Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 2. P was
C4Y631
(Respiratory supercomplex factor 1, mitochondrial) with a FATCAT P-Value: 4.39e-07 and RMSD of 1.34 angstrom. The sequence alignment identity is 20.2%.
Structural alignment shown in left. Query protein H3BTG2 colored as red in alignment, homolog C4Y631 colored as blue.
Query protein H3BTG2 is also shown in right top, homolog C4Y631 showed in right bottom. They are colored based on secondary structures.
H3BTG2 M-SLHGI--------LASAGTIGAVAAWLMSYKPAL-----------F----GF-LFLL--LLLSN-WLVKY--EHKLT----LPEPQ--QDEI----LQ 60 C4Y631 MNTLQKIAYRSKQQPLVPLGTLLTTAAVVLAAK-SLKQGRKKDTQRYFRYRVGFQAFTLVALVIGGMYYQKESAEQKQTREDKLREKAKLREQLWIEELE 99 H3BTG2 R--LLFSEMKMKVLENQ---MFIIWNKMNHHG-RSSRHRNFPMKK-HRMRRHESICPTLSDCTSSSPS 121 C4Y631 RRDQLIKARKQRLEESKKELM-----KVAQEGFEQERER--ELKKEDK-------------------- 140
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 2. P | GO:0005746 | mitochondrial respirasome |
| 2. P | GO:0044568 | secondary cell wall cellulose synthase complex |
| 2. P | GO:0006983 | ER overload response |
| 2. P | GO:2001243 | negative regulation of intrinsic apoptotic signaling pathway |
| 2. P | GO:0039520 | induction by virus of host autophagy |
| 2. P | GO:0030433 | ubiquitin-dependent ERAD pathway |
| 2. P | GO:0019076 | viral release from host cell |
| 2. P | GO:0005881 | cytoplasmic microtubule |
| 2. P | GO:1901612 | cardiolipin binding |
| 2. P | GO:2000652 | regulation of secondary cell wall biogenesis |
| 2. P | GO:0035458 | cellular response to interferon-beta |
| 2. P | GO:0045039 | protein insertion into mitochondrial inner membrane |
| 2. P | GO:0022890 | inorganic cation transmembrane transporter activity |
| 2. P | GO:0032720 | negative regulation of tumor necrosis factor production |
| 2. P | GO:0045719 | negative regulation of glycogen biosynthetic process |
| 2. P | GO:0034362 | low-density lipoprotein particle |
| 2. P | GO:0030970 | retrograde protein transport, ER to cytosol |
| 2. P | GO:0044385 | integral to membrane of host cell |
| 2. P | GO:0043280 | positive regulation of cysteine-type endopeptidase activity involved in apoptotic process |
| 2. P | GO:0050728 | negative regulation of inflammatory response |
| 2. P | GO:0036513 | Derlin-1 retrotranslocation complex |
| 2. P | GO:0034361 | very-low-density lipoprotein particle |
| 2. P | GO:0031304 | intrinsic component of mitochondrial inner membrane |
| 2. P | GO:0016531 | copper chaperone activity |
| 2. P | GO:0039707 | pore formation by virus in membrane of host cell |
| 2. P | GO:0008137 | NADH dehydrogenase (ubiquinone) activity |
| 2. P | GO:0015693 | magnesium ion transport |
| 2. P | GO:0032715 | negative regulation of interleukin-6 production |
| 2. P | GO:0010952 | positive regulation of peptidase activity |
| 2. P | GO:0005576 | extracellular region |
| 2. P | GO:0097190 | apoptotic signaling pathway |
