
1. PB A8MZA4 Golgin subfamily A member 6-like protein 6 3.64e-13 1.41e-49 0.0
2. P P18170 Defective chorion-1 protein, FC106 isoform 4.93e-05 2.69e-05 NA
2. P Q5RAM9 Zinc finger protein 664 9.20e-01 4.58e-02 NA
2. P P02895 Glycophorin-binding protein 8.96e-01 1.87e-09 NA
2. P Q4ZJZ1 Protease inhibitor Egf1.5b NA 3.99e-04 NA
2. P Q9PJT6 Uncharacterized protein TC_0741 7.62e-01 2.47e-02 NA
2. P P21850 [D-Ala2]-deltorphins 9.08e-01 1.78e-07 NA
2. P Q5SRN2 Testis-expressed basic protein 1 2.80e-01 4.87e-04 NA
2. P Q8TF32 Zinc finger protein 431 7.16e-01 7.61e-03 NA
2. P Q42626 Oleosin-B3 1.58e-01 2.31e-02 NA
2. P Q90WZ1 Kininogen-1b 9.67e-01 1.08e-02 NA
2. P Q8N4W9 Zinc finger protein 808 9.63e-01 5.15e-04 NA
2. P Q95WA4 Spore wall protein 2 2.25e-02 7.66e-15 NA
2. P Q9H320 Variable charge X-linked protein 1 9.85e-01 3.60e-07 NA
2. P P06680 Acidic proline-rich protein HP43A 8.75e-01 1.97e-02 NA
2. P D3YZV8 Coiled-coil domain-containing protein 8 homolog 9.77e-01 4.28e-02 NA
2. P P17941 Involucrin 3.15e-05 6.35e-04 NA
2. P P07476 Involucrin 1.07e-01 1.91e-02 NA
2. P Q26264 41 kDa spicule matrix protein 9.80e-01 1.22e-03 NA
2. P A6NEY3 Putative golgin subfamily A member 6-like protein 3 1.18e-06 3.79e-09 NA
2. P B3KS81 Serine/arginine repetitive matrix protein 5 9.97e-01 9.20e-04 NA
2. P F4J3S1 SHUGOSHIN 1 8.88e-02 1.17e-02 NA
2. P P82970 High mobility group nucleosome-binding domain-containing protein 5 9.52e-01 2.85e-10 NA
2. P Q27409 Adhesive plaque matrix protein 9.98e-01 1.26e-06 NA
2. P D3YU32 Testis-expressed protein 13C-1 4.20e-02 3.27e-04 NA
2. P Q90W88 Kininogen-1c 9.79e-01 1.99e-02 NA
2. P Q9RBS0 Protein PopA1 1.92e-01 4.31e-04 NA
2. P P24709 Involucrin 3.98e-03 8.60e-06 NA
2. P P12027 Polysialoglycoprotein 9.08e-01 4.93e-04 NA
2. P P12949 Dehydrin DHN4 9.86e-01 8.53e-04 NA
2. P Q28092 Cylicin-2 9.79e-01 9.71e-05 NA
2. P Q6GZS6 Uncharacterized protein 050L NA 1.51e-03 NA
2. P P17025 Zinc finger protein 182 9.75e-01 3.16e-02 NA
2. P P24708 Involucrin 2.63e-02 1.76e-02 NA
2. P P24712 Involucrin 7.43e-04 3.17e-05 NA
2. P Q01033 Uncharacterized gene 48 protein NA 1.80e-09 NA
2. P Q68FX6 Calcium-binding and spermatid-specific protein 1 9.89e-01 9.20e-04 NA
2. P Q6IC83 Uncharacterized protein C22orf42 1.30e-01 1.67e-03 NA
2. P P04474 Acidic proline-rich protein PRP33 9.08e-01 1.58e-02 NA
2. P A0A0J9YY54 Testis-expressed protein 13D 1.15e-01 1.39e-09 NA
2. P Q13117 Deleted in azoospermia protein 2 9.96e-01 5.05e-08 NA
