Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
Q5PQJ9
(Coiled-coil domain-containing protein 175) with a FATCAT P-Value: 3.06e-12 and RMSD of 9.31 angstrom. The sequence alignment identity is 51.6%.
Structural alignment shown in left. Query protein P0C221 colored as red in alignment, homolog Q5PQJ9 colored as blue.
Query protein P0C221 is also shown in right top, homolog Q5PQJ9 showed in right bottom. They are colored based on secondary structures.
P0C221 MALSPWTPGLG-AGEKLVQAAAVSTGPSLELCTLPSTLGSSVAVEALEQLFVVEQSLQSDYFKCNEEAKIFLKDIAVAVKKLEEMRKATIDLLEIESMEL 99 Q5PQJ9 MAMRSWTPDQGFVDRKLVRPASVSTSLSLELCTFPSTLGSSVAANALEQLLVVEKSLQGDYFTCNEEVKTFLKDITVAVKKLEEMRKNTIELLEIESMEL 100 P0C221 NKLYYLLETLPNSIKRELEECVRDARRLNLFEINTIKMRITRTENEIELLKKKITDLTKYNEALGEKQEELARKHARFVLSLNQTMEKKATTTVYINETY 199 Q5PQJ9 SRLYFLLETVPNSMHKELQECILEARRLNILEISQVKGKIEKTNDEIKFLNDKIIELKNMNEALGIKQVELAKQHAKFVLLLNQTLEEKAVATICINDTY 200 P0C221 TKINLKREDIALQKKCIQEAEELMEKERAEYLIRKQELTAQINEFENTREVKRMETYQKKKELDKLQTKMSKIKETVTVSAAVLSDHNLEIARLHESIRY 299 Q5PQJ9 TRIKFEKEEIGLQKQCLQDATDLIEKHKQEHRKKKERLAERIKDVKQSCEEKRKEAYNKRKELTRLQNKIIKMKQTVTTNAVMINDKSLEIMRLRETADL 300 P0C221 WEQEVSELKKDLAILEAKLCFFTDNKEKLDDISNDEKNEFLNKIKQLVETLHAARMEYKDLREKMKTLARQYKIVLSEEEKAFLQKQKIHDENQKQLTFI 399 Q5PQJ9 WKKKVEDMKRVCESLEEKLLFFLTHKQQIDSVSSEKKSGFISQIQQVAEKLQKINKENKDLRDRLNTLLKQYKITLKEEEAMSLQRQKMAEEHQKQMELL 400 P0C221 SQKEYFLSQKRVDIKNMEEGLITLQELQQATKTVYQQQIKILSANLERESQRCVITQWKMACLRKKHARWTAKIKAEI-QAITEKIQNAEVRRIELLNET 498 Q5PQJ9 NQKETFLTQRKLDIKNMEEGFSTLRDLNVATKEVYRKQIKLLTENLERELQRWVVNQWRLLCSRKRHSRWLHKTKLTLRKIITE-IEIAEEKRRQLLKET 499 P0C221 SFRQQEISGFVAQIEKLTTELKEEEKAFVNKEKMLMKELSKYEEIFVKETQINKEKEEELVEYLPQLQVAEQEYKEKRRKLEELSNIITAQRQEEDLLNN 598 Q5PQJ9 KRRQKEISRFVNQIETIKEQLEVEEKEYIKKEKKLMKELNKYEDLIIKEAQINKVKEEQLVETLPRLQIAEDDFQEKSRTLKSLQNDISAKKQEETLLST 599 P0C221 HIFLFTRDFSRYISNMEDVKQELQQLRDQESKKNKDHFETLKNLENGFYINDQKADLLLLENKKLKEYILYLKNNIEKYREGQEALMHTSSDLSRQLIAQ 698 Q5PQJ9 YIFRYRKDIIRCTNNTETVKRDMRHIRTLESEKTQSHFEALKNLENEIYVNDQKLALLILENKKLRDYLAYLKKHTKEYSEKQIVTVQNSGDLSWQLIAQ 699 P0C221 EAQYKDLWAEFQTTVKILVDNGEETLQDINNLTDKLRERDEKMQHVSTWLRGSLEGLRLLVEQESPM-----DLLK---KKKHIRTRVHF-PVVKCTEKN 789 Q5PQJ9 HSQYSDLLAEFQIKIKELVDTGEETLQEIRSLASKLRYRDEKIESISAWLLGGIERLHSLMEEESPSSLSKEDLQKAGMKQKEEKT-LRFSPSLH-TRRD 797 P0C221 TLTK---------------- 793 Q5PQJ9 TLSRNCKMIKKRSRSPKNKP 817
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0008022 | protein C-terminus binding |
| 2. P | GO:0097539 | ciliary transition fiber |
| 2. P | GO:0006611 | protein export from nucleus |
| 2. P | GO:0070530 | K63-linked polyubiquitin modification-dependent protein binding |
| 2. P | GO:0007094 | mitotic spindle assembly checkpoint signaling |
| 2. P | GO:0045141 | meiotic telomere clustering |
| 2. P | GO:0090161 | Golgi ribbon formation |
| 2. P | GO:0005874 | microtubule |
| 2. P | GO:0051026 | chiasma assembly |
| 2. P | GO:1903251 | multi-ciliated epithelial cell differentiation |
| 2. P | GO:0035148 | tube formation |
| 2. P | GO:0048786 | presynaptic active zone |
| 2. P | GO:0030992 | intraciliary transport particle B |
