Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
Q9P2K6
(Kelch-like protein 42) with a FATCAT P-Value: 0.0 and RMSD of 3.04 angstrom. The sequence alignment identity is 23.8%.
Structural alignment shown in left. Query protein O94819 colored as red in alignment, homolog Q9P2K6 colored as blue.
Query protein O94819 is also shown in right top, homolog Q9P2K6 showed in right bottom. They are colored based on secondary structures.
O94819 MEHAVAPCVLYPGTEPGAAGESESEGAASPAQTPCSLGASLCFSSGEESPPQSLASAAEGAATSPPSSGGPRVVERQWEAGSAGAASPEELASPEERACP 100 Q9P2K6 ---------------------------------------------------------------------------------------------------- 0 O94819 EEPAAPSPEPRVWLEDPASPEEPGEPAPVPPGFGAVYGEPDLVLEVSGRRL--RAH---KAVLAARSDYFRA--RAS-RDVL----------RVQGVSLT 182 Q9P2K6 ------------------------------------MSAEEMV-QI---RLEDRCYPVSKRKLIEQSDYFRALYRSGMREALSQEAGGPEVQQLRGLSAP 60 O94819 ALRLLLAD------AYSGRM--------AGVRPDN-------VAEVVAGARRLQLPGAAQRATDAVGPQLSLANCYEVLSAAKRQRLNELRDAAYC--FM 259 Q9P2K6 GLRLVL-DFINAGGAREGWLLGPRGEKGGGVDEDEEMDEVSLLSELVEAASFLQVTSLLQ----LLLSQVRLNNCLEMYRLAQVYGLPDLQEA--CLRFM 153 O94819 SDHYLEVLREPAVFGRLSG----AERDLLLRRRLRAGR---AHLLAAALGP-AGERAGSRPQSP---SGDADA--RGDAAVYCFHAAAGEWREL-TRLPE 345 Q9P2K6 VVHFHEVLCKPQ-F-HLLGSPPQAPGDVSLKQRLREARMTGTPVL-VALGDFLG---G--PLAPHPYQGEPPSMLR-----Y--EEMTERWFPLANNLP- 237 O94819 GAP----ARGCGLCVLYNYLFVAGGVAPAGPDGRARPSDQVFC---YNPATDSWSAVRPLRQARSQLRLLALDGHLYAVGGECLLSVERYDPRADRWAPV 438 Q9P2K6 --PDLVNVRGYGSAILDNYLFIVGGY-------RI-TSQEISAAHSYNPSTNEWLQVASMNQKRSNFKLVAVNSKLYAIGGQAVSNVECYNPEQDAWNFV 327 O94819 APLPR--GAFAVAHEATTCHGEIYVSGGSLFY--R-----LLKYDPRRDEWQ--ECPCSSSRERSADMVALDGFIYRFDLSGSRGEAQAAGP---SG--- 521 Q9P2K6 APLPNPLAEFSACE----CKGKIYVIGG---YTTRDRNMNILQYCPSSDMWTLFE-TC-DVHIRKQQMVSVEETIY---IVG--GCLHELGPNRRSSQSE 413 O94819 --VSVSRYHCLAKQWSPCVAPLRLP--GGPTGLQPFRCAAL--DGAIYCVSRAGTWRFQ-PAR---EGEAGGDAGQG-GGFEALGAPLDVRGVLIPFALS 610 Q9P2K6 DMLTVQSYNTVTRQW------LYLKENTSKSGLN-LTC-ALHNDG-IYIMSRDVTLSTSLEHRVFLKYNIFSDSWEAFRRFPAFG-----HNLLVS-SLY 498 O94819 LPEKPPRGEQGAP 623 Q9P2K6 LPNKAET------ 505
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0045604 | regulation of epidermal cell differentiation |
| 1. PB | GO:0016055 | Wnt signaling pathway |
| 1. PB | GO:0071466 | cellular response to xenobiotic stimulus |
| 1. PB | GO:0032886 | regulation of microtubule-based process |
| 1. PB | GO:0007094 | mitotic spindle assembly checkpoint signaling |
| 1. PB | GO:0048873 | homeostasis of number of cells within a tissue |
| 1. PB | GO:0045886 | negative regulation of synaptic assembly at neuromuscular junction |
| 1. PB | GO:0042994 | cytoplasmic sequestering of transcription factor |
| 1. PB | GO:0072156 | distal tubule morphogenesis |
| 1. PB | GO:0031398 | positive regulation of protein ubiquitination |
| 1. PB | GO:0031463 | Cul3-RING ubiquitin ligase complex |
| 1. PB | GO:0006511 | ubiquitin-dependent protein catabolic process |
| 1. PB | GO:0071353 | cellular response to interleukin-4 |
| 1. PB | GO:0035020 | regulation of Rac protein signal transduction |
| 1. PB | GO:0001887 | selenium compound metabolic process |
| 1. PB | GO:0043161 | proteasome-mediated ubiquitin-dependent protein catabolic process |
| 1. PB | GO:0030424 | axon |
| 1. PB | GO:0034451 | centriolar satellite |
| 1. PB | GO:0045109 | intermediate filament organization |
| 1. PB | GO:0001701 | in utero embryonic development |
| 1. PB | GO:0045171 | intercellular bridge |
| 1. PB | GO:0016567 | protein ubiquitination |
| 1. PB | GO:0031430 | M band |
| 1. PB | GO:0070294 | renal sodium ion absorption |
| 1. PB | GO:0032435 | negative regulation of proteasomal ubiquitin-dependent protein catabolic process |
| 1. PB | GO:0031672 | A band |
| 1. PB | GO:0014032 | neural crest cell development |
| 1. PB | GO:0045214 | sarcomere organization |
| 1. PB | GO:0004842 | ubiquitin-protein transferase activity |
| 1. PB | GO:0006888 | endoplasmic reticulum to Golgi vesicle-mediated transport |
| 1. PB | GO:0014029 | neural crest formation |
| 1. PB | GO:0031275 | obsolete regulation of lateral pseudopodium assembly |
| 1. PB | GO:0071233 | cellular response to leucine |
| 1. PB | GO:0002467 | germinal center formation |
| 1. PB | GO:0043066 | negative regulation of apoptotic process |
| 1. PB | GO:0001726 | ruffle |
| 1. PB | GO:0006513 | protein monoubiquitination |
| 1. PB | GO:0032465 | regulation of cytokinesis |
| 1. PB | GO:0051301 | cell division |
| 1. PB | GO:0032839 | dendrite cytoplasm |
| 1. PB | GO:0007420 | brain development |
| 1. PB | GO:0005884 | actin filament |
| 1. PB | GO:2000291 | regulation of myoblast proliferation |
| 1. PB | GO:0010507 | negative regulation of autophagy |
| 1. PB | GO:0030036 | actin cytoskeleton organization |
| 1. PB | GO:0039648 | modulation by virus of host protein ubiquitination |
| 1. PB | GO:0016605 | PML body |
| 1. PB | GO:0030057 | desmosome |
| 1. PB | GO:0019964 | interferon-gamma binding |
| 1. PB | GO:0005802 | trans-Golgi network |
| 1. PB | GO:0043025 | neuronal cell body |