| 2. P | GO:0050872 | white fat cell differentiation |
| 2. P | GO:0080164 | regulation of nitric oxide metabolic process |
| 2. P | GO:0009749 | response to glucose |
| 2. P | GO:1902600 | proton transmembrane transport |
| 2. P | GO:0045732 | positive regulation of protein catabolic process |
| 2. P | GO:0072593 | reactive oxygen species metabolic process |
| 2. P | GO:0097191 | extrinsic apoptotic signaling pathway |
| 2. P | GO:0005750 | mitochondrial respiratory chain complex III |
| 2. P | GO:0072546 | EMC complex |
| 2. P | GO:0045454 | cell redox homeostasis |
| 2. P | GO:0010155 | regulation of proton transport |
| 2. P | GO:0034551 | mitochondrial respiratory chain complex III assembly |
| 2. P | GO:0042609 | CD4 receptor binding |
| 2. P | GO:0099616 | extrinsic component of matrix side of mitochondrial inner membrane |
| 2. P | GO:0003954 | NADH dehydrogenase activity |
| 2. P | GO:0051259 | protein complex oligomerization |
| 2. P | GO:0015095 | magnesium ion transmembrane transporter activity |
| 2. P | GO:0005737 | cytoplasm |
| 2. P | GO:0006754 | ATP biosynthetic process |
| 2. P | GO:0005524 | ATP binding |
| 2. P | GO:0090729 | toxin activity |
| 2. P | GO:0051775 | response to redox state |
| 2. P | GO:0005747 | mitochondrial respiratory chain complex I |
| 2. P | GO:0051771 | negative regulation of nitric-oxide synthase biosynthetic process |
| 2. P | GO:1990524 | INA complex |
| 2. P | GO:2000110 | negative regulation of macrophage apoptotic process |
| 2. P | GO:0006122 | mitochondrial electron transport, ubiquinol to cytochrome c |
| 2. P | GO:0071816 | tail-anchored membrane protein insertion into ER membrane |
| 2. P | GO:0032801 | receptor catabolic process |
| 2. P | GO:0030308 | negative regulation of cell growth |
| 2. P | GO:0080143 | regulation of amino acid export |
| 2. P | GO:0039587 | suppression by virus of host tetherin activity |
| 2. P | GO:0031966 | mitochondrial membrane |
| 2. P | GO:0036502 | Derlin-1-VIMP complex |
| 2. P | GO:0051117 | ATPase binding |
| 2. P | GO:0005216 | ion channel activity |
| 2. P | GO:0042407 | cristae formation |
| 2. P | GO:1905177 | tracheary element differentiation |
| 2. P | GO:0016021 | integral component of membrane |
| 2. P | GO:0070300 | phosphatidic acid binding |
| 2. P | GO:0071300 | cellular response to retinoic acid |
| 2. P | GO:0020002 | host cell plasma membrane |
| 2. P | GO:0030968 | endoplasmic reticulum unfolded protein response |
| 2. P | GO:0039502 | suppression by virus of host type I interferon-mediated signaling pathway |
| 2. P | GO:0044659 | viral release from host cell by cytolysis |
| 2. P | GO:0033644 | host cell membrane |
| 2. P | GO:0005739 | mitochondrion |
| 2. P | GO:0016209 | antioxidant activity |
| 2. P | GO:1990381 | ubiquitin-specific protease binding |
| 2. P | GO:0097250 | mitochondrial respirasome assembly |