| 2. P | GO:0044615 | nuclear pore nuclear basket |
| 2. P | GO:0048874 | host-mediated regulation of intestinal microbiota composition |
| 2. P | GO:0007507 | heart development |
| 2. P | GO:0030010 | establishment of cell polarity |
| 2. P | GO:0031122 | cytoplasmic microtubule organization |
| 2. P | GO:0009903 | chloroplast avoidance movement |
| 2. P | GO:1904526 | regulation of microtubule binding |
| 2. P | GO:0048193 | Golgi vesicle transport |
| 2. P | GO:0044877 | protein-containing complex binding |
| 2. P | GO:0000138 | Golgi trans cisterna |
| 2. P | GO:1904417 | positive regulation of xenophagy |
| 2. P | GO:0008340 | determination of adult lifespan |
| 2. P | GO:0071907 | determination of digestive tract left/right asymmetry |
| 2. P | GO:0035092 | sperm DNA condensation |
| 2. P | GO:0008017 | microtubule binding |
| 2. P | GO:0007032 | endosome organization |
| 2. P | GO:0007020 | microtubule nucleation |
| 2. P | GO:0032982 | myosin filament |
| 2. P | GO:0120103 | centriolar subdistal appendage |
| 2. P | GO:0048790 | maintenance of presynaptic active zone structure |
| 2. P | GO:0032663 | regulation of interleukin-2 production |
| 2. P | GO:0001673 | male germ cell nucleus |
| 2. P | GO:0097431 | mitotic spindle pole |
| 2. P | GO:0090166 | Golgi disassembly |
| 2. P | GO:0022027 | interkinetic nuclear migration |
| 2. P | GO:0034067 | protein localization to Golgi apparatus |
| 2. P | GO:0030897 | HOPS complex |
| 2. P | GO:0051301 | cell division |
| 2. P | GO:0002756 | MyD88-independent toll-like receptor signaling pathway |
| 2. P | GO:0008356 | asymmetric cell division |
| 2. P | GO:0044774 | mitotic DNA integrity checkpoint signaling |
| 2. P | GO:0010507 | negative regulation of autophagy |
| 2. P | GO:0000802 | transverse filament |
| 2. P | GO:0071910 | determination of liver left/right asymmetry |
| 2. P | GO:0007283 | spermatogenesis |
| 2. P | GO:0030324 | lung development |
| 2. P | GO:0051878 | lateral element assembly |
| 2. P | GO:0043025 | neuronal cell body |
| 2. P | GO:0060287 | epithelial cilium movement involved in determination of left/right asymmetry |
| 2. P | GO:0071955 | recycling endosome to Golgi transport |
| 2. P | GO:0032725 | positive regulation of granulocyte macrophage colony-stimulating factor production |
| 2. P | GO:0042130 | negative regulation of T cell proliferation |
| 2. P | GO:0120229 | protein localization to motile cilium |
| 2. P | GO:0005886 | plasma membrane |
| 2. P | GO:0032815 | negative regulation of natural killer cell activation |
| 2. P | GO:0008104 | protein localization |
| 2. P | GO:0001520 | outer dense fiber |
| 2. P | GO:0015031 | protein transport |
| 2. P | GO:0036159 | inner dynein arm assembly |
| 2. P | GO:0006913 | nucleocytoplasmic transport |
| 2. P | GO:0051649 | establishment of localization in cell |
| 2. P | GO:0005816 | spindle pole body |
| 2. P | GO:0005863 | striated muscle myosin thick filament |
| 2. P | GO:0008333 | endosome to lysosome transport |
| 2. P | GO:1905232 | cellular response to L-glutamate |