| 1. PB | GO:2001014 | regulation of skeletal muscle cell differentiation |
| 1. PB | GO:0016235 | aggresome |
| 1. PB | GO:0048808 | male genitalia morphogenesis |
| 1. PB | GO:0005886 | plasma membrane |
| 1. PB | GO:0071322 | cellular response to carbohydrate stimulus |
| 1. PB | GO:0010506 | regulation of autophagy |
| 1. PB | GO:0097718 | disordered domain specific binding |
| 1. PB | GO:0050801 | ion homeostasis |
| 1. PB | GO:1904263 | positive regulation of TORC1 signaling |
| 1. PB | GO:0071630 | nuclear protein quality control by the ubiquitin-proteasome system |
| 1. PB | GO:0005856 | cytoskeleton |
| 1. PB | GO:0039649 | modulation by virus of host ubiquitin-protein ligase activity |
| 1. PB | GO:0034599 | cellular response to oxidative stress |
| 1. PB | GO:0097602 | cullin family protein binding |
| 1. PB | GO:0035914 | skeletal muscle cell differentiation |
| 1. PB | GO:0005912 | adherens junction |
| 1. PB | GO:0098528 | skeletal muscle fiber differentiation |
| 1. PB | GO:1990390 | protein K33-linked ubiquitination |
| 1. PB | GO:0006446 | regulation of translational initiation |
| 1. PB | GO:0021680 | cerebellar Purkinje cell layer development |
| 1. PB | GO:0016234 | inclusion body |
| 1. PB | GO:2001243 | negative regulation of intrinsic apoptotic signaling pathway |
| 1. PB | GO:0014728 | regulation of the force of skeletal muscle contraction |
| 1. PB | GO:0030239 | myofibril assembly |
| 1. PB | GO:0030430 | host cell cytoplasm |
| 1. PB | GO:0015629 | actin cytoskeleton |
| 1. PB | GO:0061061 | muscle structure development |
| 1. PB | GO:0016358 | dendrite development |
| 1. PB | GO:0031674 | I band |
| 1. PB | GO:0005819 | spindle |
| 1. PB | GO:0005764 | lysosome |
| 1. PB | GO:0048741 | skeletal muscle fiber development |
| 1. PB | GO:0051865 | protein autoubiquitination |
| 1. PB | GO:0048208 | COPII vesicle coating |
| 1. PB | GO:0072686 | mitotic spindle |
| 1. PB | GO:0031397 | negative regulation of protein ubiquitination |
| 1. PB | GO:0030134 | COPII-coated ER to Golgi transport vesicle |
| 1. PB | GO:0060028 | convergent extension involved in axis elongation |
| 1. PB | GO:0030425 | dendrite |
| 1. PB | GO:0033150 | cytoskeletal calyx |
| 1. PB | GO:0030496 | midbody |
| 1. PB | GO:0009968 | negative regulation of signal transduction |
| 1. PB | GO:0031208 | POZ domain binding |
| 1. PB | GO:1901992 | positive regulation of mitotic cell cycle phase transition |
| 1. PB | GO:0005827 | polar microtubule |
| 1. PB | GO:0046329 | negative regulation of JNK cascade |
| 1. PB | GO:0006895 | Golgi to endosome transport |
| 1. PB | GO:0007049 | cell cycle |
| 1. PB | GO:0007010 | cytoskeleton organization |
| 1. PB | GO:0000070 | mitotic sister chromatid segregation |
| 1. PB | GO:0045661 | regulation of myoblast differentiation |
| 1. PB | GO:0042803 | protein homodimerization activity |
| 1. PB | GO:0061912 | selective autophagy |
| 1. PB | GO:0048471 | perinuclear region of cytoplasm |
| 1. PB | GO:0035853 | chromosome passenger complex localization to spindle midzone |
| 1. PB | GO:0036268 | swimming |
| 1. PB | GO:0051015 | actin filament binding |
| 1. PB | GO:0060090 | molecular adaptor activity |
| 1. PB | GO:0030127 | COPII vesicle coat |
| 1. PB | GO:2000312 | regulation of kainate selective glutamate receptor activity |
| 1. PB | GO:0070936 | protein K48-linked ubiquitination |
| 1. PB | GO:0007286 | spermatid development |
| 1. PB | GO:0016021 | integral component of membrane |
| 1. PB | GO:0031143 | pseudopodium |
| 1. PB | GO:0033017 | sarcoplasmic reticulum membrane |
| 1. PB | GO:0005829 | cytosol |
| 1. PB | GO:0009566 | fertilization |
| 1. PB | GO:0047485 | protein N-terminus binding |
| 1. PB | GO:0071889 | 14-3-3 protein binding |
| 1. PB | GO:0003779 | actin binding |
| 1. PB | GO:0001933 | negative regulation of protein phosphorylation |
| 1. PB | GO:0071379 | cellular response to prostaglandin stimulus |
| 1. PB | GO:2000042 | negative regulation of double-strand break repair via homologous recombination |
| 1. PB | GO:0090076 | relaxation of skeletal muscle |
| 1. PB | GO:0032436 | positive regulation of proteasomal ubiquitin-dependent protein catabolic process |
| 1. PB | GO:0007628 | adult walking behavior |
| 1. PB | GO:0030307 | positive regulation of cell growth |
| 1. PB | GO:0042802 | identical protein binding |
| 1. PB | GO:0008584 | male gonad development |
| 1. PB | GO:0005654 | nucleoplasm |
| 2. P | GO:0043224 | nuclear SCF ubiquitin ligase complex |
| 2. P | GO:0010718 | positive regulation of epithelial to mesenchymal transition |
| 2. P | GO:1904672 | regulation of somatic stem cell population maintenance |
| 2. P | GO:0035455 | response to interferon-alpha |
| 2. P | GO:0097066 | response to thyroid hormone |
| 2. P | GO:0099243 | extrinsic component of synaptic membrane |
| 2. P | GO:0044295 | axonal growth cone |
| 2. P | GO:0007399 | nervous system development |
| 2. P | GO:0019005 | SCF ubiquitin ligase complex |
| 2. P | GO:0016363 | nuclear matrix |
