Summary

H3BTG2

Homolog: C4Y631.
Function: Respiratory supercomplex factor 1, mitochondrial.

Statistics

Total GO Annotation: 95
Unique PROST Go: 95
Unique BLAST Go: 0

Total Homologs: 143
Unique PROST Homologs: 142
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was C4Y631 (Respiratory supercomplex factor 1, mitochondrial) with a FATCAT P-Value: 4.39e-07 and RMSD of 1.34 angstrom. The sequence alignment identity is 20.2%.
Structural alignment shown in left. Query protein H3BTG2 colored as red in alignment, homolog C4Y631 colored as blue. Query protein H3BTG2 is also shown in right top, homolog C4Y631 showed in right bottom. They are colored based on secondary structures. 

  H3BTG2 M-SLHGI--------LASAGTIGAVAAWLMSYKPAL-----------F----GF-LFLL--LLLSN-WLVKY--EHKLT----LPEPQ--QDEI----LQ 60
  C4Y631 MNTLQKIAYRSKQQPLVPLGTLLTTAAVVLAAK-SLKQGRKKDTQRYFRYRVGFQAFTLVALVIGGMYYQKESAEQKQTREDKLREKAKLREQLWIEELE 99

  H3BTG2 R--LLFSEMKMKVLENQ---MFIIWNKMNHHG-RSSRHRNFPMKK-HRMRRHESICPTLSDCTSSSPS 121
  C4Y631 RRDQLIKARKQRLEESKKELM-----KVAQEGFEQERER--ELKKEDK-------------------- 140

