Results | PROST

Summary

O95626

Homolog: Q6A1I3.
Function: Acidic leucine-rich nuclear phosphoprotein 32 family member B.

Statistics

Total GO Annotation: 113
Unique PROST Go: 55
Unique BLAST Go: 56

Total Homologs: 91
Unique PROST Homologs: 41
Unique BLAST Homologs: 48

Structures and Sequence Alignment

The best structural homolog that predicted by 3. B was Q6A1I3 (Acidic leucine-rich nuclear phosphoprotein 32 family member B) with a FATCAT P-Value: 0.0 and RMSD of 0.50 angstrom. The sequence alignment identity is 35.2%.
Structural alignment shown in left. Query protein O95626 colored as red in alignment, homolog Q6A1I3 colored as blue. Query protein O95626 is also shown in right top, homolog Q6A1I3 showed in right bottom. They are colored based on secondary structures.

  O95626 MEMGKWIHLELRNRTPSDVKELFLDNSQSNEGKLEGLTDEFEELELLNTINIGLTSIANLPKLNKLKKLELSSNRASVGLEVLAEKCPNLIHLNLSGNKI 100
  Q6A1I3 MDMKRRIHLELRNRTPAAVRELVLDNCKSNDGKIEGLTAEFVNLEFLSLINVGLISVSNLPKLPKLKKLELSDNRICGGLDMLAEKLPNLTHLNLSGNKL 100

  O95626 KDLSTIEPLKKLENLESLDLFTCEVTNLNNY--------------------------------------------------------------------- 131
  Q6A1I3 KDIGTLEPLKKLECLKSLDLFNCEVTNLNDYRESVFKLLPQLTYLDGYDREDREAPDSDAEVDGVDEEEDDEEGENEDKEEDEDGEEEEFDDEEDDDEDE 200

  O95626 ------------------------------------------------------------- 131
  Q6A1I3 DVEGEEDEDKVSGEEEEFGHDGEADEDDEDEDEDEDEDEEEEESGKGEGRKRETDDEGEDD 261