| 2. P | GO:0050815 | phosphoserine residue binding |
| 2. P | GO:0032281 | AMPA glutamate receptor complex |
| 2. P | GO:0010499 | proteasomal ubiquitin-independent protein catabolic process |
| 2. P | GO:0043065 | positive regulation of apoptotic process |
| 2. P | GO:0097060 | synaptic membrane |
| 2. P | GO:0023041 | neuronal signal transduction |
| 2. P | GO:0005783 | endoplasmic reticulum |
| 2. P | GO:0071230 | cellular response to amino acid stimulus |
| 2. P | GO:1905174 | regulation of vascular associated smooth muscle cell dedifferentiation |
| 2. P | GO:0005813 | centrosome |
| 2. P | GO:0003190 | atrioventricular valve formation |
| 2. P | GO:0015630 | microtubule cytoskeleton |
| 2. P | GO:0060317 | cardiac epithelial to mesenchymal transition |
| 2. P | GO:0051152 | positive regulation of smooth muscle cell differentiation |
| 2. P | GO:0014069 | postsynaptic density |
| 2. P | GO:0010629 | negative regulation of gene expression |
| 2. P | GO:0050853 | B cell receptor signaling pathway |
| 2. P | GO:0043204 | perikaryon |
| 2. P | GO:0030516 | regulation of axon extension |
| 2. P | GO:0030914 | |
| 3. B | GO:0001227 | DNA-binding transcription repressor activity, RNA polymerase II-specific |
| 3. B | GO:0034058 | endosomal vesicle fusion |
| 3. B | GO:0010017 | red or far-red light signaling pathway |
| 3. B | GO:0030162 | regulation of proteolysis |
| 3. B | GO:0045746 | negative regulation of Notch signaling pathway |
| 3. B | GO:0061418 | regulation of transcription from RNA polymerase II promoter in response to hypoxia |
| 3. B | GO:0007398 | ectoderm development |
| 3. B | GO:1902410 | mitotic cytokinetic process |
| 3. B | GO:0060766 | negative regulation of androgen receptor signaling pathway |
| 3. B | GO:0006357 | regulation of transcription by RNA polymerase II |
| 3. B | GO:0000978 | RNA polymerase II cis-regulatory region sequence-specific DNA binding |
| 3. B | GO:0045111 | intermediate filament cytoskeleton |
| 3. B | GO:0050804 | modulation of chemical synaptic transmission |
| 3. B | GO:0000381 | regulation of alternative mRNA splicing, via spliceosome |
| 3. B | GO:1900242 | regulation of synaptic vesicle endocytosis |
| 3. B | GO:2000676 | positive regulation of type B pancreatic cell apoptotic process |
| 3. B | GO:0007297 | ovarian follicle cell migration |
| 3. B | GO:1990837 | sequence-specific double-stranded DNA binding |
| 3. B | GO:0097680 | double-strand break repair via classical nonhomologous end joining |
| 3. B | GO:0035035 | histone acetyltransferase binding |
| 3. B | GO:0031625 | ubiquitin protein ligase binding |
| 3. B | GO:0110070 | cellularization cleavage furrow |
| 3. B | GO:0006338 | chromatin remodeling |
| 3. B | GO:0006325 | chromatin organization |
| 3. B | GO:0090160 | Golgi to lysosome transport |
| 3. B | GO:0035324 | female germline ring canal |
| 3. B | GO:0048549 | positive regulation of pinocytosis |
| 3. B | GO:0042428 | serotonin metabolic process |
| 3. B | GO:0001702 | gastrulation with mouth forming second |
| 3. B | GO:0050681 | androgen receptor binding |
| 3. B | GO:0007300 | ovarian nurse cell to oocyte transport |
| 3. B | GO:0046332 | SMAD binding |
| 3. B | GO:0070418 | DNA-dependent protein kinase complex |
| 3. B | GO:0050951 | sensory perception of temperature stimulus |
| 3. B | GO:0042748 | circadian sleep/wake cycle, non-REM sleep |
| 3. B | GO:0000209 | protein polyubiquitination |
| 3. B | GO:2000104 | negative regulation of DNA-dependent DNA replication |
| 3. B | GO:0035183 | female germline ring canal inner rim |
| 3. B | GO:0060586 | multicellular organismal iron ion homeostasis |
| 3. B | GO:0007301 | female germline ring canal formation |
| 3. B | GO:1901044 | protein polyubiquitination involved in nucleus-associated proteasomal ubiquitin-dependent protein catabolic process |
| 3. B | GO:0045444 | fat cell differentiation |
| 3. B | GO:0030723 | ovarian fusome organization |
| 3. B | GO:0051090 | regulation of DNA-binding transcription factor activity |
| 3. B | GO:0005634 | nucleus |
| 3. B | GO:0140014 | mitotic nuclear division |
| 3. B | GO:0007616 | long-term memory |
| 3. B | GO:0016607 | nuclear speck |
| 3. B | GO:0008344 | adult locomotory behavior |
| 3. B | GO:0030512 | negative regulation of transforming growth factor beta receptor signaling pathway |
| 3. B | GO:0032225 | regulation of synaptic transmission, dopaminergic |
| 3. B | GO:0045670 | regulation of osteoclast differentiation |
| 3. B | GO:0001222 | transcription corepressor binding |
| 3. B | GO:0043249 | erythrocyte maturation |
| 3. B | GO:0000117 | regulation of transcription involved in G2/M transition of mitotic cell cycle |
| 3. B | GO:0140297 | DNA-binding transcription factor binding |
| 3. B | GO:0045172 | germline ring canal |
| 3. B | GO:0001046 | core promoter sequence-specific DNA binding |
| 3. B | GO:0098813 | nuclear chromosome segregation |
| 3. B | GO:0030183 | B cell differentiation |