| 2. P | GO:0060077 | inhibitory synapse |
| 2. P | GO:0042734 | presynaptic membrane |
| 2. P | GO:0010564 | regulation of cell cycle process |
| 2. P | GO:0036126 | sperm flagellum |
| 2. P | GO:0031985 | Golgi cisterna |
| 2. P | GO:0110120 | gamma-tubulin complex localization to nuclear side of mitotic spindle pole body |
| 2. P | GO:0035889 | otolith tethering |
| 2. P | GO:0020035 | cytoadherence to microvasculature, mediated by symbiont protein |
| 2. P | GO:0007249 | I-kappaB kinase/NF-kappaB signaling |
| 2. P | GO:0072686 | mitotic spindle |
| 2. P | GO:0001947 | heart looping |
| 2. P | GO:0043515 | kinetochore binding |
| 2. P | GO:0006897 | endocytosis |
| 2. P | GO:0070695 | FHF complex |
| 2. P | GO:0000242 | pericentriolar material |
| 2. P | GO:0036064 | ciliary basal body |
| 2. P | GO:0031593 | polyubiquitin modification-dependent protein binding |
| 2. P | GO:0030276 | clathrin binding |
| 2. P | GO:0016064 | immunoglobulin mediated immune response |
| 2. P | GO:0120317 | sperm mitochondrial sheath assembly |
| 2. P | GO:0005930 | axoneme |
| 2. P | GO:0090268 | activation of mitotic cell cycle spindle assembly checkpoint |
| 2. P | GO:0007010 | cytoskeleton organization |
| 2. P | GO:0051660 | establishment of centrosome localization |
| 2. P | GO:0097225 | sperm midpiece |
| 2. P | GO:0003146 | heart jogging |
| 2. P | GO:0033116 | endoplasmic reticulum-Golgi intermediate compartment membrane |
| 2. P | GO:0060294 | cilium movement involved in cell motility |
| 2. P | GO:0003677 | DNA binding |
| 2. P | GO:0048471 | perinuclear region of cytoplasm |
| 2. P | GO:0030031 | cell projection assembly |
| 2. P | GO:0051289 | protein homotetramerization |
| 2. P | GO:0000775 | chromosome, centromeric region |
| 2. P | GO:1900017 | positive regulation of cytokine production involved in inflammatory response |
| 2. P | GO:0005814 | centriole |
| 2. P | GO:0061734 | parkin-mediated stimulation of mitophagy in response to mitochondrial depolarization |
| 2. P | GO:0043330 | response to exogenous dsRNA |
| 2. P | GO:0034452 | dynactin binding |
| 2. P | GO:0005776 | autophagosome |
| 2. P | GO:0000794 | condensed nuclear chromosome |
| 2. P | GO:0061760 | antifungal innate immune response |
| 2. P | GO:0030241 | skeletal muscle myosin thick filament assembly |
| 2. P | GO:0003356 | regulation of cilium beat frequency |
| 2. P | GO:1902426 | deactivation of mitotic spindle assembly checkpoint |
| 2. P | GO:0044691 | tooth eruption |
| 2. P | GO:0007368 | determination of left/right symmetry |
| 2. P | GO:0032495 | response to muramyl dipeptide |
| 2. P | GO:0097228 | sperm principal piece |
| 2. P | GO:0015630 | microtubule cytoskeleton |
| 2. P | GO:0000795 | synaptonemal complex |
| 2. P | GO:0032740 | positive regulation of interleukin-17 production |
| 2. P | GO:0035735 | intraciliary transport involved in cilium assembly |
| 2. P | GO:0000137 | Golgi cis cisterna |
| 2. P | GO:0005801 | cis-Golgi network |
| 2. P | GO:0051220 | cytoplasmic sequestering of protein |
| 2. P | GO:0007274 | neuromuscular synaptic transmission |