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Source	GO	Description
1. PB	GO:0005634	nucleus
1. PB	GO:0006913	nucleocytoplasmic transport
2. P	GO:0043014	alpha-tubulin binding
2. P	GO:0030286	dynein complex
2. P	GO:0034142	toll-like receptor 4 signaling pathway
2. P	GO:0006754	ATP biosynthetic process
2. P	GO:1901970	positive regulation of mitotic sister chromatid separation
2. P	GO:0016019	peptidoglycan immune receptor activity
2. P	GO:0005874	microtubule
2. P	GO:0004865	protein serine/threonine phosphatase inhibitor activity
2. P	GO:0045263	proton-transporting ATP synthase complex, coupling factor F(o)
2. P	GO:0060047	heart contraction
2. P	GO:0034612	response to tumor necrosis factor
2. P	GO:0042995	cell projection
2. P	GO:0036157	outer dynein arm
2. P	GO:0046696	lipopolysaccharide receptor complex
2. P	GO:0007023	post-chaperonin tubulin folding pathway
2. P	GO:0051602	response to electrical stimulus
2. P	GO:0036158	outer dynein arm assembly
2. P	GO:0001847	opsonin receptor activity
2. P	GO:0005743	mitochondrial inner membrane
2. P	GO:0031663	lipopolysaccharide-mediated signaling pathway
2. P	GO:0072357	PTW/PP1 phosphatase complex
2. P	GO:1901224	positive regulation of NIK/NF-kappaB signaling
2. P	GO:0035307	positive regulation of protein dephosphorylation
2. P	GO:0043231	intracellular membrane-bounded organelle
2. P	GO:0071727	cellular response to triacyl bacterial lipopeptide
2. P	GO:0051457	maintenance of protein location in nucleus
2. P	GO:0006898	receptor-mediated endocytosis
2. P	GO:0071219	cellular response to molecule of bacterial origin
2. P	GO:0031430	M band
2. P	GO:0023052	signaling
2. P	GO:0030667	secretory granule membrane
2. P	GO:0032026	response to magnesium ion
2. P	GO:0005694	chromosome
2. P	GO:0007021	tubulin complex assembly
2. P	GO:0032481	positive regulation of type I interferon production
2. P	GO:0055008	cardiac muscle tissue morphogenesis
2. P	GO:0045842	positive regulation of mitotic metaphase/anaphase transition
2. P	GO:0072542	protein phosphatase activator activity
2. P	GO:0071723	lipopeptide binding
2. P	GO:0019888	protein phosphatase regulator activity
2. P	GO:0045214	sarcomere organization
2. P	GO:0032757	positive regulation of interleukin-8 production
2. P	GO:0006811	ion transport
2. P	GO:0001530	lipopolysaccharide binding
2. P	GO:0000164	protein phosphatase type 1 complex
2. P	GO:0046600	negative regulation of centriole replication
2. P	GO:0070891	lipoteichoic acid binding
2. P	GO:0071726	cellular response to diacyl bacterial lipopeptide
2. P	GO:0045807	positive regulation of endocytosis
2. P	GO:0045504	dynein heavy chain binding
2. P	GO:0071223	cellular response to lipoteichoic acid
2. P	GO:0007165	signal transduction
2. P	GO:0004722	protein serine/threonine phosphatase activity
2. P	GO:0031362	anchored component of external side of plasma membrane
2. P	GO:0007059	chromosome segregation
3. B	GO:0048471	perinuclear region of cytoplasm
3. B	GO:0060021	roof of mouth development
3. B	GO:0001944	vasculature development
3. B	GO:0030336	negative regulation of cell migration
3. B	GO:0006334	nucleosome assembly
3. B	GO:0018344	protein geranylgeranylation
3. B	GO:0000398	mRNA splicing, via spliceosome
3. B	GO:0005654	nucleoplasm
3. B	GO:0005686	U2 snRNP
3. B	GO:0008217	regulation of blood pressure
3. B	GO:0005769	early endosome
3. B	GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process
3. B	GO:0019901	protein kinase binding
3. B	GO:0030036	actin cytoskeleton organization
3. B	GO:0010225	response to UV-C
3. B	GO:0016363	nuclear matrix
3. B	GO:0043549	regulation of kinase activity
3. B	GO:0055037	recycling endosome
3. B	GO:0043486	histone exchange
3. B	GO:0035091	phosphatidylinositol binding
3. B	GO:0042981	regulation of apoptotic process
3. B	GO:0060339	negative regulation of type I interferon-mediated signaling pathway
3. B	GO:0021591	ventricular system development
3. B	GO:0035067	negative regulation of histone acetylation
3. B	GO:0070063	RNA polymerase binding
3. B	GO:0045171	intercellular bridge
3. B	GO:0030532	small nuclear ribonucleoprotein complex
3. B	GO:0045345	positive regulation of MHC class I biosynthetic process
3. B	GO:0016601	Rac protein signal transduction
3. B	GO:0005783	endoplasmic reticulum
3. B	GO:0006006	glucose metabolic process
3. B	GO:0000812	Swr1 complex
3. B	GO:0005178	integrin binding
3. B	GO:0000389	mRNA 3'-splice site recognition
3. B	GO:0060340	positive regulation of type I interferon-mediated signaling pathway
3. B	GO:1900087	positive regulation of G1/S transition of mitotic cell cycle
3. B	GO:0006915	apoptotic process
3. B	GO:0015630	microtubule cytoskeleton
3. B	GO:0005968	Rab-protein geranylgeranyltransferase complex
3. B	GO:0007166	cell surface receptor signaling pathway
3. B	GO:0046827	positive regulation of protein export from nucleus
3. B	GO:0040022	feminization of hermaphroditic germ-line
3. B	GO:0002322	B cell proliferation involved in immune response
3. B	GO:0031410	cytoplasmic vesicle
3. B	GO:0019212	phosphatase inhibitor activity
3. B	GO:0030620	U2 snRNA binding
3. B	GO:0045596	negative regulation of cell differentiation
3. B	GO:0048243	norepinephrine secretion
3. B	GO:0032228	regulation of synaptic transmission, GABAergic
3. B	GO:0004663	Rab geranylgeranyltransferase activity
3. B	GO:0051729	germline cell cycle switching, mitotic to meiotic cell cycle
3. B	GO:0031666	positive regulation of lipopolysaccharide-mediated signaling pathway
3. B	GO:0060335	positive regulation of interferon-gamma-mediated signaling pathway
3. B	GO:0005681	spliceosomal complex
3. B	GO:0048839	inner ear development
3. B	GO:0042393	histone binding

