Summary

O43247

Homolog: Q9D9J2.
Function: Testis-expressed protein 33.

Statistics

Total GO Annotation: 107
Unique PROST Go: 107
Unique BLAST Go: 0

Total Homologs: 50
Unique PROST Homologs: 48
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q9D9J2 (Testis-expressed protein 33) with a FATCAT P-Value: 0.00333 and RMSD of 9.49 angstrom. The sequence alignment identity is 64.1%.
Structural alignment shown in left. Query protein O43247 colored as red in alignment, homolog Q9D9J2 colored as blue. Query protein O43247 is also shown in right top, homolog Q9D9J2 showed in right bottom. They are colored based on secondary structures. 

  O43247 MELGHGAGTTTFTRAHLNDKEGQQDLDPWKAAYSSLDTSKFK-NQGLSSPQPLPLGASAQGSSLGQCHLKEIPPPPPTAASRDSLGMDPQSRSLKNAGSR 99
  Q9D9J2 MELSHRQGTTTLTRTHPNDKEGQQDMNSFRANHSSLDNSKFKYHARLSQ-SPL-------GSSLGQGYL-ETPPLPPTPTCRTSLAMNSHPEDLKKGASR 91

  O43247 SSSRENRATSGEGAQPCQGTDDGPSLGAQDQRSTPTNQKGSIIPNNIRHKFGSNVVDQLVSEEQAQKAIDEVFEGQKRASSWPSRTQNPVEISSVFSDYY 199
  Q9D9J2 SSSRDARETFREG---CVG-EEGQDSRSPEQRTVPLSKKDSVIPENIRHKFGSKMVDQLISEDQARQAIGEMFEGQKRPSSWPSRTQSPMQASSIFSDYY 187

  O43247 DLGYNMRSNLFRGAAEETKSLMKASYTPEVIEKSVRDLEHWHGRKTDDLGRWHQKNAMNLNLQKALEEKYGENSKSKSSKY 280
  Q9D9J2 DLGYHMRSNLFQGPPQETKSLMKASYTPEVIEKSVRDVEHWHGRKTDDLGRWHRKNAMNMNLQKALEEKYGEKSRSK-AK- 266

