Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
Q9Z0F1
(Neuroendocrine secretory protein 55) with a FATCAT P-Value: 8.51e-06 and RMSD of 4.45 angstrom. The sequence alignment identity is 74.0%.
Structural alignment shown in left. Query protein O95467 colored as red in alignment, homolog Q9Z0F1 colored as blue.
Query protein O95467 is also shown in right top, homolog Q9Z0F1 showed in right bottom. They are colored based on secondary structures.
O95467 MDRRSRAQQWRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALATSNARAQQRAAAQQRRSFLNAHHRS-----GAQVFPESPESESDHEHEEADLEL 95 Q9Z0F1 MDRRSRAQQWRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALASSNARAQQRAA--QRRSFLNAHHRSAAAAAAAQVLPESSESESDHEHEEVEPEL 98 O95467 SLPECLEYEEEFDYETE--SET--ESEIESETDF----ETEPETAPTTEPETEPEDDRGPVVPKHSTFGQSLTQRLHALKLRSPDASPSRAPPSTQEPQS 187 Q9Z0F1 ARPECLEYDQD-DYETETDSETEPESDIESETEIETEPETEPETAPTTEPETEPEDERG---PRGATFNQSLTQRLHALKLQSADASPRRAQPTTQEPES 194 O95467 PREGEELK--PEDKDPRDPEESKEP---KEE-KQRRRCKPKKPT-RRDASPESPSKKGPIPIRRH 245 Q9Z0F1 ASEGEEPQRGPLDQDPRDPEE--EPEERKEENRQPRRCKTRRPARRRDQSPESPPRKGPIPIRRH 257
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0043014 | alpha-tubulin binding |
| 1. PB | GO:0048471 | perinuclear region of cytoplasm |
| 1. PB | GO:0005768 | endosome |
| 1. PB | GO:0005159 | insulin-like growth factor receptor binding |
| 1. PB | GO:0120162 | positive regulation of cold-induced thermogenesis |
| 1. PB | GO:0048701 | embryonic cranial skeleton morphogenesis |
| 1. PB | GO:0070527 | platelet aggregation |
| 1. PB | GO:0060789 | hair follicle placode formation |
| 1. PB | GO:0045669 | positive regulation of osteoblast differentiation |
| 1. PB | GO:0031224 | intrinsic component of membrane |
| 1. PB | GO:0045672 | positive regulation of osteoclast differentiation |
| 1. PB | GO:0031748 | D1 dopamine receptor binding |
| 1. PB | GO:0019904 | protein domain specific binding |
| 1. PB | GO:0071514 | genomic imprinting |
| 1. PB | GO:0051430 | corticotropin-releasing hormone receptor 1 binding |
| 1. PB | GO:0001958 | endochondral ossification |
| 1. PB | GO:0051216 | cartilage development |
| 1. PB | GO:0001934 | positive regulation of protein phosphorylation |
| 1. PB | GO:0010765 | positive regulation of sodium ion transport |
| 1. PB | GO:0030142 | COPI-coated Golgi to ER transport vesicle |
| 1. PB | GO:0007606 | sensory perception of chemical stimulus |
| 1. PB | GO:0007188 | adenylate cyclase-modulating G protein-coupled receptor signaling pathway |
| 1. PB | GO:0055074 | calcium ion homeostasis |
| 1. PB | GO:0045121 | membrane raft |
| 1. PB | GO:0071870 | cellular response to catecholamine stimulus |
| 1. PB | GO:0042493 | |
| 1. PB | GO:0045776 | negative regulation of blood pressure |
| 1. PB | GO:0009966 | regulation of signal transduction |
| 1. PB | GO:0055037 | recycling endosome |
| 1. PB | GO:0071107 | response to parathyroid hormone |
| 1. PB | GO:0001501 | skeletal system development |
| 1. PB | GO:0043025 | neuronal cell body |
| 1. PB | GO:0035116 | embryonic hindlimb morphogenesis |
| 1. PB | GO:0008284 | positive regulation of cell population proliferation |
| 1. PB | GO:0035255 | ionotropic glutamate receptor binding |
| 1. PB | GO:2000828 | regulation of parathyroid hormone secretion |
| 1. PB | GO:0005834 | heterotrimeric G-protein complex |
| 1. PB | GO:0001664 | G protein-coupled receptor binding |