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0005746 mitochondrial respirasome
2. P GO:0044568 secondary cell wall cellulose synthase complex
2. P GO:0006983 ER overload response
2. P GO:2001243 negative regulation of intrinsic apoptotic signaling pathway
2. P GO:0039520 induction by virus of host autophagy
2. P GO:0030433 ubiquitin-dependent ERAD pathway
2. P GO:0019076 viral release from host cell
2. P GO:0005881 cytoplasmic microtubule
2. P GO:1901612 cardiolipin binding
2. P GO:2000652 regulation of secondary cell wall biogenesis
2. P GO:0035458 cellular response to interferon-beta
2. P GO:0045039 protein insertion into mitochondrial inner membrane
2. P GO:0022890 inorganic cation transmembrane transporter activity
2. P GO:0032720 negative regulation of tumor necrosis factor production
2. P GO:0045719 negative regulation of glycogen biosynthetic process
2. P GO:0034362 low-density lipoprotein particle
2. P GO:0030970 retrograde protein transport, ER to cytosol
2. P GO:0044385 integral to membrane of host cell
2. P GO:0043280 positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
2. P GO:0050728 negative regulation of inflammatory response
2. P GO:0036513 Derlin-1 retrotranslocation complex
2. P GO:0034361 very-low-density lipoprotein particle
2. P GO:0031304 intrinsic component of mitochondrial inner membrane
2. P GO:0016531 copper chaperone activity
2. P GO:0039707 pore formation by virus in membrane of host cell
2. P GO:0008137 NADH dehydrogenase (ubiquinone) activity
2. P GO:0015693 magnesium ion transport
2. P GO:0032715 negative regulation of interleukin-6 production
2. P GO:0010952 positive regulation of peptidase activity
2. P GO:0005576 extracellular region
2. P GO:0097190 apoptotic signaling pathway
2. P GO:0050872 white fat cell differentiation
2. P GO:0080164 regulation of nitric oxide metabolic process
2. P GO:0009749 response to glucose
2. P GO:1902600 proton transmembrane transport
2. P GO:0045732 positive regulation of protein catabolic process
2. P GO:0072593 reactive oxygen species metabolic process
2. P GO:0097191 extrinsic apoptotic signaling pathway
2. P GO:0005750 mitochondrial respiratory chain complex III
2. P GO:0072546 EMC complex
2. P GO:0045454 cell redox homeostasis
2. P GO:0010155 regulation of proton transport
2. P GO:0034551 mitochondrial respiratory chain complex III assembly
2. P GO:0042609 CD4 receptor binding
2. P GO:0099616 extrinsic component of matrix side of mitochondrial inner membrane
2. P GO:0003954 NADH dehydrogenase activity
2. P GO:0051259 protein complex oligomerization
2. P GO:0015095 magnesium ion transmembrane transporter activity
2. P GO:0005737 cytoplasm
2. P GO:0006754 ATP biosynthetic process
2. P GO:0005524 ATP binding
2. P GO:0090729 toxin activity
2. P GO:0051775 response to redox state
2. P GO:0005747 mitochondrial respiratory chain complex I
2. P GO:0051771 negative regulation of nitric-oxide synthase biosynthetic process
2. P GO:1990524 INA complex
2. P GO:2000110 negative regulation of macrophage apoptotic process
2. P GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
2. P GO:0071816 tail-anchored membrane protein insertion into ER membrane
2. P GO:0032801 receptor catabolic process
2. P GO:0030308 negative regulation of cell growth
2. P GO:0080143 regulation of amino acid export
2. P GO:0039587 suppression by virus of host tetherin activity
2. P GO:0031966 mitochondrial membrane
2. P GO:0036502 Derlin-1-VIMP complex
2. P GO:0051117 ATPase binding
2. P GO:0005216 ion channel activity
2. P GO:0042407 cristae formation
2. P GO:1905177 tracheary element differentiation
2. P GO:0016021 integral component of membrane
2. P GO:0070300 phosphatidic acid binding
2. P GO:0071300 cellular response to retinoic acid
2. P GO:0020002 host cell plasma membrane
2. P GO:0030968 endoplasmic reticulum unfolded protein response
2. P GO:0039502 suppression by virus of host type I interferon-mediated signaling pathway
2. P GO:0044659 viral release from host cell by cytolysis
2. P GO:0033644 host cell membrane
2. P GO:0005739 mitochondrion
2. P GO:0016209 antioxidant activity
2. P GO:1990381 ubiquitin-specific protease binding
2. P GO:0097250 mitochondrial respirasome assembly
2. P GO:0033617 mitochondrial cytochrome c oxidase assembly
2. P GO:0002865 negative regulation of acute inflammatory response to antigenic stimulus
2. P GO:0031305 integral component of mitochondrial inner membrane
2. P GO:1902236 negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway
2. P GO:0005261 cation channel activity
2. P GO:0030176 integral component of endoplasmic reticulum membrane
2. P GO:0071222 cellular response to lipopolysaccharide
2. P GO:0034599 cellular response to oxidative stress
2. P GO:0044155 host caveola
2. P GO:0005741 mitochondrial outer membrane
2. P GO:0045050 protein insertion into ER membrane by stop-transfer membrane-anchor sequence
2. P GO:0032981 mitochondrial respiratory chain complex I assembly
2. P GO:0055036 virion membrane
2. P GO:0044169 host cell rough endoplasmic reticulum membrane