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0071391 cellular response to estrogen stimulus
2. P GO:0043029 T cell homeostasis
2. P GO:0030879 mammary gland development
2. P GO:0007160 cell-matrix adhesion
2. P GO:1902725 negative regulation of satellite cell differentiation
2. P GO:0032496 response to lipopolysaccharide
2. P GO:0000122 negative regulation of transcription by RNA polymerase II
2. P GO:0030430 host cell cytoplasm
2. P GO:0045926 negative regulation of growth
2. P GO:0007127 meiosis I
2. P GO:0032755 positive regulation of interleukin-6 production
2. P GO:0010847 regulation of chromatin assembly
2. P GO:0034080 CENP-A containing chromatin assembly
2. P GO:0035148 tube formation
2. P GO:0007526 larval somatic muscle development
2. P GO:0043280 positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
2. P GO:1902723 negative regulation of skeletal muscle satellite cell proliferation
2. P GO:0097141 BIM-BCL-2 complex
2. P GO:0008630 intrinsic apoptotic signaling pathway in response to DNA damage
2. P GO:0030991 intraciliary transport particle A
2. P GO:0001701 in utero embryonic development
2. P GO:0071392 cellular response to estradiol stimulus
2. P GO:0043065 positive regulation of apoptotic process
2. P GO:1902110 positive regulation of mitochondrial membrane permeability involved in apoptotic process
2. P GO:0097140 BIM-BCL-xl complex
2. P GO:0090200 positive regulation of release of cytochrome c from mitochondria
2. P GO:0045663 positive regulation of myoblast differentiation
2. P GO:0009968 negative regulation of signal transduction
2. P GO:0043631 RNA polyadenylation
2. P GO:0005634 nucleus
2. P GO:0097192 extrinsic apoptotic signaling pathway in absence of ligand
2. P GO:0005700 polytene chromosome
2. P GO:0045787 positive regulation of cell cycle
2. P GO:0010629 negative regulation of gene expression
2. P GO:0000217 DNA secondary structure binding
2. P GO:0002262 myeloid cell homeostasis
2. P GO:0005929 cilium
2. P GO:1902263 apoptotic process involved in embryonic digit morphogenesis
2. P GO:0043525 positive regulation of neuron apoptotic process
2. P GO:0001776 leukocyte homeostasis
2. P GO:0061966 establishment of left/right asymmetry
2. P GO:0001782 B cell homeostasis
2. P GO:0070242 thymocyte apoptotic process
2. P GO:0032006 regulation of TOR signaling
2. P GO:0010592 positive regulation of lamellipodium assembly
2. P GO:0046620 regulation of organ growth
2. P GO:0000785 chromatin
2. P GO:0008258 head involution
2. P GO:0019899 enzyme binding
2. P GO:0048024 regulation of mRNA splicing, via spliceosome
2. P GO:0010759 positive regulation of macrophage chemotaxis
2. P GO:1904646 cellular response to amyloid-beta
2. P GO:0039563 suppression by virus of host JAK-STAT cascade via inhibition of STAT1 activity
2. P GO:0097728 9+0 motile cilium
2. P GO:1902237 positive regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway
2. P GO:0061059 positive regulation of peptidoglycan recognition protein signaling pathway
2. P GO:2001244 positive regulation of intrinsic apoptotic signaling pathway
2. P GO:0007420 brain development
2. P GO:0032798 Swi5-Sfr1 complex
2. P GO:0017124 SH3 domain binding
2. P GO:0014839 myoblast migration involved in skeletal muscle regeneration
2. P GO:1903896 positive regulation of IRE1-mediated unfolded protein response
2. P GO:0008584 male gonad development
2. P GO:0043583 ear development
2. P GO:0048066 developmental pigmentation
2. P GO:0006919 activation of cysteine-type endopeptidase activity involved in apoptotic process
2. P GO:0002260 lymphocyte homeostasis
2. P GO:0001822 kidney development
2. P GO:0048070 regulation of developmental pigmentation
2. P GO:0048538 thymus development
2. P GO:0031334 positive regulation of protein-containing complex assembly
2. P GO:0035721 intraciliary retrograde transport
2. P GO:0071385 cellular response to glucocorticoid stimulus
2. P GO:0017053 transcription repressor complex
2. P GO:0048536 spleen development
2. P GO:0042981 regulation of apoptotic process
2. P GO:0034976 response to endoplasmic reticulum stress
2. P GO:0060271 cilium assembly
2. P GO:0042475 odontogenesis of dentin-containing tooth
2. P GO:0008284 positive regulation of cell population proliferation
2. P GO:0030317 flagellated sperm motility
2. P GO:0045088 regulation of innate immune response
2. P GO:0045089 positive regulation of innate immune response
2. P GO:0060139 positive regulation of apoptotic process by virus
2. P GO:0006915 apoptotic process
2. P GO:0039502 suppression by virus of host type I interferon-mediated signaling pathway
2. P GO:0019898 extrinsic component of membrane
2. P GO:0009792 embryo development ending in birth or egg hatching
2. P GO:0039564 suppression by virus of host JAK-STAT cascade via inhibition of STAT2 activity
2. P GO:0097228 sperm principal piece
2. P GO:0003712 transcription coregulator activity
2. P GO:0097136 Bcl-2 family protein complex
2. P GO:0003968 RNA-directed 5'-3' RNA polymerase activity
2. P GO:2000271 positive regulation of fibroblast apoptotic process
2. P GO:0045087 innate immune response
2. P GO:0001669 acrosomal vesicle
2. P GO:0005856 cytoskeleton
2. P GO:0016592 mediator complex
2. P GO:0045944 positive regulation of transcription by RNA polymerase II
2. P GO:0048563 post-embryonic animal organ morphogenesis
2. P GO:0000776 kinetochore
2. P GO:2001236 regulation of extrinsic apoptotic signaling pathway
2. P GO:0039644 suppression by virus of host NF-kappaB cascade
2. P GO:0097729 9+2 motile cilium
2. P GO:0034263 positive regulation of autophagy in response to ER overload
2. P GO:0010950 positive regulation of endopeptidase activity
2. P GO:0005654 nucleoplasm