| 3. B | GO:0034504 | protein localization to nucleus |
| 3. B | GO:0044354 | macropinosome |
| 3. B | GO:1901981 | phosphatidylinositol phosphate binding |
| 3. B | GO:0001223 | transcription coactivator binding |
| 3. B | GO:0048512 | circadian behavior |
| 3. B | GO:2000677 | regulation of transcription regulatory region DNA binding |
| 3. B | GO:2000762 | regulation of phenylpropanoid metabolic process |
| 3. B | GO:0006110 | regulation of glycolytic process |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | E9QIN8 | Kelch-like protein 41a | 9.01e-11 | 1.86e-10 | 6.57e-05 |
| 1. PB | Q9Y2M5 | Kelch-like protein 20 | 2.93e-10 | 2.25e-13 | 2.10e-17 |
| 1. PB | Q5REP9 | Kelch-like protein 3 | 1.07e-08 | 1.31e-14 | 6.84e-10 |
| 1. PB | A0A1B8YAB1 | Kelch repeat and BTB domain-containing protein 8 | 1.58e-11 | 8.41e-20 | 3.69e-15 |
| 1. PB | Q5VTJ3 | Kelch domain-containing protein 7A | 3.55e-07 | 2.83e-06 | 3.14e-86 |
| 1. PB | Q8JZP3 | Kelch-like protein 2 | 2.72e-10 | 8.10e-14 | 1.63e-09 |
| 1. PB | Q1LYM6 | Kelch-like protein 38 | 4.13e-12 | 1.13e-12 | 2.35e-05 |
| 1. PB | A6NCF5 | Kelch-like protein 33 | 1.85e-11 | 7.14e-10 | 7.32e-12 |
| 1. PB | Q16RL8 | Kelch-like protein diablo | 4.63e-10 | 8.91e-11 | 7.61e-18 |
| 1. PB | Q9CZ49 | Kelch-like protein 35 | 1.12e-11 | 2.32e-21 | 9.76e-14 |
| 1. PB | B3DIV9 | Kelch-like protein 40a | 8.03e-11 | 2.94e-10 | 5.27e-07 |
| 1. PB | Q9C0H6 | Kelch-like protein 4 | 3.84e-09 | 1.40e-17 | 7.47e-14 |
| 1. PB | A2AUC9 | Kelch-like protein 41 | 1.82e-09 | 2.13e-11 | 1.39e-08 |
| 1. PB | Q8BNW9 | Kelch repeat and BTB domain-containing protein 11 | 0.00e+00 | 4.32e-102 | 0.0 |
| 1. PB | Q8BFQ9 | Kelch-like protein 42 | 9.77e-15 | 9.12e-13 | 1.02e-28 |
| 1. PB | Q6TFL4 | Kelch-like protein 24 | 4.94e-12 | 5.25e-18 | 1.05e-13 |
| 1. PB | A2AAX3 | Kelch-like protein 15 | 1.52e-10 | 1.84e-11 | 1.65e-12 |
| 1. PB | Q9NVX7 | Kelch repeat and BTB domain-containing protein 4 | 7.00e-12 | 2.49e-16 | 2.66e-05 |
| 1. PB | Q14145 | Kelch-like ECH-associated protein 1 | 3.05e-09 | 1.14e-16 | 4.46e-17 |
| 1. PB | Q5R866 | Kelch domain-containing protein 7A (Fragment) | 4.54e-06 | 2.54e-08 | 4.33e-89 |
| 1. PB | Q5ZLD3 | Kelch-like protein 13 | 3.44e-08 | 1.19e-20 | 4.52e-21 |
| 1. PB | P32206 | Protein C13 | NA | 1.18e-10 | 5.59e-05 |
| 1. PB | Q5RGB8 | Kelch-like protein 26 | 1.06e-11 | 7.16e-18 | 5.38e-18 |
| 1. PB | Q8BWA5 | Kelch-like protein 31 | 1.93e-08 | 1.91e-19 | 1.38e-14 |
| 1. PB | F1MBP6 | Kelch-like protein 3 | 7.90e-09 | 1.51e-14 | 5.27e-10 |
| 1. PB | Q684M4 | Kelch-like ECH-associated protein 1 | 3.20e-09 | 1.10e-17 | 2.04e-16 |
| 1. PB | Q5ZKD9 | Kelch-like protein 20 | 5.84e-09 | 1.65e-13 | 2.26e-18 |
| 1. PB | B3NDN0 | Kelch-like protein diablo | 2.82e-09 | 1.16e-16 | 1.25e-18 |
| 1. PB | Q7QGL0 | Kelch-like protein diablo | 6.55e-10 | 5.50e-10 | 9.81e-18 |
| 1. PB | O94819 | Kelch repeat and BTB domain-containing protein 11 | 0 | 2.93e-150 | 0.0 |
| 1. PB | Q8IY47 | Kelch repeat and BTB domain-containing protein 2 | 3.42e-09 | 1.89e-11 | 9.46e-08 |
| 1. PB | Q3UQV5 | Kelch repeat and BTB domain-containing protein 8 | 6.73e-09 | 1.08e-18 | 1.39e-14 |
| 1. PB | D3ZZC3 | Kelch-like protein 22 | 1.12e-08 | 3.41e-15 | 3.52e-14 |
| 1. PB | Q3ZB90 | Kelch repeat and BTB domain-containing protein 12 | 2.73e-08 | 6.54e-13 | 1.70e-05 |
| 1. PB | Q8IXQ5 | Kelch-like protein 7 | 1.81e-09 | 4.82e-16 | 5.29e-08 |
| 1. PB | Q9UH77 | Kelch-like protein 3 | 3.98e-10 | 1.86e-14 | 6.78e-10 |
| 1. PB | Q3U410 | Kelch-like protein 21 | 1.88e-11 | 3.39e-17 | 4.44e-20 |
| 1. PB | E9Q4F2 | Kelch-like protein 18 | 5.51e-10 | 7.34e-10 | 3.01e-23 |
| 1. PB | O35709 | Ectoderm-neural cortex protein 1 | 6.41e-08 | 1.41e-16 | 0.003 |
| 1. PB | Q6Q7X9 | Kelch-like protein 31 | 1.34e-09 | 8.26e-20 | 6.98e-13 |
| 1. PB | Q8BUL5 | Kelch-like protein 7 | 1.77e-10 | 1.11e-15 | 1.17e-06 |
| 1. PB | Q6JEL2 | Kelch-like protein 10 | 9.91e-09 | 2.62e-13 | 2.93e-18 |
| 1. PB | Q2M0J9 | Kelch-like protein diablo | 1.89e-10 | 3.47e-16 | 1.93e-18 |
| 1. PB | Q8QQ16 | Kelch repeat and BTB domain-containing protein 1 | NA | 6.05e-09 | 0.002 |
| 1. PB | Q9CA63 | F-box/kelch-repeat protein At1g74510 | 1.18e-04 | 2.64e-02 | 0.022 |
| 1. PB | Q8N4N3 | Kelch-like protein 36 | 7.79e-12 | 2.28e-15 | 1.92e-14 |
| 1. PB | Q5U374 | Kelch-like protein 12 | 5.01e-10 | 2.16e-09 | 1.66e-10 |
| 1. PB | Q9H2C0 | Gigaxonin | 5.66e-10 | 1.91e-16 | 3.99e-09 |
| 1. PB | Q3B7M1 | Kelch-like protein 36 | 1.28e-10 | 8.71e-16 | 1.75e-14 |
| 1. PB | Q28068 | Calicin | 1.35e-09 | 7.10e-11 | 3.78e-04 |
| 1. PB | Q8WVZ9 | Kelch repeat and BTB domain-containing protein 7 | 1.50e-07 | 1.01e-18 | 1.94e-06 |
| 1. PB | Q5U575 | Kelch-like protein 21 | 1.03e-09 | 2.54e-17 | 4.62e-13 |
| 1. PB | Q5RG82 | Influenza virus NS1A-binding protein homolog A | 1.42e-07 | 5.08e-07 | 1.64e-16 |
| 1. PB | Q8BHI4 | Kelch repeat and BTB domain-containing protein 3 | 2.51e-09 | 5.08e-17 | 2.28e-14 |
| 1. PB | F1LZ52 | Kelch-like protein 3 | 4.26e-09 | 4.52e-16 | 4.96e-10 |