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB H3BTG2 Testis-expressed protein 46 0 4.31e-143 3.94e-87
2. P P12515 Protein Vpu NA 3.57e-04 NA
2. P Q6SXP0 Bublin coiled-coil protein 8.94e-04 1.02e-03 NA
2. P Q2NKS2 Cytochrome c oxidase assembly protein COX16 homolog, mitochondrial 1.38e-02 1.55e-02 NA
2. P Q5I030 Selenoprotein S NA 6.79e-03 NA
2. P C4Y631 Respiratory supercomplex factor 1, mitochondrial 4.39e-07 2.92e-02 NA
2. P Q1A262 Protein Vpu NA 1.15e-02 NA
2. P O56850 Non-structural glycoprotein 4 NA 2.08e-02 NA
2. P Q0VG18 Small integral membrane protein 24 1.06e-03 6.86e-03 NA
2. P Q0MQ90 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 1.71e-03 9.29e-03 NA
2. P Q9PYD0 Non-structural glycoprotein 4 NA 2.51e-02 NA
2. P P39504 Spanin, inner membrane subunit NA 2.69e-03 NA
2. P O91085 Protein Vpu NA 2.80e-03 NA
2. P F6USH3 Small integral membrane protein 12 5.49e-03 3.21e-05 NA
2. P E2R5I0 Small integral membrane protein 12 1.72e-02 3.99e-06 NA
2. P Q9LSK9 Uncharacterized protein At5g65660 3.64e-02 3.43e-02 NA
2. P Q0CLP4 Respiratory supercomplex factor 1, mitochondrial 1.09e-05 3.36e-02 NA
2. P P20882 Protein Vpu NA 1.67e-02 NA
2. P P0CM84 Cytochrome c oxidase assembly protein COX16, mitochondrial 1.02e-02 5.17e-04 NA
2. P P05919 Protein Vpu NA 8.10e-05 NA
2. P P89061 Non-structural glycoprotein 4 NA 2.56e-02 NA
2. P Q2NL23 Coiled-coil domain-containing protein 107 9.36e-04 2.75e-03 NA
2. P P13881 Matrix protein 2 NA 2.34e-03 NA
2. P Q92JH8 Uncharacterized protein RC0089 8.38e-05 3.59e-02 NA
2. P Q02377 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 1.74e-02 2.95e-02 NA
2. P P03493 Matrix protein 2 NA 5.63e-03 NA
2. P A0A0D9SF12 Transmembrane protein CCDC163 5.41e-05 4.70e-06 NA
2. P O75264 Small integral membrane protein 24 2.23e-05 2.27e-03 NA
2. P P24079 GP16 protein NA 2.59e-03 NA
2. P Q0MQ89 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 1.69e-03 5.32e-05 NA
2. P Q70LD2 Uncharacterized protein ORF94 NA 4.75e-05 NA
2. P Q9BCZ4 Selenoprotein S NA 3.51e-05 NA
2. P D4ACP2 Small integral membrane protein 12 7.65e-03 1.33e-06 NA
2. P O55762 Uncharacterized protein 169L NA 8.59e-03 NA
2. P C5E3S0 Outer spore wall protein 5 2.59e-05 6.66e-04 NA
2. P O70891 Protein Vpu NA 1.50e-02 NA
2. P O75324 Stannin 3.50e-03 1.59e-02 NA
2. P Q9PYD2 Non-structural glycoprotein 4 NA 1.18e-02 NA
2. P Q9YS17 Non-structural glycoprotein 4 NA 5.97e-14 NA
2. P Q8N4V1 ER membrane protein complex subunit 5 8.72e-04 4.74e-02 NA
2. P B3SRQ8 Non-structural glycoprotein 4 NA 4.86e-03 NA
2. P Q7JGX4 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 2.65e-03 2.49e-02 NA
2. P P19554 Protein Vpu NA 8.12e-04 NA
2. P P64499 Uncharacterized protein YebO 8.40e-06 2.89e-04 NA
2. P Q17Q87 Stannin 1.26e-03 3.30e-02 NA
2. P P16208 Glycoprotein NB NA 8.84e-03 NA
2. P P20221 Uncharacterized protein F-92 NA 3.98e-02 NA
2. P P61808 Stannin 1.75e-04 3.01e-02 NA
