Summary

O95278

Homolog: Q9WUA5.
Function: Laforin.

Statistics

Total GO Annotation: 136
Unique PROST Go: 26
Unique BLAST Go: 57

Total Homologs: 46
Unique PROST Homologs: 13
Unique BLAST Homologs: 29

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q9WUA5 (Laforin) with a FATCAT P-Value: 0.0 and RMSD of 0.45 angstrom. The sequence alignment identity is 89.5%.
Structural alignment shown in left. Query protein O95278 colored as red in alignment, homolog Q9WUA5 colored as blue. Query protein O95278 is also shown in right top, homolog Q9WUA5 showed in right bottom. They are colored based on secondary structures. 

  O95278 MRFRFGVVVPPAVAGARPELLVVGSRPELGRWEPRGAVRLRPAGTAAGDGALALQEPGLWLGEVELAA-EEAAQDGAEPGRVDTFWYKFLKREPGGELSW 99
  Q9WUA5 MLFRFGVVVPPAVAGARQELLLAGSRPELGRWEPHGAVRLRPAGTAAGAAALALQEPGLWLAEVELEAYEEAG--GAEPGRVDTFWYKFLQREPGGELHW 98

  O95278 EGNGPHHDRCCTYNENNLVDGVYCLPIGHWIEATGHTNEMKHTTDFYFNIAGHQAMHYSRILPNIWLGSCPRQVEHVTIKLKHELGITAVMNFQTEWDIV 199
  Q9WUA5 EGNGPHHDRCCTYNEDNLVDGVYCLPVGHWIEATGHTNEMKHTTDFYFNIAGHQAMHYSRILPNIWLGSCPRQLEHVTIKLKHELGVTAVMNFQTEWDII 198

  O95278 QNSSGCNRYPEPMTPDTMIKLYREEGLAYIWMPTPDMSTEGRVQMLPQAVCLLHALLEKGHIVYVHCNAGVGRSTAAVCGWLQYVMGWNLRKVQYFLMAK 299
  Q9WUA5 QNSSGCNRYPEPMTPDTMMKLYKEEGLSYIWMPTPDMSTEGRVQMLPQAVCLLHALLENGHTVYVHCNAGVGRSTAAVCGWLHYVIGWNLRKVQYFIMAK 298