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	Q64G17	Putative acidic leucine-rich nuclear phosphoprotein 32 family member C	0.00e+00	1.26e-50	2.45e-51
1. PB	O95626	Acidic leucine-rich nuclear phosphoprotein 32 family member D	0	9.17e-152	4.68e-88
2. P	Q4LDG9	Dynein axonemal light chain 1	2.45e-11	1.46e-10	NA
2. P	Q8TCA0	Leucine-rich repeat-containing protein 20	1.59e-08	2.01e-12	NA
2. P	Q3UM45	Protein phosphatase 1 regulatory subunit 7	2.48e-08	2.06e-04	NA
2. P	Q5XIM4	ATP synthase subunit s, mitochondrial	1.03e-03	4.19e-04	NA
2. P	Q641R9	Dynein axonemal light chain 1	4.03e-11	2.70e-08	NA
2. P	F1R6I3	Leucine-rich repeat-containing protein 39	7.17e-06	4.29e-04	NA
2. P	Q54Q39	Protein phosphatase 1 regulatory subunit pprA	1.81e-07	4.97e-02	NA
2. P	Q9XHH2	Dynein axonemal light chain 1	9.10e-11	3.88e-09	NA
2. P	Q28CU0	Leucine-rich repeat-containing protein 23	4.50e-07	6.46e-03	NA
2. P	Q6DHB1	Dynein axonemal light chain 1	3.15e-11	2.48e-09	NA
2. P	Q55CN0	Tubulin-specific chaperone E	5.11e-05	1.47e-02	NA
2. P	Q05A62	Dynein axonemal light chain 1	2.49e-11	5.14e-11	NA
2. P	P22194	Protein phosphatase 1 regulatory subunit SDS22	1.07e-07	4.29e-04	NA
2. P	A0A096MJZ0	Dynein axonemal light chain 1	2.44e-11	1.13e-11	NA
2. P	O06733	Uncharacterized protein YisX	8.58e-03	8.43e-03	NA
2. P	Q3UV48	Leucine-rich repeat-containing protein 30	1.23e-06	2.91e-02	NA
2. P	Q32PL1	Protein phosphatase 1 regulatory subunit 7	3.22e-08	3.96e-03	NA
2. P	Q9CRA7	ATP synthase subunit s, mitochondrial	1.27e-03	6.29e-04	NA
2. P	Q8T888	Dynein axonemal light chain 1	2.01e-11	1.59e-10	NA
2. P	Q5R9E6	ATP synthase subunit s, mitochondrial	1.04e-03	2.27e-04	NA
2. P	Q4R5S4	ATP synthase subunit s, mitochondrial	1.17e-03	3.23e-03	NA
2. P	P17778	Outer membrane protein YopM	9.18e-05	1.46e-02	NA
2. P	P36047	Protein phosphatase 1 regulatory subunit SDS22	8.25e-07	1.83e-06	NA
2. P	P73063	Uncharacterized protein slr1851	5.11e-03	2.59e-06	NA
2. P	Q15435	Protein phosphatase 1 regulatory subunit 7	1.61e-08	5.96e-05	NA
2. P	Q5HZV9	Protein phosphatase 1 regulatory subunit 7	2.33e-08	3.17e-05	NA
2. P	Q1RK82	Putative ankyrin repeat protein RBE_0151	8.15e-01	2.36e-02	NA
2. P	P08571	Monocyte differentiation antigen CD14	8.60e-04	6.14e-03	NA
2. P	Q28G94	Dynein axonemal light chain 1	3.24e-11	1.56e-08	NA
2. P	P45969	Protein phosphatase 1 regulatory subunit SDS22 homolog	6.72e-09	2.70e-04	NA