2. P Q9WAI8 Non-structural glycoprotein 4 NA 4.81e-03 NA
2. P Q2KI76 Selenoprotein S NA 7.25e-05 NA
2. P Q08AY9 Protein FAM89A 1.69e-04 4.58e-03 NA
2. P Q4WP59 Respiratory supercomplex factor 1, mitochondrial 7.30e-05 3.43e-02 NA
2. P P81306 Uncharacterized protein MJ0332.1 6.55e-03 3.56e-02 NA
2. P P69700 Protein Vpu NA 9.34e-05 NA
2. P A9Q1L1 Non-structural glycoprotein 4 NA 3.08e-04 NA
2. P P0CM85 Cytochrome c oxidase assembly protein COX16, mitochondrial 5.09e-03 5.17e-04 NA
2. P G1S9B8 Small integral membrane protein 12 6.00e-03 3.00e-05 NA
2. P A1L2P2 Small integral membrane protein 12-A 1.83e-03 1.36e-03 NA
2. P P18806 Protein Vpu NA 6.66e-04 NA
2. P Q9P0J0 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 1.50e-03 1.67e-03 NA
2. P Q79669 Protein Vpu NA 1.27e-03 NA
2. P P17286 Protein Vpu NA 3.94e-03 NA
2. P Q8VHV8 Selenoprotein S NA 1.52e-03 NA
2. P P08383 Matrix protein 2 NA 4.44e-03 NA
2. P O64224 Gene 30 protein NA 6.07e-05 NA
2. P Q9T1W9 Uncharacterized protein gp25 NA 3.25e-04 NA
2. P B3SRY0 Non-structural glycoprotein 4 NA 4.06e-03 NA
2. P Q68EU0 Selenoprotein S B NA 1.17e-02 NA
2. P Q78RX3 Small integral membrane protein 12 1.04e-02 8.53e-06 NA
2. P Q8BIS8 Coiled-coil domain-containing protein 126 3.46e-05 5.22e-08 NA
2. P Q5RDZ8 Protein BRAWNIN 3.31e-02 2.56e-02 NA
2. P D2H617 Small integral membrane protein 12 8.85e-03 2.16e-05 NA
2. P Q9YJN7 Non-structural glycoprotein 4 NA 2.36e-03 NA
2. P P05923 Protein Vpu NA 5.75e-04 NA
2. P Q3EAV6 Protein GLUTAMINE DUMPER 6 3.02e-02 3.93e-04 NA
2. P P05921 Protein Vpu NA 4.10e-04 NA
2. P Q9ZDQ6 Uncharacterized protein RP269 1.39e-04 4.86e-03 NA
2. P P40576 Inner membrane assembly complex subunit 22 8.46e-04 4.29e-02 NA
2. P Q9UTK1 Cytochrome c oxidase assembly protein cox16, mitochondrial 3.00e-03 6.91e-08 NA
2. P C0HK61 ATP synthase subunit e, mitochondrial 1.17e-04 3.16e-03 NA
2. P P05947 Protein Vpu NA 1.50e-02 NA
2. P P28670 Uncharacterized protein YoxC 1.87e-07 5.26e-03 NA
2. P O92374 Non-structural glycoprotein 4 NA 5.52e-03 NA
2. P F1SR90 Selenoprotein S NA 1.40e-04 NA
2. P P61807 Stannin 1.86e-04 3.01e-02 NA
2. P Q8XCN8 Uncharacterized protein YebO 3.93e-05 4.06e-04 NA
2. P Q9PYD1 Non-structural glycoprotein 4 NA 2.31e-03 NA
2. P Q9ERS2 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 6.47e-04 1.31e-03 NA
2. P P67909 Glycoprotein NB NA 1.16e-02 NA
2. P Q8QL14 Uncharacterized protein 98 NA 2.85e-04 NA
2. P Q70625 Protein Vpu NA 3.43e-03 NA
2. P Q96EE4 Coiled-coil domain-containing protein 126 2.72e-05 4.04e-06 NA
2. P Q0VFV6 Selenoprotein S NA 5.93e-04 NA
2. P Q9BQE4 Selenoprotein S NA 7.87e-04 NA
2. P O15239 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 2.63e-03 3.98e-02 NA
2. P Q8K2T4 Ubiquinol-cytochrome-c reductase complex assembly factor 3 1.36e-04 2.13e-03 NA
2. P G1QDE8 Small integral membrane protein 12 2.31e-03 4.75e-05 NA