| 2. P | GO:0033617 | mitochondrial cytochrome c oxidase assembly |
| 2. P | GO:0002865 | negative regulation of acute inflammatory response to antigenic stimulus |
| 2. P | GO:0031305 | integral component of mitochondrial inner membrane |
| 2. P | GO:1902236 | negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway |
| 2. P | GO:0005261 | cation channel activity |
| 2. P | GO:0030176 | integral component of endoplasmic reticulum membrane |
| 2. P | GO:0071222 | cellular response to lipopolysaccharide |
| 2. P | GO:0034599 | cellular response to oxidative stress |
| 2. P | GO:0044155 | host caveola |
| 2. P | GO:0005741 | mitochondrial outer membrane |
| 2. P | GO:0045050 | protein insertion into ER membrane by stop-transfer membrane-anchor sequence |
| 2. P | GO:0032981 | mitochondrial respiratory chain complex I assembly |
| 2. P | GO:0055036 | virion membrane |
| 2. P | GO:0044169 | host cell rough endoplasmic reticulum membrane |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | H3BTG2 | Testis-expressed protein 46 | 0 | 4.31e-143 | 3.94e-87 |
| 2. P | P12515 | Protein Vpu | NA | 3.57e-04 | NA |
| 2. P | Q6SXP0 | Bublin coiled-coil protein | 8.94e-04 | 1.02e-03 | NA |
| 2. P | Q2NKS2 | Cytochrome c oxidase assembly protein COX16 homolog, mitochondrial | 1.38e-02 | 1.55e-02 | NA |
| 2. P | Q5I030 | Selenoprotein S | NA | 6.79e-03 | NA |
| 2. P | C4Y631 | Respiratory supercomplex factor 1, mitochondrial | 4.39e-07 | 2.92e-02 | NA |
| 2. P | Q1A262 | Protein Vpu | NA | 1.15e-02 | NA |
| 2. P | O56850 | Non-structural glycoprotein 4 | NA | 2.08e-02 | NA |
| 2. P | Q0VG18 | Small integral membrane protein 24 | 1.06e-03 | 6.86e-03 | NA |
| 2. P | Q0MQ90 | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 | 1.71e-03 | 9.29e-03 | NA |
| 2. P | Q9PYD0 | Non-structural glycoprotein 4 | NA | 2.51e-02 | NA |
| 2. P | P39504 | Spanin, inner membrane subunit | NA | 2.69e-03 | NA |
| 2. P | O91085 | Protein Vpu | NA | 2.80e-03 | NA |
| 2. P | F6USH3 | Small integral membrane protein 12 | 5.49e-03 | 3.21e-05 | NA |
| 2. P | E2R5I0 | Small integral membrane protein 12 | 1.72e-02 | 3.99e-06 | NA |
| 2. P | Q9LSK9 | Uncharacterized protein At5g65660 | 3.64e-02 | 3.43e-02 | NA |
| 2. P | Q0CLP4 | Respiratory supercomplex factor 1, mitochondrial | 1.09e-05 | 3.36e-02 | NA |
| 2. P | P20882 | Protein Vpu | NA | 1.67e-02 | NA |
| 2. P | P0CM84 | Cytochrome c oxidase assembly protein COX16, mitochondrial | 1.02e-02 | 5.17e-04 | NA |
| 2. P | P05919 | Protein Vpu | NA | 8.10e-05 | NA |
| 2. P | P89061 | Non-structural glycoprotein 4 | NA | 2.56e-02 | NA |
| 2. P | Q2NL23 | Coiled-coil domain-containing protein 107 | 9.36e-04 | 2.75e-03 | NA |
| 2. P | P13881 | Matrix protein 2 | NA | 2.34e-03 | NA |
| 2. P | Q92JH8 | Uncharacterized protein RC0089 | 8.38e-05 | 3.59e-02 | NA |
| 2. P | Q02377 | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 | 1.74e-02 | 2.95e-02 | NA |