| 1. PB | D2HEW7 | Kelch-like protein 22 | 2.55e-10 | 7.62e-15 | 2.50e-13 |
| 1. PB | Q6NYM1 | Kelch-like protein 21 | 1.37e-11 | 1.11e-15 | 1.29e-17 |
| 1. PB | Q6DFF6 | Kelch-like protein 20 | 4.58e-09 | 2.81e-12 | 2.75e-17 |
| 1. PB | P28575 | Actin-binding protein IPP | 2.71e-10 | 6.24e-11 | 4.35e-19 |
| 1. PB | A2APT9 | Kelch domain-containing protein 7A | 1.03e-06 | 2.64e-08 | 3.41e-89 |
| 1. PB | Q5R774 | Kelch-like ECH-associated protein 1 | 2.75e-09 | 9.79e-17 | 6.11e-17 |
| 1. PB | Q9P2N7 | Kelch-like protein 13 | 6.30e-09 | 1.63e-24 | 3.79e-19 |
| 1. PB | Q8WZ60 | Kelch-like protein 6 | 2.81e-09 | 1.91e-20 | 1.78e-06 |
| 1. PB | Q0D2A9 | Kelch-like protein 25 | 3.05e-08 | 1.03e-14 | 1.40e-04 |
| 1. PB | D3Z8N4 | Kelch-like protein 20 | 4.36e-09 | 2.25e-13 | 2.10e-17 |
| 1. PB | Q6PF15 | Kelch-like protein 35 | 3.95e-10 | 4.59e-22 | 6.69e-12 |
| 1. PB | Q6V595 | Kelch-like protein 6 | 2.18e-09 | 5.04e-21 | 1.38e-06 |
| 1. PB | Q6DEL7 | Kelch-like protein 15 | 1.11e-10 | 2.56e-11 | 1.09e-12 |
| 1. PB | Q8NAB2 | Kelch repeat and BTB domain-containing protein 3 | 8.93e-10 | 4.63e-15 | 3.09e-16 |
| 1. PB | D3ZA50 | Kelch-like protein 15 | 1.09e-10 | 1.84e-11 | 1.65e-12 |
| 1. PB | B4L0G9 | Kelch-like protein diablo | 4.14e-09 | 6.49e-16 | 1.93e-18 |
| 1. PB | P59280 | Kelch-like protein 8 | 5.22e-09 | 5.35e-17 | 1.70e-10 |
| 1. PB | Q8R2H4 | Kelch-like protein 12 | 5.12e-10 | 1.78e-10 | 2.63e-09 |
| 1. PB | B4HIK1 | Kelch-like protein diablo | 2.13e-09 | 1.06e-16 | 1.37e-18 |
| 1. PB | Q9NR64 | Kelch-like protein 1 | 4.70e-09 | 8.74e-12 | 9.37e-15 |
| 1. PB | Q96PQ7 | Kelch-like protein 5 | 1.57e-06 | 1.89e-05 | 1.17e-18 |
| 1. PB | Q6DFU2 | Influenza virus NS1A-binding protein homolog | 6.67e-08 | 8.08e-07 | 4.59e-11 |
| 1. PB | O14682 | Ectoderm-neural cortex protein 1 | 5.15e-08 | 7.74e-17 | 0.021 |
| 1. PB | Q5U504 | Kelch-like protein 40 | 1.39e-10 | 1.01e-10 | 8.05e-07 |
| 1. PB | Q8CDE2 | Calicin | 1.79e-09 | 7.20e-11 | 2.06e-08 |
| 1. PB | Q6JEL3 | Kelch-like protein 10 | 6.84e-10 | 8.62e-14 | 1.63e-18 |
| 1. PB | Q9Z2X8 | Kelch-like ECH-associated protein 1 | 2.31e-09 | 1.33e-17 | 2.10e-16 |
| 1. PB | Q08CY1 | Kelch-like protein 22 | 1.16e-09 | 9.95e-17 | 2.45e-15 |
| 1. PB | Q8BRG6 | Kelch-like protein 24 | 8.10e-11 | 3.92e-18 | 9.39e-14 |
| 1. PB | Q9NVR0 | Kelch-like protein 11 | 2.27e-05 | 1.41e-28 | 0.002 |
| 1. PB | Q9Y573 | Actin-binding protein IPP | 4.65e-10 | 1.45e-09 | 4.65e-10 |
| 1. PB | Q9CR40 | Kelch-like protein 28 | 5.30e-10 | 1.90e-07 | 1.28e-23 |
| 1. PB | Q2T9Z7 | Kelch-like protein 9 | 2.48e-10 | 1.01e-17 | 1.47e-19 |
| 1. PB | E1B932 | Kelch-like protein 12 | 5.23e-10 | 1.69e-11 | 2.86e-09 |
| 1. PB | Q5ZI33 | Kelch-like protein 7 | 2.18e-09 | 2.89e-16 | 3.70e-07 |
| 1. PB | Q5XI58 | Calicin | 1.55e-09 | 7.20e-11 | 1.02e-08 |
| 1. PB | Q08DS0 | Kelch-like protein 21 | 3.38e-11 | 1.39e-16 | 5.04e-12 |
| 1. PB | B4GRJ2 | Kelch-like protein diablo | 3.10e-09 | 2.07e-16 | 1.33e-18 |
| 1. PB | Q8BGY4 | Kelch-like protein 26 | 3.01e-10 | 4.50e-18 | 3.44e-15 |
| 1. PB | Q9Y6Y0 | Influenza virus NS1A-binding protein | 1.72e-07 | 1.30e-06 | 6.24e-13 |
| 1. PB | Q8R179 | Kelch repeat and BTB domain-containing protein 4 | 8.38e-11 | 1.54e-21 | 1.18e-06 |
| 1. PB | Q08DK3 | Kelch-like protein 20 | 2.60e-10 | 2.25e-13 | 2.10e-17 |
| 1. PB | C9JR72 | Kelch repeat and BTB domain-containing protein 13 | 1.60e-14 | 3.72e-12 | 8.35e-10 |
| 1. PB | Q9P2G3 | Kelch-like protein 14 | 1.51e-08 | 2.10e-24 | 1.93e-14 |
| 1. PB | Q9NXS3 | Kelch-like protein 28 | 7.38e-10 | 6.09e-08 | 1.49e-25 |
| 1. PB | Q9UJP4 | Kelch-like protein 21 | 1.60e-09 | 2.03e-17 | 1.02e-18 |
| 1. PB | B4LIG6 | Kelch-like protein diablo | 9.14e-10 | 1.40e-17 | 1.85e-18 |
| 1. PB | Q8R124 | Kelch-like protein 36 | 1.36e-10 | 2.68e-15 | 7.86e-14 |
| 1. PB | Q5R7B8 | Kelch-like protein 20 | 7.97e-10 | 1.11e-12 | 2.51e-17 |
| 1. PB | Q96M94 | Kelch-like protein 15 | 1.63e-10 | 2.88e-11 | 1.20e-12 |
| 1. PB | Q53G59 | Kelch-like protein 12 | 5.95e-10 | 1.29e-10 | 2.49e-09 |
| 1. PB | Q0GNQ5 | Kelch repeat and BTB domain-containing protein 1 | NA | 4.96e-09 | 6.07e-10 |
| 1. PB | Q53HC5 | Kelch-like protein 26 | 1.41e-11 | 4.26e-22 | 1.43e-13 |
| 1. PB | Q9P2J3 | Kelch-like protein 9 | 3.06e-09 | 7.54e-18 | 2.03e-20 |
| 1. PB | B1H285 | Kelch repeat and BTB domain-containing protein 8 | 2.41e-11 | 1.14e-13 | 1.20e-13 |
| 1. PB | Q8BZM0 | Kelch-like protein 12 | 5.15e-10 | 2.63e-10 | 4.31e-09 |
| 1. PB | Q9VUU5 | Kelch-like protein diablo | 2.27e-09 | 1.06e-16 | 1.37e-18 |
| 1. PB | P24768 | Kelch repeat and BTB domain-containing protein A55 | NA | 9.25e-09 | 2.54e-09 |
| 1. PB | Q8NBE8 | Kelch-like protein 23 | 1.45e-10 | 1.34e-09 | 5.10e-10 |
| 1. PB | O60662 | Kelch-like protein 41 | 1.52e-09 | 1.27e-10 | 4.04e-07 |
| 1. PB | Q69ZK5 | Kelch-like protein 14 | 3.00e-09 | 6.26e-24 | 2.52e-14 |
| 1. PB | Q8CA72 | Gigaxonin | 9.50e-10 | 4.16e-16 | 9.08e-09 |
| 1. PB | Q9D783 | Kelch-like protein 40 | 3.13e-09 | 2.06e-08 | 8.17e-04 |