2. P Q6UW78 Ubiquinol-cytochrome-c reductase complex assembly factor 3 8.74e-04 1.27e-02 NA
2. P Q0MQ88 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 4.75e-04 2.68e-05 NA
2. P P69699 Protein Vpu NA 9.34e-05 NA
2. P Q82028 Non-structural glycoprotein 4 NA 9.10e-04 NA
2. P Q8R400 Adipogenin 1.27e-03 2.40e-02 NA
2. P Q5BKW8 Small integral membrane protein 12 3.11e-03 3.12e-07 NA
2. P P13058 Protein gop NA 2.50e-05 NA
2. P Q6FW43 Cytochrome c oxidase assembly protein COX16, mitochondrial 1.01e-03 3.33e-02 NA
2. P P51729 Uncharacterized 13.1 kDa protein in lys 3'region NA 3.50e-04 NA
2. P Q95KV7 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 3.55e-05 1.58e-04 NA
2. P P89063 Non-structural glycoprotein 4 NA 1.98e-02 NA
2. P P08803 Protein Vpu NA 2.75e-03 NA
2. P B0Y606 Respiratory supercomplex factor 1, mitochondrial 3.24e-04 3.43e-02 NA
2. P Q57915 Uncharacterized protein MJ0492 2.50e-05 2.06e-02 NA
2. P C6Y4C1 Protein pet117, mitochondrial 1.92e-05 3.18e-02 NA
2. P Q45UF1 Non-structural glycoprotein 4 NA 6.59e-03 NA
2. P P45279 Uncharacterized protein HI_1628 8.26e-05 2.59e-02 NA
2. P A5PJ82 Small integral membrane protein 12 1.78e-03 3.21e-05 NA
2. P Q91E93 Non-structural glycoprotein 4 NA 2.10e-02 NA
2. P Q9DCC3 Coiled-coil domain-containing protein 107 1.18e-04 3.48e-07 NA
2. P Q8SPF0 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 2.72e-03 2.49e-02 NA
2. P P67908 Glycoprotein NB NA 1.16e-02 NA
2. P Q05239 Gene 30 protein NA 1.10e-07 NA
2. P P64500 Uncharacterized protein YebO 5.32e-06 2.89e-04 NA
2. P P34592 Uncharacterized protein ZC21.8 7.58e-03 4.29e-02 NA
2. P Q5QGZ2 Non-structural glycoprotein 4 NA 3.87e-02 NA
2. P P05925 Protein Vpu NA 8.75e-05 NA
2. P Q96EX1 Small integral membrane protein 12 1.14e-02 3.00e-05 NA
2. P P05949 Protein Vpu NA 2.46e-03 NA
2. P Q8MN55 Uncharacterized protein DDB_G0277453 4.44e-04 6.04e-03 NA
2. P A2VE00 Coiled-coil domain-containing protein 126 3.61e-05 2.12e-08 NA
2. P Q6AZH0 Selenoprotein S A NA 4.17e-02 NA
2. P Q573C2 Uncharacterized protein ORF107a NA 6.38e-04 NA
2. P P0C0X4 Matrix protein 2 NA 3.30e-02 NA
2. P Q5UR53 Uncharacterized protein L583 NA 2.03e-06 NA
2. P P0CD94 Ubiquinol-cytochrome-c reductase complex assembly factor 3 1.13e-03 1.66e-05 NA
2. P Q82055 Non-structural glycoprotein 4 NA 5.83e-11 NA
2. P Q8ZFG9 Uncharacterized protein YPO1740/y2567/YP_1481 7.58e-05 2.56e-05 NA
2. P P13882 Matrix protein 2 NA 2.34e-03 NA
2. P Q2NKV5 Transmembrane and coiled-coil domain-containing protein 2 3.59e-05 2.71e-05 NA
2. P Q5RA70 ER membrane protein complex subunit 5 1.52e-03 1.04e-02 NA
2. P Q28EM2 Small integral membrane protein 12 5.00e-03 1.67e-03 NA
2. P Q8GTS2 Basic leucine zipper 23 2.67e-03 3.86e-03 NA
2. P P12516 Protein Vpu NA 4.41e-02 NA
2. P P53903 Processing of GAS1 and ALP protein 2 9.03e-07 8.42e-03 NA
2. P C1PGW0 Protein TRACHEARY ELEMENT DIFFERENTIATION-RELATED 6 1.23e-03 4.97e-02 NA