2. P Q9H094 Neuroblastoma breakpoint family member 3 1.47e-02 7.81e-04 NA
2. P Q96SK3 Zinc finger protein 607 7.46e-01 1.18e-02 NA
2. P Q8X482 Secreted effector protein EspF(U) NA 2.44e-07 NA
2. P Q32MZ4 Leucine-rich repeat flightless-interacting protein 1 3.25e-03 4.72e-07 NA
2. P Q14093 Cylicin-2 9.63e-01 1.37e-03 NA
2. P P07898 Aggrecan core protein 9.99e-01 9.60e-05 NA
2. P P24587 A-kinase anchor protein 5 8.28e-01 1.89e-02 NA
2. P P11994 50 kDa spicule matrix protein 9.89e-01 2.17e-03 NA
2. P P15276 Transcriptional regulatory protein AlgP 5.17e-02 2.47e-02 NA
2. P P13813 110 kDa antigen (Fragment) 4.54e-03 3.08e-03 NA
2. P Q28658 Small proline-rich protein 3 9.84e-01 1.05e-03 NA
2. P Q25434 Adhesive plaque matrix protein 9.99e-01 2.04e-03 NA
2. P P23253 Sialidase 9.95e-01 4.09e-03 NA
2. P Q62565 Sex-determining region Y protein 1.44e-02 2.85e-04 NA
2. P A6NN14 Zinc finger protein 729 6.79e-01 1.00e-02 NA
2. P Q5MJ10 Sperm protein associated with the nucleus on the X chromosome N2 5.15e-01 6.50e-07 NA
2. P P05422 Dermorphin-1 8.22e-01 1.41e-05 NA
2. P Q02290 Endo-1,4-beta-xylanase B 9.08e-01 2.16e-04 NA
2. P Q8I6U8 Glycophorin-binding protein 9.28e-01 7.35e-08 NA
2. P C6UYI3 Secreted effector protein EspF(U) 7.52e-01 4.42e-08 NA
2. P Q55EQ3 Uncharacterized abhydrolase domain-containing protein DDB_G0269086 6.68e-03 2.63e-09 NA
2. P H0YKK7 Putative golgin subfamily A member 6-like protein 19 2.12e-06 1.01e-02 NA
2. P Q95J40 Coiled-coil domain-containing protein 7 5.53e-02 4.90e-02 NA
2. P P06599 Extensin 8.48e-01 2.55e-03 NA
2. P P15502 Elastin 9.96e-01 4.63e-02 NA
2. P A0A1B0GUY1 MARCO-like protein 8.63e-01 3.30e-04 NA
2. P Q8IXT5 RNA-binding protein 12B 9.97e-01 4.84e-07 NA
2. P Q96MR9 Zinc finger protein 560 3.54e-01 1.12e-02 NA
2. P Q9Y0X6 BmK-YA precursor 9.91e-01 4.22e-04 NA
2. P Q05738 Sex-determining region Y protein 2.51e-04 1.97e-11 NA
2. P Q96N58 Zinc finger protein 578 5.21e-01 9.72e-03 NA
2. P Q08696 Axoneme-associated protein mst101(2) 1.79e-04 4.55e-06 NA
2. P Q9JL35 High mobility group nucleosome-binding domain-containing protein 5 9.84e-01 2.14e-06 NA
2. P Q62563 Sex-determining region Y protein 1.04e-01 1.64e-06 NA
2. P P26371 Keratin-associated protein 5-9 9.97e-01 1.30e-02 NA
2. P Q9H321 Variable charge X-linked protein 3B 9.64e-01 4.24e-13 NA
2. P Q9Y3M9 Zinc finger protein 337 8.44e-01 3.45e-02 NA
2. P Q5H9T9 Fibrous sheath CABYR-binding protein 8.56e-01 1.02e-04 NA
2. P Q9BYQ7 Keratin-associated protein 4-1 9.96e-01 1.20e-02 NA