| 1. PB | E9QJ30 | Kelch-like protein 40b | 1.16e-10 | 1.38e-09 | 1.55e-05 |
| 1. PB | B4PD06 | Kelch-like protein diablo | 2.54e-09 | 1.06e-16 | 1.37e-18 |
| 1. PB | P21073 | Kelch repeat and BTB domain-containing protein 1 | NA | 3.36e-09 | 2.05e-09 |
| 1. PB | D4A2K4 | Kelch-like protein 21 | 2.65e-11 | 3.75e-17 | 9.66e-20 |
| 1. PB | Q5RCQ9 | Kelch-like protein 23 | 3.20e-10 | 2.07e-09 | 1.17e-07 |
| 1. PB | P57790 | Kelch-like ECH-associated protein 1 | 2.70e-09 | 1.28e-17 | 2.34e-13 |
| 1. PB | Q4KLM4 | Kelch-like protein 25 | 8.36e-09 | 6.03e-14 | 8.52e-06 |
| 1. PB | Q5F3N5 | Kelch-like protein 14 | 2.31e-09 | 3.01e-20 | 9.50e-14 |
| 1. PB | E7F6F9 | Kelch-like protein 3 | 2.14e-11 | 5.41e-16 | 2.07e-10 |
| 1. PB | O72736 | Kelch repeat and BTB domain-containing protein 1 | NA | 2.86e-09 | 2.76e-08 |
| 1. PB | Q8N239 | Kelch-like protein 34 | 1.28e-08 | 8.38e-08 | 1.35e-07 |
| 1. PB | Q9D618 | Kelch repeat and BTB domain-containing protein 12 | 1.48e-08 | 3.67e-13 | 4.48e-07 |
| 1. PB | Q5R663 | Kelch repeat and BTB domain-containing protein 3 | 2.35e-08 | 7.74e-15 | 1.78e-09 |
| 1. PB | Q8R2P1 | Kelch-like protein 25 | 6.47e-09 | 2.89e-14 | 5.98e-06 |
| 1. PB | Q6DFF7 | Kelch-like protein 25 | 4.77e-08 | 7.62e-15 | 1.50e-08 |
| 1. PB | Q99JN2 | Kelch-like protein 22 | 2.36e-10 | 3.25e-15 | 1.31e-16 |
| 1. PB | E0CZ16 | Kelch-like protein 3 | 7.46e-09 | 1.29e-15 | 6.22e-10 |
| 1. PB | Q8C828 | Kelch repeat and BTB domain-containing protein 13 | 1.10e-14 | 3.78e-13 | 5.49e-11 |
| 1. PB | Q9D5V2 | Kelch-like protein 10 | 6.79e-10 | 8.10e-14 | 1.63e-18 |
| 1. PB | Q9JI74 | Kelch-like protein 1 | 8.65e-09 | 1.24e-11 | 1.34e-14 |
| 1. PB | O95198 | Kelch-like protein 2 | 3.03e-09 | 3.65e-14 | 1.24e-09 |
| 1. PB | A0A2R8Q1W5 | Kelch-like ECH-associated protein 1B | 5.91e-10 | 3.42e-11 | 4.22e-14 |
| 1. PB | Q6GQU2 | Kelch-like protein 23 | 9.68e-11 | 2.64e-09 | 2.68e-10 |
| 1. PB | Q8QMQ2 | Kelch repeat and BTB domain-containing protein 1 | NA | 1.17e-09 | 2.71e-08 |
| 1. PB | Q08CL3 | Kelch repeat and BTB domain-containing protein 8 | 6.24e-10 | 4.59e-16 | 2.89e-15 |
| 1. PB | Q6INL2 | Kelch-like protein 30 | 3.57e-10 | 6.62e-14 | 1.29e-04 |
| 1. PB | Q920Q8 | Influenza virus NS1A-binding protein homolog | 6.05e-08 | 1.59e-06 | 2.18e-13 |
| 1. PB | Q8C3F7 | Kelch-like protein 30 | 1.14e-11 | 4.31e-12 | 1.20e-12 |
| 1. PB | Q5XHZ6 | Kelch-like protein 7 | 7.67e-11 | 7.40e-16 | 7.84e-07 |
| 1. PB | Q9ER30 | Kelch-like protein 41 | 5.71e-11 | 3.78e-11 | 1.35e-08 |
| 1. PB | B3M9V8 | Kelch-like protein diablo | 9.92e-09 | 1.26e-17 | 1.19e-18 |
| 1. PB | Q5BK60 | Kelch-like protein 38 | 5.36e-12 | 3.54e-14 | 7.24e-06 |
| 1. PB | O94889 | Kelch-like protein 18 | 5.82e-10 | 4.92e-10 | 5.69e-24 |
| 1. PB | Q5ZJU2 | Kelch-like protein 15 | 5.09e-09 | 1.03e-12 | 3.02e-12 |
| 1. PB | Q56A24 | Kelch-like protein 24 | 9.36e-12 | 3.92e-18 | 9.39e-14 |
| 1. PB | Q8JL69 | Kelch repeat and BTB domain-containing protein 1 | NA | 5.37e-09 | 2.46e-08 |
| 1. PB | Q96G42 | Kelch domain-containing protein 7B | 2.06e-08 | 1.06e-34 | 4.45e-93 |
| 1. PB | Q6TDP3 | Kelch-like protein 17 | 1.67e-09 | 2.69e-21 | 7.61e-15 |
| 1. PB | Q6NRH0 | Kelch-like protein 12 | 4.89e-10 | 1.22e-08 | 5.23e-09 |
| 1. PB | Q503R4 | Kelch-like protein 36 | 1.01e-10 | 2.21e-12 | 7.76e-17 |
| 1. PB | Q9H511 | Kelch-like protein 31 | 1.21e-08 | 1.88e-19 | 3.08e-12 |
| 1. PB | Q5EB39 | Kelch-like protein 40 | 1.31e-10 | 4.34e-10 | 8.70e-06 |
| 1. PB | A6QQY2 | Kelch-like protein 13 | 8.56e-09 | 1.80e-24 | 3.79e-19 |
| 1. PB | Q86V97 | Kelch repeat and BTB domain-containing protein 6 | 3.21e-08 | 5.93e-18 | 6.05e-06 |
| 1. PB | Q1ECZ2 | Kelch-like ECH-associated protein 1A | 6.21e-10 | 2.28e-12 | 2.01e-20 |
| 1. PB | B4MXW3 | Kelch-like protein diablo | 1.03e-08 | 4.62e-14 | 3.42e-18 |
| 1. PB | Q6TDP4 | Kelch-like protein 17 | 2.21e-10 | 4.59e-22 | 1.06e-14 |
| 1. PB | Q6ZPT1 | Kelch-like protein 9 | 6.29e-12 | 9.59e-18 | 4.74e-20 |
| 1. PB | Q7ZVQ8 | Influenza virus NS1A-binding protein homolog B | 2.11e-07 | 6.49e-07 | 2.99e-15 |
| 1. PB | F1QEG2 | Kelch-like protein 41b | 1.16e-10 | 3.33e-08 | 3.27e-04 |
| 1. PB | Q8K430 | Kelch-like protein 17 | 4.49e-09 | 2.69e-21 | 7.61e-15 |
| 1. PB | Q5RDY3 | Kelch repeat and BTB domain-containing protein 2 | 2.97e-09 | 7.62e-11 | 1.69e-13 |
| 1. PB | Q80TF4 | Kelch-like protein 13 | 9.96e-09 | 1.17e-24 | 4.64e-18 |
| 1. PB | Q8NFY9 | Kelch repeat and BTB domain-containing protein 8 | 3.85e-09 | 3.13e-18 | 2.04e-14 |
| 1. PB | B4QLQ2 | Kelch-like protein diablo | 2.57e-09 | 6.88e-17 | 1.00e-17 |
| 1. PB | Q5R4S6 | Kelch repeat and BTB domain-containing protein 4 | 1.46e-09 | 3.47e-16 | 2.36e-05 |
| 1. PB | Q53GT1 | Kelch-like protein 22 | 1.64e-09 | 3.41e-15 | 1.44e-13 |
| 1. PB | Q0D2K2 | Kelch-like protein 30 | 1.08e-10 | 6.24e-12 | 8.71e-11 |
| 1. PB | Q3ZCT8 | Kelch repeat and BTB domain-containing protein 12 | 1.05e-07 | 1.96e-13 | 1.17e-07 |
| 1. PB | Q13939 | Calicin | 1.66e-09 | 3.05e-11 | 1.11e-10 |