  O95278 RPAVYIDEEALARAQEDFFQKFGKVRSSVCSL 331
  Q9WUA5 RPAVYIDEDALAQAQQDFSQKFGKVHSSICAL 330

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0005844 polysome
1. PB GO:0016239 positive regulation of macroautophagy
1. PB GO:1904666 regulation of ubiquitin protein ligase activity
1. PB GO:0016055 Wnt signaling pathway
1. PB GO:0016791 phosphatase activity
1. PB GO:0106307
1. PB GO:2000465 regulation of glycogen (starch) synthase activity
1. PB GO:0031396 regulation of protein ubiquitination
1. PB GO:0030246 carbohydrate binding
1. PB GO:0045786 negative regulation of cell cycle
1. PB GO:0010923 negative regulation of phosphatase activity
1. PB GO:0045859 regulation of protein kinase activity
1. PB GO:0014009 glial cell proliferation
1. PB GO:0007005 mitochondrion organization
1. PB GO:0046959 habituation
1. PB GO:0046838 phosphorylated carbohydrate dephosphorylation
1. PB GO:0006816 calcium ion transport
1. PB GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
1. PB GO:0001932 regulation of protein phosphorylation
1. PB GO:0098556 cytoplasmic side of rough endoplasmic reticulum membrane
1. PB GO:0005977 glycogen metabolic process
1. PB GO:0033137 negative regulation of peptidyl-serine phosphorylation
1. PB GO:2001070 starch binding
1. PB GO:0016311 dephosphorylation
1. PB GO:0061136 regulation of proteasomal protein catabolic process
1. PB GO:0019203 carbohydrate phosphatase activity
1. PB GO:0042325 regulation of phosphorylation
1. PB GO:0046835 carbohydrate phosphorylation
1. PB GO:0006470 protein dephosphorylation
1. PB GO:0004725 protein tyrosine phosphatase activity
1. PB GO:0030425 dendrite
1. PB GO:2001069 glycogen binding
1. PB GO:0035305 negative regulation of dephosphorylation
1. PB GO:0042306 regulation of protein import into nucleus
1. PB GO:0035335 peptidyl-tyrosine dephosphorylation
1. PB GO:0044260 cellular macromolecule metabolic process
1. PB GO:0010629 negative regulation of gene expression
1. PB GO:0015813 L-glutamate transmembrane transport
1. PB GO:0008138 protein tyrosine/serine/threonine phosphatase activity
1. PB GO:0004721 phosphoprotein phosphatase activity
1. PB GO:0032007 negative regulation of TOR signaling
1. PB GO:0098554 cytoplasmic side of endoplasmic reticulum membrane
1. PB GO:0043204 perikaryon
1. PB GO:0106306
1. PB GO:1903076 regulation of protein localization to plasma membrane
1. PB GO:0000045 autophagosome assembly
1. PB GO:0001558 regulation of cell growth
1. PB GO:0030247 polysaccharide binding
1. PB GO:0006914 autophagy
1. PB GO:0004722 protein serine/threonine phosphatase activity
1. PB GO:0005978 glycogen biosynthetic process
1. PB GO:0005654 nucleoplasm
1. PB GO:0004373 glycogen (starch) synthase activity
2. P GO:0070373 negative regulation of ERK1 and ERK2 cascade
2. P GO:0000122 negative regulation of transcription by RNA polymerase II
2. P GO:0008579 JUN kinase phosphatase activity
2. P GO:0034053 modulation by symbiont of host defense-related programmed cell death
2. P GO:0052845 inositol-5-diphosphate-1,2,3,4,6-pentakisphosphate diphosphatase activity
2. P GO:0007399 nervous system development
2. P GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
2. P GO:0005794 Golgi apparatus
2. P GO:0040038 polar body extrusion after meiotic divisions
2. P GO:0030866 cortical actin cytoskeleton organization
2. P GO:0052847 inositol-1,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 5-diphosphatase activity
2. P GO:0008486 diphosphoinositol-polyphosphate diphosphatase activity
2. P GO:0106211 inositol-5-diphosphate-1,3,4,6-tetrakisphosphate diphosphatase activity
2. P GO:0004647
2. P GO:0044387 negative regulation of protein kinase activity by regulation of protein phosphorylation
2. P GO:0010468 regulation of gene expression
2. P GO:0030703 eggshell formation
2. P GO:0002039 p53 binding
2. P GO:0004860 protein kinase inhibitor activity
2. P GO:0046855 inositol phosphate dephosphorylation
2. P GO:0006469 negative regulation of protein kinase activity
2. P GO:1902310 positive regulation of peptidyl-serine dephosphorylation
2. P GO:0043405 regulation of MAP kinase activity
2. P GO:0045785 positive regulation of cell adhesion
2. P GO:0005938 cell cortex
2. P GO:1904778 positive regulation of protein localization to cell cortex
3. B GO:0033133 positive regulation of glucokinase activity
3. B GO:0048364 root development
3. B GO:0050868 negative regulation of T cell activation
3. B GO:0002385 mucosal immune response
3. B GO:0045906 negative regulation of vasoconstriction
3. B GO:0030837 negative regulation of actin filament polymerization
3. B GO:0030336 negative regulation of cell migration
3. B GO:0005982 starch metabolic process
3. B GO:0035160 maintenance of epithelial integrity, open tracheal system
3. B GO:0007474 imaginal disc-derived wing vein specification
3. B GO:0009569 chloroplast starch grain
3. B GO:0007428 primary branching, open tracheal system
3. B GO:0007179 transforming growth factor beta receptor signaling pathway
3. B GO:0061388 regulation of rate of cell growth
3. B GO:0005983 starch catabolic process
3. B GO:0007623 circadian rhythm
3. B GO:0030036 actin cytoskeleton organization
3. B GO:1990782 protein tyrosine kinase binding
3. B GO:0120277 positive regulation of cerebral blood circulation
3. B GO:0043036 starch grain
3. B GO:0000188 obsolete inactivation of MAPK activity
3. B GO:0050860 negative regulation of T cell receptor signaling pathway
3. B GO:0046330 positive regulation of JNK cascade
3. B GO:0033550 MAP kinase tyrosine phosphatase activity
3. B GO:0045204 MAPK export from nucleus
3. B GO:1903996 negative regulation of non-membrane spanning protein tyrosine kinase activity
3. B GO:0045209 MAPK phosphatase export from nucleus, leptomycin B sensitive
3. B GO:2001242 regulation of intrinsic apoptotic signaling pathway
3. B GO:0033549 MAP kinase phosphatase activity
3. B GO:0050308 sugar-phosphatase activity
3. B GO:0019900 kinase binding
3. B GO:0017017 MAP kinase tyrosine/serine/threonine phosphatase activity
3. B GO:2001066 amylopectin binding
3. B GO:0002710 negative regulation of T cell mediated immunity
3. B GO:0023052 signaling
3. B GO:0004726 non-membrane spanning protein tyrosine phosphatase activity
3. B GO:0005829 cytosol
3. B GO:0035970 peptidyl-threonine dephosphorylation
3. B GO:0005634 nucleus
3. B GO:0001706 endoderm formation
3. B GO:0006655 phosphatidylglycerol biosynthetic process
3. B GO:0042127 regulation of cell population proliferation
3. B GO:0048713 regulation of oligodendrocyte differentiation
3. B GO:0031305 integral component of mitochondrial inner membrane
3. B GO:0004439 phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity
3. B GO:0032049 cardiolipin biosynthetic process
3. B GO:0061851 leading edge of lamellipodium
3. B GO:0008330 protein tyrosine/threonine phosphatase activity
3. B GO:0051895 negative regulation of focal adhesion assembly
3. B GO:0061179 negative regulation of insulin secretion involved in cellular response to glucose stimulus
3. B GO:0008962 phosphatidylglycerophosphatase activity
3. B GO:0071364 cellular response to epidermal growth factor stimulus
3. B GO:0046620 regulation of organ growth
3. B GO:0009501 amyloplast
3. B GO:0031941 filamentous actin
3. B GO:0051019 mitogen-activated protein kinase binding
3. B GO:0042059 negative regulation of epidermal growth factor receptor signaling pathway