2. P	Q3T0W4	Protein phosphatase 1 regulatory subunit 7	2.23e-08	6.74e-05	NA
2. P	Q2KID4	Dynein axonemal light chain 1	2.67e-11	8.02e-11	NA
2. P	Q1RK83	Putative ankyrin repeat protein RBE_0150	7.15e-01	4.06e-04	NA
2. P	Q0P4D1	Protein AMN1 homolog	1.48e-06	1.73e-04	NA
2. P	A6NM36	Leucine-rich repeat-containing protein 30	1.12e-06	4.79e-03	NA
2. P	Q8CI70	Leucine-rich repeat-containing protein 20	1.72e-08	2.57e-10	NA
2. P	B6CZ40	Leucine-rich repeat-containing protein 51	2.35e-07	1.58e-02	NA
2. P	Q53EV4	Leucine-rich repeat-containing protein 23	3.18e-07	6.22e-04	NA
2. P	Q8VDB8	Leucine-rich repeat-containing protein 2	3.06e-05	1.12e-02	NA
2. P	Q55837	Uncharacterized protein slr0516	6.72e-03	5.39e-05	NA
2. P	Q5RFS7	Protein phosphatase 1 regulatory subunit 7	1.78e-08	5.36e-06	NA
3. B	Q6NUW5	Acidic leucine-rich nuclear phosphoprotein 32 family member E	0.00e+00	NA	1.12e-51
3. B	Q7TT36	Adhesion G protein-coupled receptor A3	1.31e-01	NA	0.011
3. B	Q92688	Acidic leucine-rich nuclear phosphoprotein 32 family member B	0.00e+00	NA	2.10e-50
3. B	Q8IWK6	Adhesion G protein-coupled receptor A3	1.40e-01	NA	0.015
3. B	Q5BGW9	U2 small nuclear ribonucleoprotein A'	3.63e-07	NA	5.30e-04
3. B	Q9SCQ7	Acidic leucine-rich nuclear phosphoprotein 32-related protein	4.36e-10	NA	1.55e-13
3. B	P43333	U2 small nuclear ribonucleoprotein A'	7.68e-10	NA	0.010
3. B	Q8ILI6	Acidic leucine-rich nuclear phosphoprotein 32-related protein	4.91e-11	NA	0.002
3. B	Q5XIE0	Acidic leucine-rich nuclear phosphoprotein 32 family member E	0.00e+00	NA	2.64e-49
3. B	Q5ZMN0	Acidic leucine-rich nuclear phosphoprotein 32 family member B	0.00e+00	NA	8.53e-54
3. B	Q6YSF3	Acidic leucine-rich nuclear phosphoprotein 32-related protein 1	2.22e-07	NA	3.67e-13
3. B	Q6PAF6	Acidic leucine-rich nuclear phosphoprotein 32 family member A	0.00e+00	NA	6.85e-58
3. B	O01615	Acidic leucine-rich nuclear phosphoprotein 32-related protein 2	0.00e+00	NA	7.12e-13
3. B	P51122	Acidic leucine-rich nuclear phosphoprotein 32 family member A	0.00e+00	NA	2.95e-64
3. B	Q9EST6	Acidic leucine-rich nuclear phosphoprotein 32 family member B	0.00e+00	NA	3.36e-45
3. B	Q5F4A3	Acidic leucine-rich nuclear phosphoprotein 32 family member E	0.00e+00	NA	1.47e-50
3. B	Q3SZC6	Acidic leucine-rich nuclear phosphoprotein 32 family member B	0.00e+00	NA	1.92e-50
3. B	Q8HY67	Acidic leucine-rich nuclear phosphoprotein 32 family member A	NA	NA	4.18e-64