| 1. PB | B0WWP2 | Kelch-like protein diablo | 7.19e-10 | 1.10e-10 | 5.39e-18 |
| 1. PB | Q8BSF5 | Kelch-like protein 38 | 1.66e-11 | 7.72e-13 | 1.28e-05 |
| 1. PB | Q9P2G9 | Kelch-like protein 8 | 1.06e-09 | 6.12e-17 | 1.51e-10 |
| 1. PB | B4J045 | Kelch-like protein diablo | 2.09e-09 | 5.59e-16 | 1.44e-18 |
| 1. PB | Q9H0H3 | Kelch-like protein 25 | 3.91e-08 | 2.64e-15 | 4.77e-07 |
| 1. PB | Q9P2K6 | Kelch-like protein 42 | 0.00e+00 | 4.42e-15 | 2.57e-27 |
| 1. PB | Q96NJ5 | Kelch-like protein 32 | 5.27e-10 | 1.17e-14 | 1.26e-14 |
| 1. PB | F1LZF0 | Kelch-like protein 2 | 4.03e-09 | 5.49e-14 | 1.56e-09 |
| 1. PB | Q9N010 | Kelch repeat and BTB domain-containing protein 4 | 4.74e-10 | 4.59e-22 | 1.36e-05 |
| 1. PB | Q8CE33 | Kelch-like protein 11 | 3.99e-05 | 1.87e-26 | 7.65e-04 |
| 1. PB | Q2WGJ6 | Kelch-like protein 38 | 2.04e-10 | 1.69e-12 | 2.84e-07 |
| 1. PB | Q66HD2 | Kelch-like protein 36 | 7.65e-11 | 2.13e-15 | 6.21e-14 |
| 1. PB | G5ED84 | Kelch-like protein 8 | 3.10e-09 | 9.93e-18 | 3.01e-07 |
| 1. PB | Q2TBA0 | Kelch-like protein 40 | 1.20e-10 | 8.38e-08 | 8.90e-06 |
| 1. PB | Q8VCK5 | Kelch-like protein 20 | 1.01e-09 | 4.19e-12 | 3.37e-17 |
| 2. P | Q10579 | Spermatocyte protein spe-26 | 1.20e-07 | 3.32e-09 | NA |
| 2. P | Q67XN8 | F-box/kelch-repeat protein At4g39560 | 2.57e-05 | 3.15e-02 | NA |
| 2. P | O82376 | Putative F-box/kelch-repeat protein At2g29800 | 2.72e-06 | 2.02e-02 | NA |
| 2. P | O72756 | Kelch repeat and BTB domain-containing protein 2 | NA | 1.67e-08 | NA |
| 2. P | Q8V2Z3 | Kelch repeat protein C2 | NA | 2.95e-07 | NA |
| 2. P | O75529 | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L | 2.80e-03 | 2.14e-02 | NA |
| 2. P | Q9JFG1 | Kelch repeat protein C2 | NA | 2.84e-07 | NA |
| 2. P | P53699 | Cell division control protein 4 | 4.84e-04 | 1.48e-02 | NA |
| 2. P | P24357 | Kelch repeat protein F3 | NA | 1.95e-08 | NA |
| 2. P | P07834 | Cell division control protein 4 | 1.87e-03 | 3.28e-02 | NA |
| 2. P | P08073 | Kelch repeat protein M-T9 | NA | 8.42e-10 | NA |
| 2. P | P17371 | Kelch repeat protein C2 | NA | 2.70e-07 | NA |
| 2. P | Q61FW2 | F-box/WD repeat-containing protein sel-10 | 2.55e-03 | 3.28e-02 | NA |
| 2. P | Q0GNN1 | Kelch repeat and BTB domain-containing protein 2 | NA | 4.76e-09 | NA |
| 2. P | Q6RZS3 | Kelch repeat protein C2 | NA | 1.03e-07 | NA |
| 2. P | Q8L736 | F-box/kelch-repeat protein SKIP11 | 1.85e-04 | 3.51e-07 | NA |
| 2. P | O95897 | Noelin-2 | 3.66e-03 | 4.38e-03 | NA |
| 2. P | P21037 | Kelch repeat protein C2 | NA | 2.38e-07 | NA |
| 2. P | Q8QMN3 | Kelch repeat and BTB domain-containing protein 2 | NA | 3.45e-09 | NA |
| 2. P | P32228 | Protein C4 | NA | 7.20e-09 | NA |
| 2. P | O57174 | Kelch repeat protein F3 | NA | 2.71e-09 | NA |
| 2. P | P87617 | Kelch repeat protein C2 | NA | 1.26e-07 | NA |
| 2. P | P34569 | Kelch repeat-containing protein kel-10 | 1.83e-09 | 3.78e-13 | NA |
| 2. P | Q9IAK4 | Noelin | 2.53e-03 | 2.09e-04 | NA |
| 2. P | Q62609 | Noelin | 7.70e-03 | 8.84e-04 | NA |
| 2. P | Q9JFS4 | Kelch repeat and BTB domain-containing protein 2 | NA | 7.79e-09 | NA |
| 2. P | Q99784 | Noelin | 3.13e-03 | 1.00e-03 | NA |
| 2. P | O88998 | Noelin | 1.53e-03 | 1.45e-03 | NA |
| 2. P | Q55BF8 | RING finger domain and kelch repeat-containing protein DDB_G0271372 | 4.62e-02 | 1.05e-02 | NA |
| 2. P | Q9FII1 | F-box/kelch-repeat protein At5g42360 | 1.65e-04 | 3.07e-06 | NA |
| 2. P | Q8BM13 | Noelin-2 | 2.80e-03 | 7.70e-03 | NA |
| 2. P | Q8JLI4 | Kelch repeat protein C2 | NA | 1.24e-07 | NA |
| 2. P | Q09563 | Kelch repeat and BTB domain-containing protein F47D12.7 | 1.64e-09 | 2.14e-16 | NA |
| 2. P | P22611 | Kelch repeat protein M-T8 | NA | 4.83e-11 | NA |
| 2. P | Q9LI89 | F-box/kelch-repeat protein At3g27150 | 3.78e-05 | 5.73e-03 | NA |
| 2. P | P21013 | Kelch repeat protein F3 | NA | 5.71e-08 | NA |
| 2. P | Q9FII2 | F-box/kelch-repeat protein At5g42350 | 9.83e-04 | 4.49e-06 | NA |
| 2. P | Q776A6 | Kelch repeat protein C2 | NA | 2.95e-07 | NA |
| 3. B | Q8C726 | BTB/POZ domain-containing protein 9 | 6.92e-03 | NA | 0.029 |
| 3. B | Q25390 | Alpha-scruin | 2.94e-03 | NA | 3.07e-09 |
| 3. B | Q6ZWS8 | Speckle-type POZ protein | 9.18e-03 | NA | 4.31e-05 |
| 3. B | Q5RCW7 | Kelch domain-containing protein 8B | 9.75e-07 | NA | 0.035 |
| 3. B | Q93W93 | F-box/kelch-repeat protein At1g55270 | 6.34e-05 | NA | 0.001 |
| 3. B | Q5XIA9 | Kelch domain-containing protein 8B | 8.45e-07 | NA | 0.013 |
| 3. B | Q6YCH1 | TD and POZ domain-containing protein 5 | 6.87e-03 | NA | 1.66e-05 |
| 3. B | Q6P8B3 | Speckle-type POZ protein | 1.36e-03 | NA | 8.47e-05 |
| 3. B | Q5E9V5 | Kelch domain-containing protein 8B | 1.03e-06 | NA | 0.023 |
| 3. B | P41886 | BTB and MATH domain-containing protein 41 | 1.02e-02 | NA | 8.32e-06 |
| 3. B | Q8R0A2 | Zinc finger and BTB domain-containing protein 44 | 2.38e-01 | NA | 1.57e-06 |
| 3. B | Q5PQR3 | BTB/POZ domain-containing protein 9 | 7.38e-03 | NA | 0.007 |
| 3. B | Q96CT2 | Kelch-like protein 29 | 1.70e-06 | NA | 2.79e-08 |