2. P P0C8Z4 RNA-binding motif protein, X-linked-like-3 NA 2.83e-03 NA
2. P P37709 Trichohyalin 1.43e-08 4.49e-03 NA
2. P Q8BXA1 Golgi integral membrane protein 4 7.45e-06 4.27e-03 NA
2. P Q04832 DNA-binding protein HEXBP 9.99e-01 2.92e-03 NA
2. P Q60493 Zinc finger protein 664 7.30e-01 3.56e-02 NA
2. P P17038 Zinc finger protein 43 7.32e-01 2.29e-03 NA
2. P A0A0J9YWL9 Putative testis-expressed protein 13C 1.39e-01 1.25e-07 NA
2. P Q2T9N0 Fibrous sheath CABYR-binding protein 7.93e-01 2.99e-03 NA
2. P Q6ZRG5 Putative uncharacterized protein FLJ43944 9.12e-01 1.83e-03 NA
2. P Q4ZJZ3 Protease inhibitor Egf1.5a NA 1.53e-05 NA
2. P Q8N7X1 RNA-binding motif protein, X-linked-like-3 9.98e-01 1.34e-03 NA
2. P P0DJ89 Secreted effector protein EspF(U) 7.47e-01 4.42e-08 NA
2. P B4F777 High mobility group nucleosome-binding domain-containing protein 5 9.84e-01 1.47e-09 NA
2. P Q06002 Filensin 1.08e-05 1.26e-04 NA
2. P Q7T1M3 Bradykinin-potentiating and C-type natriuretic peptides isoform 2 (Fragment) 8.28e-01 2.78e-02 NA
2. P P14591 Involucrin 3.39e-05 2.75e-03 NA
2. P P21733 Uncharacterized 29.1 kDa protein in cryB1 5'region 1.00e+00 4.93e-03 NA
2. P P14606 Cyclic AMP-inducible protein BP74 8.51e-01 1.02e-02 NA
2. P P32072 Glycophorin-binding protein-related antigen 4.89e-01 3.57e-03 NA
2. P Q8N402 Putative uncharacterized protein LOC388882 9.20e-01 5.31e-03 NA
2. P Q54G14 Uncharacterized protein DDB_G0290685 3.10e-02 9.16e-05 NA
2. P Q8N660 Neuroblastoma breakpoint family member 15 1.75e-02 2.81e-07 NA
2. P P0DJ88 Secreted effector protein EspF(U) 6.19e-01 4.42e-08 NA
2. P Q2GIB5 SUMOylated effector protein AmpA 9.91e-01 1.86e-04 NA
2. P P02674 Fibrinogen alpha-1 chain (Fragment) 6.79e-02 8.87e-03 NA
2. P D3YVF0 A-kinase anchor protein 5 8.04e-01 5.90e-05 NA
2. P Q49538 Variant surface antigen F 9.49e-01 2.66e-03 NA
2. P F8W0I5 Nuclear pore complex-interacting protein family member B12 3.93e-01 5.40e-08 NA
2. P Q5TI25 Neuroblastoma breakpoint family member 14 2.90e-01 2.45e-06 NA
2. P Q4A0V8 Uro-adherence factor A 9.70e-01 9.18e-07 NA
2. P Q7M3V1 33kDa venom protein 1.37e-04 3.77e-02 NA
2. P Q9H8G1 Zinc finger protein 430 4.63e-01 2.84e-02 NA
2. P O77733 Semenogelin-1 9.62e-01 2.38e-02 NA
2. P Q66HF9 Leucine-rich repeat flightless-interacting protein 1 1.97e-02 6.90e-10 NA
2. P Q06RB0 30S ribosomal protein S18, chloroplastic 5.52e-03 2.20e-04 NA
2. P P10164 Acidic proline-rich protein PRP25 (Fragment) 9.03e-01 4.01e-03 NA