| 2. P | P03493 | Matrix protein 2 | NA | 5.63e-03 | NA |
| 2. P | A0A0D9SF12 | Transmembrane protein CCDC163 | 5.41e-05 | 4.70e-06 | NA |
| 2. P | O75264 | Small integral membrane protein 24 | 2.23e-05 | 2.27e-03 | NA |
| 2. P | P24079 | GP16 protein | NA | 2.59e-03 | NA |
| 2. P | Q0MQ89 | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 | 1.69e-03 | 5.32e-05 | NA |
| 2. P | Q70LD2 | Uncharacterized protein ORF94 | NA | 4.75e-05 | NA |
| 2. P | Q9BCZ4 | Selenoprotein S | NA | 3.51e-05 | NA |
| 2. P | D4ACP2 | Small integral membrane protein 12 | 7.65e-03 | 1.33e-06 | NA |
| 2. P | O55762 | Uncharacterized protein 169L | NA | 8.59e-03 | NA |
| 2. P | C5E3S0 | Outer spore wall protein 5 | 2.59e-05 | 6.66e-04 | NA |
| 2. P | O70891 | Protein Vpu | NA | 1.50e-02 | NA |
| 2. P | O75324 | Stannin | 3.50e-03 | 1.59e-02 | NA |
| 2. P | Q9PYD2 | Non-structural glycoprotein 4 | NA | 1.18e-02 | NA |
| 2. P | Q9YS17 | Non-structural glycoprotein 4 | NA | 5.97e-14 | NA |
| 2. P | Q8N4V1 | ER membrane protein complex subunit 5 | 8.72e-04 | 4.74e-02 | NA |
| 2. P | B3SRQ8 | Non-structural glycoprotein 4 | NA | 4.86e-03 | NA |
| 2. P | Q7JGX4 | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 | 2.65e-03 | 2.49e-02 | NA |
| 2. P | P19554 | Protein Vpu | NA | 8.12e-04 | NA |
| 2. P | P64499 | Uncharacterized protein YebO | 8.40e-06 | 2.89e-04 | NA |
| 2. P | Q17Q87 | Stannin | 1.26e-03 | 3.30e-02 | NA |
| 2. P | P16208 | Glycoprotein NB | NA | 8.84e-03 | NA |
| 2. P | P20221 | Uncharacterized protein F-92 | NA | 3.98e-02 | NA |
| 2. P | P61808 | Stannin | 1.75e-04 | 3.01e-02 | NA |
| 2. P | Q9WAI8 | Non-structural glycoprotein 4 | NA | 4.81e-03 | NA |
| 2. P | Q2KI76 | Selenoprotein S | NA | 7.25e-05 | NA |
| 2. P | Q08AY9 | Protein FAM89A | 1.69e-04 | 4.58e-03 | NA |
| 2. P | Q4WP59 | Respiratory supercomplex factor 1, mitochondrial | 7.30e-05 | 3.43e-02 | NA |
| 2. P | P81306 | Uncharacterized protein MJ0332.1 | 6.55e-03 | 3.56e-02 | NA |
| 2. P | P69700 | Protein Vpu | NA | 9.34e-05 | NA |
| 2. P | A9Q1L1 | Non-structural glycoprotein 4 | NA | 3.08e-04 | NA |
| 2. P | P0CM85 | Cytochrome c oxidase assembly protein COX16, mitochondrial | 5.09e-03 | 5.17e-04 | NA |
| 2. P | G1S9B8 | Small integral membrane protein 12 | 6.00e-03 | 3.00e-05 | NA |
| 2. P | A1L2P2 | Small integral membrane protein 12-A | 1.83e-03 | 1.36e-03 | NA |
| 2. P | P18806 | Protein Vpu | NA | 6.66e-04 | NA |
| 2. P | Q9P0J0 | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 | 1.50e-03 | 1.67e-03 | NA |
| 2. P | Q79669 | Protein Vpu | NA | 1.27e-03 | NA |
| 2. P | P17286 | Protein Vpu | NA | 3.94e-03 | NA |
| 2. P | Q8VHV8 | Selenoprotein S | NA | 1.52e-03 | NA |
| 2. P | P08383 | Matrix protein 2 | NA | 4.44e-03 | NA |
| 2. P | O64224 | Gene 30 protein | NA | 6.07e-05 | NA |
| 2. P | Q9T1W9 | Uncharacterized protein gp25 | NA | 3.25e-04 | NA |
| 2. P | B3SRY0 | Non-structural glycoprotein 4 | NA | 4.06e-03 | NA |