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB O43247 Testis-expressed protein 33 0 5.33e-148 0.0
1. PB Q9D9J2 Testis-expressed protein 33 3.33e-03 1.60e-20 5.55e-115
2. P E1BXS0 Swi5-dependent recombination DNA repair protein 1 homolog 2.00e-01 3.04e-03 NA
2. P Q85443 Non-structural protein 12A NA 1.05e-02 NA
2. P E2QSX5 Intraflagellar transport protein 43 homolog 3.00e-02 1.68e-03 NA
2. P O20173 Uncharacterized 27.9 kDa protein in trnR-minE intergenic region 1.11e-02 1.04e-09 NA
2. P Q9D1Z2 Uncharacterized protein C11orf91 homolog 1.76e-01 3.70e-02 NA
2. P Q53H80 Akirin-2 8.73e-03 1.28e-03 NA
2. P Q9T1P5 Putative protein p53 NA 1.91e-02 NA
2. P P06843 Protein SPT2 8.70e-02 7.19e-04 NA
2. P Q13352 Centromere protein R 2.93e-01 1.48e-04 NA
2. P P04861 Protein C' NA 3.42e-04 NA
2. P Q5E9L4 Apoptosis facilitator Bcl-2-like protein 14 8.39e-02 4.92e-02 NA
2. P Q8TC29 Enkurin 1.17e-01 1.13e-02 NA
2. P P24567 Phosphoprotein NA 1.71e-02 NA
2. P B5X7E4 Intraflagellar transport protein 43 homolog B 2.17e-02 1.43e-04 NA
2. P B5XBI1 Intraflagellar transport protein 43 homolog A 6.41e-02 7.45e-05 NA
2. P B1AXD8 Akirin-2 2.05e-02 1.25e-03 NA
2. P Q8IE51 Uncharacterized protein MAL13P1.147 9.34e-02 4.45e-04 NA
2. P E7F555 Intraflagellar transport protein 43 homolog 1.54e-01 2.14e-03 NA
2. P P87299 Meiotically up-regulated gene 74 protein 7.66e-02 6.23e-03 NA
2. P Q9H607 Occludin/ELL domain-containing protein 1 2.52e-02 4.09e-06 NA
2. P Q9VS59 Akirin 3.83e-02 1.07e-05 NA
2. P Q8BP99 UPF0500 protein C1orf216 homolog 8.04e-02 5.10e-04 NA
2. P P69738 Protein C' NA 8.83e-04 NA
2. P A6NGY1 Protein FRG2-like-2 9.95e-02 2.51e-02 NA
2. P Q2LZ58 Protein charybde 8.86e-02 3.63e-03 NA
2. P Q25C79 Akirin-2 8.06e-03 5.96e-04 NA
2. P P89468 Tegument protein VP22 NA 2.20e-03 NA
2. P P0CU47 Cytosolic-abundant heat soluble protein 89226 2.41e-02 1.75e-03 NA
2. P Q10148 Telomere length and silencing protein 1 1.16e-01 9.09e-03 NA
2. P Q2KHX9 Mediator of RNA polymerase II transcription subunit 9 8.67e-02 2.46e-02 NA
2. P Q09762 Uncharacterized protein C24H6.08 2.14e-01 2.80e-02 NA
2. P A8YXY8 Akirin-2 2.63e-02 2.49e-04 NA
2. P Q9NWA0 Mediator of RNA polymerase II transcription subunit 9 1.37e-02 3.05e-02 NA
2. P Q5MKM7 Phosphoprotein NA 2.06e-03 NA
2. P P04862 C' protein NA 3.35e-03 NA
2. P Q99LF1 Akirin-1 1.53e-02 5.07e-03 NA
2. P Q2TBN9 Intraflagellar transport protein 43 homolog 5.96e-02 2.13e-05 NA
2. P Q8VCS6 Mediator of RNA polymerase II transcription subunit 9 1.91e-02 3.99e-02 NA
2. P Q03233 Alpha1-proteinase inhibitor-degradation deficient protein 37 3.73e-01 2.56e-03 NA
2. P O43521 Bcl-2-like protein 11 6.96e-03 1.58e-02 NA
2. P Q9VTI8 Protein charybde 3.42e-02 1.44e-02 NA
2. P O54918 Bcl-2-like protein 11 1.34e-02 4.66e-02 NA
2. P Q9CQ82 Centromere protein R 2.21e-01 1.23e-03 NA
2. P Q8TAB5 UPF0500 protein C1orf216 7.51e-03 5.42e-05 NA
2. P Q9H9L7 Akirin-1 1.09e-02 2.08e-03 NA
2. P Q6SP97 Enkurin 1.30e-01 4.17e-02 NA
2. P P14253 Protein C' NA 3.47e-02 NA
2. P B5G1P1 Intraflagellar transport protein 43 homolog 2.31e-02 7.64e-03 NA