| 3. B | Q5XKL5 | BTB/POZ domain-containing protein 8 | 1.57e-03 | NA | 1.70e-05 |
| 3. B | Q9FZJ3 | Putative F-box/kelch-repeat protein At1g27420 | 1.15e-08 | NA | 0.002 |
| 3. B | O43791 | Speckle-type POZ protein | 3.50e-03 | NA | 4.31e-05 |
| 3. B | Q9M2C9 | F-box/kelch-repeat protein SKIP4 | 2.03e-08 | NA | 7.43e-05 |
| 3. B | Q8NDN9 | RCC1 and BTB domain-containing protein 1 | 6.97e-04 | NA | 0.010 |
| 3. B | Q6YCH2 | TD and POZ domain-containing protein 4 | 3.02e-03 | NA | 3.82e-04 |
| 3. B | P0DMR5 | TD and POZ domain-containing protein 1 | 8.35e-03 | NA | 1.76e-04 |
| 3. B | Q7T330 | Speckle-type POZ protein | 4.50e-03 | NA | 1.01e-04 |
| 3. B | B7U179 | ARMADILLO BTB ARABIDOPSIS PROTEIN 1 | 1.31e-02 | NA | 0.001 |
| 3. B | Q9P2R3 | Rabankyrin-5 | 3.59e-02 | NA | 0.026 |
| 3. B | P52739 | Zinc finger protein 131 | 7.15e-01 | NA | 0.005 |
| 3. B | Q60821 | Zinc finger and BTB domain-containing protein 17 | 5.74e-01 | NA | 0.002 |
| 3. B | P97302 | Transcription regulator protein BACH1 | 8.14e-01 | NA | 0.008 |
| 3. B | Q9LM55 | F-box/kelch-repeat protein At1g22040 | 5.73e-07 | NA | 2.83e-04 |
| 3. B | Q25386 | Beta-scruin | 1.83e-03 | NA | 7.40e-05 |
| 3. B | Q9W2S3 | BTB/POZ domain-containing protein 9 | 1.60e-02 | NA | 3.62e-05 |
| 3. B | Q5TJE2 | Zinc finger and BTB domain-containing protein 22 | 4.63e-01 | NA | 0.005 |
| 3. B | O93567 | Zinc finger and BTB domain-containing protein 7A | 1.98e-01 | NA | 1.28e-05 |
| 3. B | Q8NCN2 | Zinc finger and BTB domain-containing protein 34 | 2.41e-01 | NA | 4.66e-05 |
| 3. B | Q9CAG8 | F-box/kelch-repeat protein At1g67480 | 4.19e-07 | NA | 5.13e-06 |
| 3. B | Q9Z0G7 | Zinc finger and BTB domain-containing protein 22 | 2.31e-01 | NA | 0.005 |
| 3. B | Q0WW40 | F-box/kelch-repeat protein At1g16250 | 4.77e-08 | NA | 3.61e-04 |
| 3. B | Q5RAU9 | Zinc finger protein 131 | 7.42e-01 | NA | 0.005 |
| 3. B | Q9C6Z0 | F-box/kelch-repeat protein At1g30090 | 2.58e-07 | NA | 5.49e-05 |
| 3. B | Q90850 | Hypermethylated in cancer 1 protein (Fragment) | 6.65e-01 | NA | 4.69e-04 |
| 3. B | Q8K3J5 | Zinc finger protein 131 | 6.54e-01 | NA | 0.004 |
| 3. B | Q8IXV7 | Kelch domain-containing protein 8B | 1.14e-06 | NA | 0.035 |
| 3. B | Q9M0E6 | F-box/kelch-repeat protein At4g29370 | 2.93e-07 | NA | 0.019 |
| 3. B | Q5NVK7 | Speckle-type POZ protein | 1.46e-02 | NA | 4.31e-05 |
| 3. B | Q0IHH9 | Speckle-type POZ protein B | 2.60e-03 | NA | 8.70e-05 |
| 3. B | Q9SJ85 | BTB/POZ domain-containing protein At2g04740 | 1.81e-03 | NA | 0.007 |
| 3. B | O95365 | Zinc finger and BTB domain-containing protein 7A | 9.23e-02 | NA | 4.72e-05 |
| 3. B | Q8LAW2 | F-box protein AFR | 9.20e-08 | NA | 0.005 |
| 3. B | Q8IYD2 | Kelch domain-containing protein 8A | 7.50e-08 | NA | 3.03e-05 |
| 3. B | Q810B6 | Rabankyrin-5 | 3.82e-02 | NA | 0.017 |
| 3. B | Q0P4X6 | Zinc finger and BTB domain-containing protein 44 | 2.44e-01 | NA | 1.23e-05 |
| 3. B | D3YUB6 | BTB/POZ domain-containing protein 8 | 1.79e-03 | NA | 8.61e-05 |
| 3. B | O88939 | Zinc finger and BTB domain-containing protein 7A | 5.56e-02 | NA | 4.58e-05 |
| 3. B | Q96Q07 | BTB/POZ domain-containing protein 9 | 7.56e-03 | NA | 0.008 |
| 3. B | Q969K4 | Ankyrin repeat and BTB/POZ domain-containing protein 1 | 6.33e-04 | NA | 0.003 |
| 3. B | Q8NCP5 | Zinc finger and BTB domain-containing protein 44 | 2.64e-01 | NA | 1.62e-06 |
| 3. B | Q5TC79 | Zinc finger and BTB domain-containing protein 37 | 1.30e-01 | NA | 1.53e-04 |
| 3. B | Q7ZX06 | Speckle-type POZ protein A | 8.17e-03 | NA | 8.47e-05 |
| 3. B | P0DMR6 | TD and POZ domain-containing protein 1-like | 9.31e-03 | NA | 1.94e-04 |
| 3. B | Q6NXM2 | RCC1 and BTB domain-containing protein 1 | 9.48e-04 | NA | 0.012 |
| 3. B | Q91XA8 | Kelch domain-containing protein 8A | 6.80e-08 | NA | 1.44e-05 |
| 3. B | Q0VCW1 | Speckle-type POZ protein | 3.02e-03 | NA | 4.31e-05 |
| 3. B | A4IFG2 | BTB/POZ domain-containing protein 9 | 6.92e-03 | NA | 0.016 |
| 3. B | Q9VFP2 | Protein roadkill | 7.98e-03 | NA | 1.91e-04 |
| 3. B | Q04652 | Ring canal kelch protein | NA | NA | 1.39e-10 |
| 3. B | Q13105 | Zinc finger and BTB domain-containing protein 17 | 6.38e-01 | NA | 0.001 |
| 3. B | O15209 | Zinc finger and BTB domain-containing protein 22 | 5.18e-01 | NA | 0.005 |
| 3. B | Q717B4 | TD and POZ domain-containing protein 3 | 1.06e-02 | NA | 1.28e-04 |
| 3. B | Q70JS2 | Ring canal kelch homolog | NA | NA | 2.66e-15 |
| 3. B | Q6NPN5 | F-box/kelch-repeat protein At5g26960 | 2.71e-08 | NA | 0.014 |
| 3. B | Q9D2D9 | Kelch domain-containing protein 8B | 9.35e-07 | NA | 0.012 |
| 3. B | Q9QZ48 | Zinc finger and BTB domain-containing protein 7A | 5.19e-02 | NA | 1.05e-05 |
| 3. B | Q3SWU4 | Zinc finger and BTB domain-containing protein 44 | 3.53e-01 | NA | 7.30e-07 |
| 3. B | Q80T74 | Kelch-like protein 29 | 7.95e-07 | NA | 1.54e-07 |
| 3. B | Q717B2 | TD and POZ domain-containing protein 2 | 3.15e-03 | NA | 1.60e-06 |
| 3. B | Q0D1P4 | Kelch-like protein terF | 4.25e-06 | NA | 1.09e-05 |