| 2. P | GO:0000776 | kinetochore |
| 2. P | GO:0050768 | negative regulation of neurogenesis |
| 2. P | GO:0044782 | cilium organization |
| 2. P | GO:0000077 | DNA damage checkpoint signaling |
| 2. P | GO:0045880 | positive regulation of smoothened signaling pathway |
| 2. P | GO:0035773 | insulin secretion involved in cellular response to glucose stimulus |
| 2. P | GO:0005635 | nuclear envelope |
| 2. P | GO:0048788 | cytoskeleton of presynaptic active zone |
| 2. P | GO:2000769 | regulation of establishment or maintenance of cell polarity regulating cell shape |
| 2. P | GO:0005768 | endosome |
| 2. P | GO:0050772 | positive regulation of axonogenesis |
| 2. P | GO:0035082 | axoneme assembly |
| 2. P | GO:0098831 | presynaptic active zone cytoplasmic component |
| 2. P | GO:0060050 | positive regulation of protein glycosylation |
| 2. P | GO:0097224 | sperm connecting piece |
| 2. P | GO:0030705 | cytoskeleton-dependent intracellular transport |
| 2. P | GO:0080115 | myosin XI tail binding |
| 2. P | GO:0071539 | protein localization to centrosome |
| 2. P | GO:0045503 | dynein light chain binding |
| 2. P | GO:0003351 | epithelial cilium movement involved in extracellular fluid movement |
| 2. P | GO:0030016 | myofibril |
| 2. P | GO:2000318 | positive regulation of T-helper 17 type immune response |
| 2. P | GO:0001819 | positive regulation of cytokine production |
| 2. P | GO:0034451 | centriolar satellite |
| 2. P | GO:0098882 | structural constituent of presynaptic active zone |
| 2. P | GO:2000179 | positive regulation of neural precursor cell proliferation |
| 2. P | GO:1902254 | negative regulation of intrinsic apoptotic signaling pathway by p53 class mediator |
| 2. P | GO:1905198 | manchette assembly |
| 2. P | GO:0032091 | negative regulation of protein binding |
| 2. P | GO:1902440 | protein localization to mitotic spindle pole body |
| 2. P | GO:0007030 | Golgi organization |
| 2. P | GO:1902018 | negative regulation of cilium assembly |
| 2. P | GO:0005929 | cilium |
| 2. P | GO:0051645 | Golgi localization |
| 2. P | GO:0006888 | endoplasmic reticulum to Golgi vesicle-mediated transport |
| 2. P | GO:0098535 | de novo centriole assembly involved in multi-ciliated epithelial cell differentiation |
| 2. P | GO:0048487 | beta-tubulin binding |
| 2. P | GO:0000711 | meiotic DNA repair synthesis |
| 2. P | GO:0032494 | response to peptidoglycan |
| 2. P | GO:0000301 | retrograde transport, vesicle recycling within Golgi |
| 2. P | GO:0007420 | brain development |
| 2. P | GO:0045505 | dynein intermediate chain binding |
| 2. P | GO:0051315 | attachment of mitotic spindle microtubules to kinetochore |
| 2. P | GO:0097120 | receptor localization to synapse |
| 2. P | GO:0003341 | cilium movement |
| 2. P | GO:0007098 | centrosome cycle |
| 2. P | GO:0031023 | microtubule organizing center organization |
| 2. P | GO:0019901 | protein kinase binding |
| 2. P | GO:0032880 | regulation of protein localization |
| 2. P | GO:0051959 | dynein light intermediate chain binding |