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q9WUA5 Laforin 0.00e+00 2.72e-87 0.0
1. PB Q91XQ2 Laforin 0.00e+00 3.54e-90 0.0
1. PB Q1M199 Laforin 0.00e+00 9.03e-94 0.0
1. PB O95278 Laforin 0 1.25e-127 0.0
2. P Q5R6H6 Dual specificity protein phosphatase 26 9.39e-05 1.57e-02 NA
2. P Q79LY0 Effector protein hopD2 1.42e-02 1.20e-03 NA
2. P Q17QJ3 Dual specificity protein phosphatase 26 1.76e-04 3.28e-02 NA
2. P P34337 Putative tyrosine-protein phosphatase C15H7.3 6.79e-03 8.99e-05 NA
2. P P15273 Tyrosine-protein phosphatase YopH 9.62e-03 4.24e-03 NA
2. P P53965 Inositol phosphatase SIW14 1.03e-04 1.47e-08 NA
2. P Q54R42 Probable dual specificity protein phosphatase DDB_G0283417 1.07e-03 1.63e-04 NA
2. P O10274 Putative tyrosine-protein phosphatase 1 NA 1.56e-02 NA
2. P Q9BV47 Dual specificity protein phosphatase 26 3.66e-05 3.71e-02 NA
2. P P08538 Tyrosine-protein phosphatase YopH 5.32e-03 1.61e-03 NA
2. P O01767 Inactive protein-tyrosine phosphatase egg-4 2.91e-02 9.04e-03 NA
2. P Q9D700 Dual specificity protein phosphatase 26 9.30e-05 3.46e-02 NA
2. P O61789 Inactive protein-tyrosine phosphatase egg-5 1.03e-01 7.73e-03 NA
3. B Q9JIM4 Dual specificity protein phosphatase 12 5.22e-05 NA 0.007
3. B Q9D0T2 Dual specificity protein phosphatase 12 3.08e-06 NA 0.003
3. B Q6GQJ8 Dual specificity protein phosphatase 22 7.45e-08 NA 4.55e-04
3. B Q9ZQP1 Phosphatidylglycerophosphate phosphatase PTPMT1 1.78e-05 NA 0.008
3. B Q9SRK5 Phosphoglucan phosphatase LSF2, chloroplastic 2.48e-07 NA 3.91e-09
3. B Q5XIS1 Protein phosphatase Slingshot homolog 3 6.83e-03 NA 0.027
3. B G4LTX4 Phosphoglucan phosphatase DSP4, amyloplastic 8.03e-06 NA 2.55e-05
3. B O13632 Tyrosine-protein phosphatase yvh1 4.14e-05 NA 0.008
3. B Q84JU4 Protein-tyrosine-phosphatase IBR5 4.60e-04 NA 0.028
3. B O55737 Putative tyrosine phosphatase 123R NA NA 5.34e-07
3. B Q39491 Dual specificity protein phosphatase 4.43e-04 NA 7.75e-04
3. B Q8WUK0 Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 6.67e-08 NA 5.11e-04
3. B O54838 Dual specificity protein phosphatase 5 2.01e-03 NA 0.002
3. B F4J117 Phosphoglucan phosphatase LSF1, chloroplastic 1.33e-04 NA 1.60e-06
3. B Q9FEB5 Phosphoglucan phosphatase DSP4, chloroplastic 8.11e-06 NA 3.25e-06
3. B Q8K330 Protein phosphatase Slingshot homolog 3 5.13e-03 NA 0.018
3. B Q566R7 Dual specificity protein phosphatase 22-B 2.85e-08 NA 0.003
3. B Q9VVW5 Dual specificity protein phosphatase Mpk3 1.12e-03 NA 1.47e-04
3. B Q9BY84 Dual specificity protein phosphatase 16 1.06e-01 NA 1.86e-04
3. B Q66GT5 Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 3.66e-08 NA 0.007
3. B Q9H1R2 Dual specificity protein phosphatase 15 3.30e-06 NA 0.041
3. B Q5XHB2 Dual specificity protein phosphatase 22 6.87e-08 NA 2.33e-04
3. B Q9NRW4 Dual specificity protein phosphatase 22 2.99e-08 NA 0.007
3. B Q1LWL2 Dual specificity protein phosphatase 22-A 4.72e-08 NA 0.010
3. B Q16690 Dual specificity protein phosphatase 5 6.59e-03 NA 0.002
3. B Q99N11 Dual specificity protein phosphatase 22 2.26e-08 NA 0.008
3. B Q6NKR2 Phosphatidylglycerophosphate phosphatase PTPMT2 9.46e-05 NA 0.018
3. B Q86IG3 Phospholipid-inositol phosphatase NA NA 2.63e-07
3. B P0C089 Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 9.67e-11 NA 0.030