2. P Q26005 Ring-infected erythrocyte surface antigen (Fragment) 7.61e-05 2.55e-12 NA
2. P P51814 Zinc finger protein 41 7.26e-01 4.00e-02 NA
2. P Q9NZW4 Dentin sialophosphoprotein 9.87e-01 6.01e-03 NA
2. P Q49537 Variant surface antigen E 9.80e-01 1.48e-06 NA
2. P A8MXY4 Zinc finger protein 99 4.65e-01 1.13e-02 NA
2. P P08021 FMRF-amide neuropeptides 9.35e-01 1.85e-03 NA
2. P Q06602 Apidaecins type 73 (Fragment) 8.81e-01 2.50e-04 NA
2. P Q9FKA5 Uncharacterized protein At5g39570 9.68e-01 3.44e-05 NA
2. P Q8N972 Zinc finger protein 709 9.35e-01 1.67e-03 NA
2. P Q59X49 Stress protein DDR48 9.93e-01 3.90e-04 NA
2. P Q54CY3 Putative uncharacterized protein DDB_G0292636 1.08e-01 9.78e-07 NA
2. P Q3UZ39 Leucine-rich repeat flightless-interacting protein 1 9.77e-03 9.61e-09 NA
2. P Q9NR90 Deleted in azoospermia protein 3 9.96e-01 7.70e-06 NA
2. P A6NP11 Zinc finger protein 716 7.18e-01 2.95e-02 NA
3. B Q8WZ42 Titin NA NA 0.009
3. B Q9NYA3 Golgin subfamily A member 6A 2.12e-06 NA 9.07e-21
3. B A6NMD2 Golgin subfamily A member 8J 6.64e-08 NA 2.13e-04
3. B F8WBI6 Golgin subfamily A member 8N 3.03e-08 NA 8.52e-07
3. B Q08379 Golgin subfamily A member 2 2.70e-09 NA 7.38e-37
3. B A6NDN3 Golgin subfamily A member 6B 1.01e-07 NA 1.01e-19
3. B P0CG33 Golgin subfamily A member 6D 2.18e-06 NA 1.73e-19
3. B H3BPF8 Golgin subfamily A member 8S 1.72e-08 NA 9.23e-15
3. B A6NN73 Golgin subfamily A member 8C 1.07e-07 NA 3.15e-14
3. B A8MQT2 Golgin subfamily A member 8B 9.29e-07 NA 2.60e-07
3. B P14699 Membrane antigen containing repeating peptides (Fragment) 5.99e-04 NA 0.013
3. B Q6ZQQ6 WD repeat-containing protein 87 NA NA 6.79e-05
3. B H3BQL2 Golgin subfamily A member 8T 5.65e-09 NA 1.59e-04
3. B Q9UEG4 Zinc finger protein 629 9.71e-01 NA 5.20e-05
3. B A6NCC3 Golgin subfamily A member 8O 1.55e-07 NA 8.17e-07
3. B P78559 Microtubule-associated protein 1A NA NA 5.81e-08
3. B Q62839 Golgin subfamily A member 2 1.79e-09 NA 4.67e-31
3. B A6NEM1 Golgin subfamily A member 6-like protein 9 2.17e-06 NA 2.01e-05
3. B A6NDK9 Golgin subfamily A member 6C 5.00e-06 NA 8.84e-20
3. B A6NC78 Putative golgin subfamily A member 8I 4.30e-08 NA 6.21e-05
3. B Q54G05 Putative leucine-rich repeat-containing protein DDB_G0290503 8.53e-07 NA 0.011
3. B Q921M4 Golgin subfamily A member 2 1.04e-08 NA 2.10e-31
3. B Q6A085 Zinc finger protein 629 9.76e-01 NA 8.02e-05
3. B P0CJ92 Golgin subfamily A member 8H 9.62e-09 NA 0.001
3. B H3BSY2 Golgin subfamily A member 8M 4.95e-07 NA 4.26e-05