| 2. P | GO:1901925 | negative regulation of protein import into nucleus during spindle assembly checkpoint |
| 2. P | GO:0000922 | spindle pole |
| 2. P | GO:0050700 | CARD domain binding |
| 2. P | GO:0005802 | trans-Golgi network |
| 2. P | GO:0007129 | homologous chromosome pairing at meiosis |
| 2. P | GO:0060285 | cilium-dependent cell motility |
| 2. P | GO:0045089 | positive regulation of innate immune response |
| 2. P | GO:0048167 | regulation of synaptic plasticity |
| 2. P | GO:0007288 | sperm axoneme assembly |
| 2. P | GO:0010457 | centriole-centriole cohesion |
| 2. P | GO:0030030 | cell projection organization |
| 2. P | GO:0030165 | PDZ domain binding |
| 2. P | GO:0005694 | chromosome |
| 2. P | GO:0090306 | meiotic spindle assembly |
| 2. P | GO:0043001 | Golgi to plasma membrane protein transport |
| 2. P | GO:0051298 | centrosome duplication |
| 2. P | GO:0007130 | synaptonemal complex assembly |
| 2. P | GO:1905515 | non-motile cilium assembly |
| 2. P | GO:0061676 | importin-alpha family protein binding |
| 2. P | GO:0005856 | cytoskeleton |
| 2. P | GO:0090235 | regulation of metaphase plate congression |
| 2. P | GO:0032722 | positive regulation of chemokine production |
| 2. P | GO:0046600 | negative regulation of centriole replication |
| 2. P | GO:0032580 | Golgi cisterna membrane |
| 2. P | GO:0000801 | central element |
| 2. P | GO:0043124 | negative regulation of I-kappaB kinase/NF-kappaB signaling |
| 2. P | GO:0097729 | 9+2 motile cilium |
| 2. P | GO:0001155 | TFIIIA-class transcription factor binding |
| 2. P | GO:0051225 | spindle assembly |
| 2. P | GO:0097298 | regulation of nucleus size |
| 2. P | GO:0030500 | regulation of bone mineralization |
| 2. P | GO:0002446 | neutrophil mediated immunity |
| 2. P | GO:1905719 | protein localization to perinuclear region of cytoplasm |
| 2. P | GO:0045022 | early endosome to late endosome transport |
| 2. P | GO:0097150 | neuronal stem cell population maintenance |
| 2. P | GO:0061512 | protein localization to cilium |
| 2. P | GO:0070286 | axonemal dynein complex assembly |
| 2. P | GO:0003334 | keratinocyte development |
| 2. P | GO:0009904 | chloroplast accumulation movement |
| 2. P | GO:0045162 | clustering of voltage-gated sodium channels |
| 2. P | GO:0007131 | reciprocal meiotic recombination |
| 2. P | GO:0090660 | cerebrospinal fluid circulation |
| 2. P | GO:0030134 | COPII-coated ER to Golgi transport vesicle |
| 2. P | GO:0033630 | positive regulation of cell adhesion mediated by integrin |
| 2. P | GO:0099518 | vesicle cytoskeletal trafficking |
| 2. P | GO:0003355 | cilium movement involved in otolith formation |
| 2. P | GO:0035630 | bone mineralization involved in bone maturation |
| 2. P | GO:0008385 | IkappaB kinase complex |
| 2. P | GO:0097733 | photoreceptor cell cilium |
| 2. P | GO:0048278 | vesicle docking |
| 2. P | GO:0007099 | centriole replication |
| 2. P | GO:0043122 | regulation of I-kappaB kinase/NF-kappaB signaling |
| 2. P | GO:0035469 | determination of pancreatic left/right asymmetry |