| 2. P | Q68EU0 | Selenoprotein S B | NA | 1.17e-02 | NA |
| 2. P | Q78RX3 | Small integral membrane protein 12 | 1.04e-02 | 8.53e-06 | NA |
| 2. P | Q8BIS8 | Coiled-coil domain-containing protein 126 | 3.46e-05 | 5.22e-08 | NA |
| 2. P | Q5RDZ8 | Protein BRAWNIN | 3.31e-02 | 2.56e-02 | NA |
| 2. P | D2H617 | Small integral membrane protein 12 | 8.85e-03 | 2.16e-05 | NA |
| 2. P | Q9YJN7 | Non-structural glycoprotein 4 | NA | 2.36e-03 | NA |
| 2. P | P05923 | Protein Vpu | NA | 5.75e-04 | NA |
| 2. P | Q3EAV6 | Protein GLUTAMINE DUMPER 6 | 3.02e-02 | 3.93e-04 | NA |
| 2. P | P05921 | Protein Vpu | NA | 4.10e-04 | NA |
| 2. P | Q9ZDQ6 | Uncharacterized protein RP269 | 1.39e-04 | 4.86e-03 | NA |
| 2. P | P40576 | Inner membrane assembly complex subunit 22 | 8.46e-04 | 4.29e-02 | NA |
| 2. P | Q9UTK1 | Cytochrome c oxidase assembly protein cox16, mitochondrial | 3.00e-03 | 6.91e-08 | NA |
| 2. P | C0HK61 | ATP synthase subunit e, mitochondrial | 1.17e-04 | 3.16e-03 | NA |
| 2. P | P05947 | Protein Vpu | NA | 1.50e-02 | NA |
| 2. P | P28670 | Uncharacterized protein YoxC | 1.87e-07 | 5.26e-03 | NA |
| 2. P | O92374 | Non-structural glycoprotein 4 | NA | 5.52e-03 | NA |
| 2. P | F1SR90 | Selenoprotein S | NA | 1.40e-04 | NA |
| 2. P | P61807 | Stannin | 1.86e-04 | 3.01e-02 | NA |
| 2. P | Q8XCN8 | Uncharacterized protein YebO | 3.93e-05 | 4.06e-04 | NA |
| 2. P | Q9PYD1 | Non-structural glycoprotein 4 | NA | 2.31e-03 | NA |
| 2. P | Q9ERS2 | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 | 6.47e-04 | 1.31e-03 | NA |
| 2. P | P67909 | Glycoprotein NB | NA | 1.16e-02 | NA |
| 2. P | Q8QL14 | Uncharacterized protein 98 | NA | 2.85e-04 | NA |
| 2. P | Q70625 | Protein Vpu | NA | 3.43e-03 | NA |
| 2. P | Q96EE4 | Coiled-coil domain-containing protein 126 | 2.72e-05 | 4.04e-06 | NA |
| 2. P | Q0VFV6 | Selenoprotein S | NA | 5.93e-04 | NA |
| 2. P | Q9BQE4 | Selenoprotein S | NA | 7.87e-04 | NA |
| 2. P | O15239 | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 | 2.63e-03 | 3.98e-02 | NA |
| 2. P | Q8K2T4 | Ubiquinol-cytochrome-c reductase complex assembly factor 3 | 1.36e-04 | 2.13e-03 | NA |
| 2. P | G1QDE8 | Small integral membrane protein 12 | 2.31e-03 | 4.75e-05 | NA |
| 2. P | Q6UW78 | Ubiquinol-cytochrome-c reductase complex assembly factor 3 | 8.74e-04 | 1.27e-02 | NA |
| 2. P | Q0MQ88 | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 | 4.75e-04 | 2.68e-05 | NA |
| 2. P | P69699 | Protein Vpu | NA | 9.34e-05 | NA |
| 2. P | Q82028 | Non-structural glycoprotein 4 | NA | 9.10e-04 | NA |
| 2. P | Q8R400 | Adipogenin | 1.27e-03 | 2.40e-02 | NA |
| 2. P | Q5BKW8 | Small integral membrane protein 12 | 3.11e-03 | 3.12e-07 | NA |
| 2. P | P13058 | Protein gop | NA | 2.50e-05 | NA |
| 2. P | Q6FW43 | Cytochrome c oxidase assembly protein COX16, mitochondrial | 1.01e-03 | 3.33e-02 | NA |