3. B	Q99467	CD180 antigen	1.52e-03	NA	0.004
3. B	Q9EST5	Acidic leucine-rich nuclear phosphoprotein 32 family member B	0.00e+00	NA	1.21e-43
3. B	Q28XE2	Acidic leucine-rich nuclear phosphoprotein 32 family member A	0.00e+00	NA	3.55e-30
3. B	Q9FJ32	Geranylgeranyl transferase type-2 subunit alpha 2	2.56e-03	NA	0.014
3. B	O35381	Acidic leucine-rich nuclear phosphoprotein 32 family member A	0.00e+00	NA	2.82e-60
3. B	Q4G017	Nischarin	4.37e-02	NA	0.004
3. B	O43423	Acidic leucine-rich nuclear phosphoprotein 32 family member C	0.00e+00	NA	5.79e-63
3. B	Q9BTT0	Acidic leucine-rich nuclear phosphoprotein 32 family member E	0.00e+00	NA	1.96e-50
3. B	F4I9S3	Receptor-like protein 9a	5.40e-02	NA	0.011
3. B	Q7ZUP0	Acidic leucine-rich nuclear phosphoprotein 32 family member A	0.00e+00	NA	1.61e-61
3. B	Q8AVC1	Acidic leucine-rich nuclear phosphoprotein 32 family member B	0.00e+00	NA	3.37e-46
3. B	Q7ZY40	Acidic leucine-rich nuclear phosphoprotein 32 family member E	0.00e+00	NA	1.55e-49
3. B	C3VPR6	Protein NLRC5	2.64e-01	NA	0.002
3. B	Q7Y180	Acidic leucine-rich nuclear phosphoprotein 32-related protein 2	9.97e-14	NA	6.27e-13
3. B	P97822	Acidic leucine-rich nuclear phosphoprotein 32 family member E	0.00e+00	NA	2.67e-49
3. B	Q9C5D2	F-box/LRR-repeat protein 4	1.27e-03	NA	0.002
3. B	Q80TM9	Nischarin	2.49e-02	NA	0.006
3. B	P39687	Acidic leucine-rich nuclear phosphoprotein 32 family member A	0.00e+00	NA	4.51e-67
3. B	Q9BLB6	Probable U2 small nuclear ribonucleoprotein A'	5.51e-10	NA	1.91e-05
3. B	Q86QS6	Acidic leucine-rich nuclear phosphoprotein 32-related protein	0.00e+00	NA	3.70e-29
3. B	Q7AP87	Internalin H	7.95e-05	NA	0.002
3. B	Q4WV66	U2 small nuclear ribonucleoprotein A'	9.81e-10	NA	4.12e-04
3. B	P49911	Acidic leucine-rich nuclear phosphoprotein 32 family member A	0.00e+00	NA	3.01e-60
3. B	O62220	Acidic leucine-rich nuclear phosphoprotein 32-related protein 1	0.00e+00	NA	8.61e-15
3. B	Q9V4Q8	Probable U2 small nuclear ribonucleoprotein A'	5.28e-09	NA	1.11e-05
3. B	Q6A1I3	Acidic leucine-rich nuclear phosphoprotein 32 family member B	0.00e+00	NA	8.05e-50
3. B	Q8R2R5	Leucine-rich repeat-containing protein 61	7.34e-11	NA	0.045
3. B	Q9Y2I1	Nischarin	2.04e-02	NA	1.02e-04
3. B	Q6P1U7	Acidic leucine-rich nuclear phosphoprotein 32 family member B	0.00e+00	NA	5.77e-47
3. B	Q9V895	Acidic leucine-rich nuclear phosphoprotein 32 family member A	0.00e+00	NA	1.00e-29