| 2. P | GO:0061966 | establishment of left/right asymmetry |
| 2. P | GO:0090307 | mitotic spindle assembly |
| 2. P | GO:0016459 | myosin complex |
| 2. P | GO:1903566 | positive regulation of protein localization to cilium |
| 2. P | GO:0034613 | cellular protein localization |
| 2. P | GO:0035686 | sperm fibrous sheath |
| 2. P | GO:0007040 | lysosome organization |
| 2. P | GO:0034454 | microtubule anchoring at centrosome |
| 2. P | GO:0030154 | cell differentiation |
| 2. P | GO:0098536 | deuterosome |
| 2. P | GO:0031393 | negative regulation of prostaglandin biosynthetic process |
| 2. P | GO:0016082 | synaptic vesicle priming |
| 2. P | GO:0005798 | Golgi-associated vesicle |
| 2. P | GO:0005822 | inner plaque of spindle pole body |
| 2. P | GO:0048538 | thymus development |
| 2. P | GO:0005794 | Golgi apparatus |
| 2. P | GO:0098982 | GABA-ergic synapse |
| 2. P | GO:0007286 | spermatid development |
| 2. P | GO:0016021 | integral component of membrane |
| 2. P | GO:0031267 | small GTPase binding |
| 2. P | GO:0060271 | cilium assembly |
| 2. P | GO:0030317 | flagellated sperm motility |
| 2. P | GO:0031514 | motile cilium |
| 2. P | GO:0099635 | voltage-gated calcium channel activity involved in positive regulation of presynaptic cytosolic calcium levels |
| 2. P | GO:0005813 | centrosome |
| 2. P | GO:0005829 | cytosol |
| 2. P | GO:0046872 | metal ion binding |
| 2. P | GO:0045202 | synapse |
| 2. P | GO:0044458 | motile cilium assembly |
| 2. P | GO:0070861 | regulation of protein exit from endoplasmic reticulum |
| 2. P | GO:0001669 | acrosomal vesicle |
| 2. P | GO:0032449 | CBM complex |
| 2. P | GO:0000139 | Golgi membrane |
| 2. P | GO:1902017 | regulation of cilium assembly |
| 2. P | GO:0042770 | signal transduction in response to DNA damage |
| 2. P | GO:0032874 | positive regulation of stress-activated MAPK cascade |
| 2. P | GO:0001920 | negative regulation of receptor recycling |
| 2. P | GO:0019905 | syntaxin binding |
| 2. P | GO:0042802 | identical protein binding |
| 2. P | GO:0017080 | sodium channel regulator activity |
| 2. P | GO:0071439 | clathrin complex |
| 3. B | GO:0007411 | axon guidance |
| 3. B | GO:0031594 | neuromuscular junction |
| 3. B | GO:2000280 | regulation of root development |
| 3. B | GO:0030155 | regulation of cell adhesion |
| 3. B | GO:0060445 | branching involved in salivary gland morphogenesis |
| 3. B | GO:0032224 | positive regulation of synaptic transmission, cholinergic |
| 3. B | GO:0009888 | tissue development |
| 3. B | GO:0005608 | laminin-3 complex |
| 3. B | GO:1902584 | positive regulation of response to water deprivation |
| 3. B | GO:0005201 | extracellular matrix structural constituent |
| 3. B | GO:0005604 | basement membrane |
| 3. B | GO:0002011 | morphogenesis of an epithelial sheet |
| 3. B | GO:0043197 | dendritic spine |
| 3. B | GO:0005102 | signaling receptor binding |
| 3. B | GO:0005606 | laminin-1 complex |
| 3. B | GO:0016363 | nuclear matrix |
| 3. B | GO:0043083 | synaptic cleft |
| 3. B | GO:0040008 | regulation of growth |
| 3. B | GO:0030334 | regulation of cell migration |