| 2. P | P51729 | Uncharacterized 13.1 kDa protein in lys 3'region | NA | 3.50e-04 | NA |
| 2. P | Q95KV7 | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 | 3.55e-05 | 1.58e-04 | NA |
| 2. P | P89063 | Non-structural glycoprotein 4 | NA | 1.98e-02 | NA |
| 2. P | P08803 | Protein Vpu | NA | 2.75e-03 | NA |
| 2. P | B0Y606 | Respiratory supercomplex factor 1, mitochondrial | 3.24e-04 | 3.43e-02 | NA |
| 2. P | Q57915 | Uncharacterized protein MJ0492 | 2.50e-05 | 2.06e-02 | NA |
| 2. P | C6Y4C1 | Protein pet117, mitochondrial | 1.92e-05 | 3.18e-02 | NA |
| 2. P | Q45UF1 | Non-structural glycoprotein 4 | NA | 6.59e-03 | NA |
| 2. P | P45279 | Uncharacterized protein HI_1628 | 8.26e-05 | 2.59e-02 | NA |
| 2. P | A5PJ82 | Small integral membrane protein 12 | 1.78e-03 | 3.21e-05 | NA |
| 2. P | Q91E93 | Non-structural glycoprotein 4 | NA | 2.10e-02 | NA |
| 2. P | Q9DCC3 | Coiled-coil domain-containing protein 107 | 1.18e-04 | 3.48e-07 | NA |
| 2. P | Q8SPF0 | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 | 2.72e-03 | 2.49e-02 | NA |
| 2. P | P67908 | Glycoprotein NB | NA | 1.16e-02 | NA |
| 2. P | Q05239 | Gene 30 protein | NA | 1.10e-07 | NA |
| 2. P | P64500 | Uncharacterized protein YebO | 5.32e-06 | 2.89e-04 | NA |
| 2. P | P34592 | Uncharacterized protein ZC21.8 | 7.58e-03 | 4.29e-02 | NA |
| 2. P | Q5QGZ2 | Non-structural glycoprotein 4 | NA | 3.87e-02 | NA |
| 2. P | P05925 | Protein Vpu | NA | 8.75e-05 | NA |
| 2. P | Q96EX1 | Small integral membrane protein 12 | 1.14e-02 | 3.00e-05 | NA |
| 2. P | P05949 | Protein Vpu | NA | 2.46e-03 | NA |
| 2. P | Q8MN55 | Uncharacterized protein DDB_G0277453 | 4.44e-04 | 6.04e-03 | NA |
| 2. P | A2VE00 | Coiled-coil domain-containing protein 126 | 3.61e-05 | 2.12e-08 | NA |
| 2. P | Q6AZH0 | Selenoprotein S A | NA | 4.17e-02 | NA |
| 2. P | Q573C2 | Uncharacterized protein ORF107a | NA | 6.38e-04 | NA |
| 2. P | P0C0X4 | Matrix protein 2 | NA | 3.30e-02 | NA |
| 2. P | Q5UR53 | Uncharacterized protein L583 | NA | 2.03e-06 | NA |
| 2. P | P0CD94 | Ubiquinol-cytochrome-c reductase complex assembly factor 3 | 1.13e-03 | 1.66e-05 | NA |
| 2. P | Q82055 | Non-structural glycoprotein 4 | NA | 5.83e-11 | NA |
| 2. P | Q8ZFG9 | Uncharacterized protein YPO1740/y2567/YP_1481 | 7.58e-05 | 2.56e-05 | NA |
| 2. P | P13882 | Matrix protein 2 | NA | 2.34e-03 | NA |
| 2. P | Q2NKV5 | Transmembrane and coiled-coil domain-containing protein 2 | 3.59e-05 | 2.71e-05 | NA |
| 2. P | Q5RA70 | ER membrane protein complex subunit 5 | 1.52e-03 | 1.04e-02 | NA |
| 2. P | Q28EM2 | Small integral membrane protein 12 | 5.00e-03 | 1.67e-03 | NA |
| 2. P | Q8GTS2 | Basic leucine zipper 23 | 2.67e-03 | 3.86e-03 | NA |
| 2. P | P12516 | Protein Vpu | NA | 4.41e-02 | NA |
| 2. P | P53903 | Processing of GAS1 and ALP protein 2 | 9.03e-07 | 8.42e-03 | NA |
| 2. P | C1PGW0 | Protein TRACHEARY ELEMENT DIFFERENTIATION-RELATED 6 | 1.23e-03 | 4.97e-02 | NA |