| 1. PB | GO:0071380 | cellular response to prostaglandin E stimulus |
| 1. PB | GO:0035814 | negative regulation of renal sodium excretion |
| 1. PB | GO:0071880 | adenylate cyclase-activating adrenergic receptor signaling pathway |
| 1. PB | GO:0060348 | bone development |
| 1. PB | GO:0050890 | cognition |
| 1. PB | GO:0043950 | positive regulation of cAMP-mediated signaling |
| 1. PB | GO:0040015 | negative regulation of multicellular organism growth |
| 1. PB | GO:0048589 | developmental growth |
| 1. PB | GO:0007186 | G protein-coupled receptor signaling pathway |
| 1. PB | GO:0007191 | adenylate cyclase-activating dopamine receptor signaling pathway |
| 1. PB | GO:0030425 | dendrite |
| 1. PB | GO:0006306 | DNA methylation |
| 1. PB | GO:0010856 | adenylate cyclase activator activity |
| 1. PB | GO:0030133 | transport vesicle |
| 1. PB | GO:0009791 | post-embryonic development |
| 1. PB | GO:0031852 | mu-type opioid receptor binding |
| 1. PB | GO:0001894 | tissue homeostasis |
| 1. PB | GO:0006112 | energy reserve metabolic process |
| 1. PB | GO:0047391 | alkylglycerophosphoethanolamine phosphodiesterase activity |
| 1. PB | GO:0001965 | G-protein alpha-subunit binding |
| 1. PB | GO:0031683 | G-protein beta/gamma-subunit complex binding |
| 1. PB | GO:0007189 | adenylate cyclase-activating G protein-coupled receptor signaling pathway |
| 1. PB | GO:0032588 | trans-Golgi network membrane |
| 1. PB | GO:0031681 | G-protein beta-subunit binding |
| 1. PB | GO:0031698 | beta-2 adrenergic receptor binding |
| 1. PB | GO:0040032 | post-embryonic body morphogenesis |
| 1. PB | GO:0043588 | skin development |
| 1. PB | GO:0035264 | multicellular organism growth |
| 1. PB | GO:0001726 | ruffle |
| 2. P | GO:0046718 | viral entry into host cell |
| 2. P | GO:0006337 | nucleosome disassembly |
| 2. P | GO:0005576 | extracellular region |
| 2. P | GO:0016573 | histone acetylation |
| 2. P | GO:0019062 | virion attachment to host cell |
| 2. P | GO:0055036 | virion membrane |
| 2. P | GO:0030683 | mitigation of host immune response by virus |
| 2. P | GO:0020002 | host cell plasma membrane |
| 3. B | GO:0007565 | female pregnancy |
| 3. B | GO:0004222 | metalloendopeptidase activity |
| 3. B | GO:0005618 | cell wall |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | O95467 | Neuroendocrine secretory protein 55 | 0 | 5.22e-150 | 5.32e-176 |
| 1. PB | O18979 | Neuroendocrine secretory protein 55 | 3.56e-05 | 1.54e-70 | 3.61e-84 |
| 1. PB | Q9Z0F1 | Neuroendocrine secretory protein 55 | 8.51e-06 | 9.81e-51 | 2.81e-69 |
| 1. PB | Q792G6 | Neuroendocrine secretory protein 55 | 6.01e-05 | 2.75e-45 | 1.02e-77 |
| 2. P | P69351 | Major surface glycoprotein G | NA | 3.99e-02 | NA |
| 2. P | O10687 | Major surface glycoprotein G | NA | 2.95e-02 | NA |
| 2. P | P69350 | Major surface glycoprotein G | NA | 3.99e-02 | NA |
| 2. P | Q5UR42 | Uncharacterized protein R564 | NA | 4.35e-02 | NA |
| 2. P | B7W112 | Aspartic and glutamic acid-rich protein | 4.95e-02 | 4.91e-02 | NA |
| 2. P | P25629 | Putative uncharacterized protein YCR049C | 3.63e-01 | 2.63e-02 | NA |
| 2. P | Q6R7F0 | Uncharacterized protein ORF79 | NA | 3.63e-02 | NA |
| 2. P | Q8SRM1 | Histone chaperone ASF1 | 1.92e-01 | 4.07e-04 | NA |
| 2. P | Q80YD3 | Protein FAM205C | 5.20e-03 | 1.99e-02 | NA |
| 3. B | Q9L7Q2 | Zinc metalloprotease ZmpB | 9.61e-01 | NA | 0.003 |
| 3. B | Q8DQN5 | Zinc metalloprotease ZmpB | 9.84e-01 | NA | 0.013 |