Summary

O43687

Homolog: O55074.
Function: A-kinase anchor protein 7 isoform alpha.

Statistics

Total GO Annotation: 53
Unique PROST Go: 28
Unique BLAST Go: 5

Total Homologs: 38
Unique PROST Homologs: 31
Unique BLAST Homologs: 5

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was O55074 (A-kinase anchor protein 7 isoform alpha) with a FATCAT P-Value: 0.00133 and RMSD of 3.34 angstrom. The sequence alignment identity is 61.5%.
Structural alignment shown in left. Query protein O43687 colored as red in alignment, homolog O55074 colored as blue. Query protein O43687 is also shown in right top, homolog O55074 showed in right bottom. They are colored based on secondary structures. 

  O43687 MGQLCCFPFSRDEGKISELESSSSAVLQRYSKDIPSWSSGEKNGGEPDDAELVRLSKRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNE 100
  O55074 MGQLCCFPFARDEGKICE-------------KD-------RR---EPEDAELVRLSKRLVENAVLKAVQQYLEETQNKKQPGEGNSTKAEEGDRNGDGSD 77

  O43687 NNRK 104
  O55074 NNRK 81

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:1901381 positive regulation of potassium ion transmembrane transport
1. PB GO:0016208 AMP binding
1. PB GO:0001508 action potential
1. PB GO:0016020 membrane
1. PB GO:0051018 protein kinase A binding
1. PB GO:0050804 modulation of chemical synaptic transmission
1. PB GO:0016324 apical plasma membrane
1. PB GO:0060306 regulation of membrane repolarization
1. PB GO:1902261 positive regulation of delayed rectifier potassium channel activity
1. PB GO:0030315 T-tubule
1. PB GO:0071320 cellular response to cAMP
1. PB GO:0010738 regulation of protein kinase A signaling
1. PB GO:0034237 protein kinase A regulatory subunit binding
1. PB GO:0032991 protein-containing complex
1. PB GO:0008104 protein localization
1. PB GO:0016328 lateral plasma membrane
1. PB GO:0007178 transmembrane receptor protein serine/threonine kinase signaling pathway
1. PB GO:0098686 hippocampal mossy fiber to CA3 synapse
1. PB GO:0070382 exocytic vesicle
1. PB GO:0016529 sarcoplasmic reticulum
2. P GO:0030879 mammary gland development
2. P GO:1904674 positive regulation of somatic stem cell population maintenance
2. P GO:0051973 positive regulation of telomerase activity
2. P GO:0045892 negative regulation of transcription, DNA-templated
2. P GO:0010507 negative regulation of autophagy
2. P GO:0042308 negative regulation of protein import into nucleus
2. P GO:2000480 negative regulation of cAMP-dependent protein kinase activity
2. P GO:0060644 mammary gland epithelial cell differentiation
2. P GO:0020002 host cell plasma membrane
2. P GO:0044178 host cell Golgi membrane
2. P GO:2000737 negative regulation of stem cell differentiation
2. P GO:2000103 positive regulation of mammary stem cell proliferation
2. P GO:0032212 positive regulation of telomere maintenance via telomerase
2. P GO:0009653 anatomical structure morphogenesis
2. P GO:0097190 apoptotic signaling pathway
2. P GO:0005634 nucleus
2. P GO:0019033 viral tegument
2. P GO:0004862 cAMP-dependent protein kinase inhibitor activity
2. P GO:0043408 regulation of MAPK cascade
2. P GO:0034198 cellular response to amino acid starvation
2. P GO:0033147 negative regulation of intracellular estrogen receptor signaling pathway
2. P GO:1904677 positive regulation of somatic stem cell division
2. P GO:0044782 cilium organization
2. P GO:0045893 positive regulation of transcription, DNA-templated
2. P GO:0046760 viral budding from Golgi membrane
2. P GO:0070513 death domain binding
2. P GO:0055036 virion membrane
2. P GO:1904355 positive regulation of telomere capping
3. B GO:0019901 protein kinase binding
3. B GO:0019904 protein domain specific binding
3. B GO:0031333 negative regulation of protein-containing complex assembly
3. B GO:0005829 cytosol
3. B GO:0008022 protein C-terminus binding

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB O55074 A-kinase anchor protein 7 isoform alpha 1.33e-03 7.02e-19 2.32e-35
1. PB O43687 A-kinase anchor protein 7 isoforms alpha and beta 0 1.10e-134 4.08e-72
2. P P04289 Cytoplasmic envelopment protein 3 NA 3.92e-05 NA
2. P A5PJU8 Protein LBH 2.19e-01 3.84e-03 NA
2. P P30220 Heat shock protein 30E (Fragment) 6.61e-03 5.65e-04 NA
2. P Q1XDR4 Uncharacterized protein ORF58 3.34e-02 2.93e-02 NA
2. P I1JLC8 Protein SLE2 2.94e-02 1.83e-02 NA
2. P P52459 Cytoplasmic envelopment protein 3 NA 9.45e-03 NA
2. P Q82XF2 Probable Fe(2+)-trafficking protein 2.43e-01 4.43e-02 NA
2. P P13294 Cytoplasmic envelopment protein 3 NA 4.80e-02 NA
2. P Q3J8X0 Probable Fe(2+)-trafficking protein 1.07e-01 2.42e-02 NA
2. P P0C8Y6 Small membrane A-kinase anchor protein 2.80e-02 1.67e-02 NA
2. P O36387 Cytoplasmic envelopment protein 3 NA 7.91e-03 NA
2. P Q9CX60 Protein LBH 1.14e-01 2.75e-02 NA
2. P Q59W04 EKC/KEOPS complex subunit GON7 3.62e-02 3.48e-02 NA
2. P Q6P8X9 Protein Flattop 2.40e-01 1.04e-02 NA
2. P Q9ZDT5 Uncharacterized protein RP240 1.26e-01 1.15e-02 NA
2. P Q68980 Cytoplasmic envelopment protein 3 NA 1.88e-04 NA
2. P A0A1B0GVK7 Protein FAM240A 1.03e-02 8.69e-03 NA
2. P A0A1B0GVZ2 Protein FAM240B 6.21e-02 4.26e-03 NA
2. P P19280 Uncharacterized 9.5 kDa protein NA 3.30e-02 NA
2. P Q6ZSJ8 Uncharacterized protein C1orf122 2.53e-02 8.46e-04 NA
2. P P52368 Cytoplasmic envelopment protein 3 NA 3.01e-06 NA
2. P Q9ZE94 Uncharacterized lipoprotein RP051 1.29e-02 1.78e-02 NA
2. P Q9D757 Death-associated protein-like 1 5.64e-03 1.56e-02 NA
2. P Q92IU6 Uncharacterized protein RC0324 9.23e-02 4.23e-05 NA
2. P Q77HP2 Protein V2 NA 2.16e-04 NA
2. P Q7YQJ4 cAMP-dependent protein kinase inhibitor gamma 3.70e-02 1.62e-02 NA
2. P Q5ZM46 Protein LBH 1.59e-01 5.59e-04 NA
2. P G3UW99 Testis-expressed protein 54 8.37e-02 1.83e-02 NA
2. P Q9C010 cAMP-dependent protein kinase inhibitor beta 3.25e-01 4.47e-03 NA
2. P Q5RD13 Protein LBH 3.01e-01 1.19e-03 NA
2. P P12533 Early E1A 11 kDa protein NA 1.98e-02 NA
3. B Q9P0M2 A-kinase anchor protein 7 isoform gamma 2.26e-01 NA 2.89e-37
3. B G3UWD5 A-kinase anchor protein inhibitor 1 9.80e-03 NA 0.025
3. B Q7TN79 A-kinase anchor protein 7 isoform gamma 1.92e-01 NA 2.73e-25
3. B P0CW23 A-kinase anchor protein inhibitor 1 4.51e-02 NA 1.51e-05
3. B Q6JP77 A-kinase anchor protein 7 isoforms delta and gamma 1.45e-01 NA 1.85e-25