| 3. B | GO:0042383 | sarcolemma |
| 3. B | GO:0061304 | retinal blood vessel morphogenesis |
| 3. B | GO:0005652 | nuclear lamina |
| 3. B | GO:0005911 | cell-cell junction |
| 3. B | GO:0048514 | blood vessel morphogenesis |
| 3. B | GO:0045995 | regulation of embryonic development |
| 3. B | GO:0045198 | establishment of epithelial cell apical/basal polarity |
| 3. B | GO:0007517 | muscle organ development |
| 3. B | GO:0007166 | cell surface receptor signaling pathway |
| 3. B | GO:0062023 | collagen-containing extracellular matrix |
| 3. B | GO:0043010 | camera-type eye development |
| 3. B | GO:0014037 | Schwann cell differentiation |
| 3. B | GO:0035633 | maintenance of blood-brain barrier |
| 3. B | GO:0006997 | nucleus organization |
| 3. B | GO:0043208 | glycosphingolipid binding |
| 3. B | GO:0007155 | cell adhesion |
| 3. B | GO:0060441 | epithelial tube branching involved in lung morphogenesis |
| 3. B | GO:0009887 | animal organ morphogenesis |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | P0C221 | Coiled-coil domain-containing protein 175 | 0 | 5.03e-151 | 0.0 |
| 1. PB | Q2T9Z6 | Coiled-coil domain-containing protein 175 | 2.43e-11 | 9.32e-48 | 0.0 |
| 1. PB | Q5PQJ9 | Coiled-coil domain-containing protein 175 | 3.06e-12 | 2.16e-49 | 0.0 |
| 1. PB | E9PVB3 | Coiled-coil domain-containing protein 175 | 1.49e-10 | 1.42e-37 | 0.0 |
| 2. P | A6NI56 | Coiled-coil domain-containing protein 154 | 6.89e-09 | 1.27e-04 | NA |
| 2. P | Q3UPP8 | Centrosomal protein of 63 kDa | 4.46e-09 | 2.92e-03 | NA |
| 2. P | Q86SQ7 | Serologically defined colon cancer antigen 8 | 2.53e-02 | 1.61e-05 | NA |
| 2. P | Q9NUQ3 | Gamma-taxilin | 6.94e-04 | 3.93e-03 | NA |
| 2. P | Q5T655 | Cilia- and flagella-associated protein 58 | 3.21e-10 | 4.21e-18 | NA |
| 2. P | Q5XHZ2 | Synaptonemal complex central element protein 1 | 5.07e-05 | 4.88e-02 | NA |
| 2. P | Q62209 | Synaptonemal complex protein 1 | 2.05e-06 | 5.19e-07 | NA |
| 2. P | Q9FWW5 | WEB family protein At1g12150 | 2.98e-09 | 1.57e-03 | NA |
| 2. P | Q02171 | Paramyosin | 2.42e-09 | 2.88e-06 | NA |
| 2. P | Q5T9S5 | Coiled-coil domain-containing protein 18 | 1.51e-03 | 2.64e-03 | NA |
| 2. P | P35415 | Paramyosin, long form | 1.53e-08 | 9.80e-09 | NA |
| 2. P | Q5BJE1 | Coiled-coil domain-containing protein 178 | 4.39e-08 | 1.09e-12 | NA |
| 2. P | Q9D5Y1 | Coiled-coil domain-containing protein 39 | 4.10e-07 | 2.96e-08 | NA |
| 2. P | Q8HZ60 | Coiled-coil alpha-helical rod protein 1 | 4.15e-09 | 1.29e-03 | NA |
| 2. P | Q6DFL0 | Coiled-coil domain-containing protein 102A | 4.34e-05 | 2.06e-05 | NA |
| 2. P | Q5D525 | Synaptonemal complex central element protein 1-like | 4.28e-04 | 6.01e-03 | NA |
| 2. P | Q4KLY0 | Centrosomal protein of 63 kDa | 7.29e-10 | 2.70e-08 | NA |
| 2. P | P39921 | Tropomyosin-1 | 2.31e-07 | 2.77e-06 | NA |
| 2. P | Q8C9S4 | Coiled-coil domain-containing protein 186 | 1.98e-07 | 6.60e-04 | NA |
| 2. P | B3NL60 | Protein hook | 4.64e-06 | 4.94e-04 | NA |
| 2. P | Q6ZU80 | Centrosomal protein of 128 kDa | 1.65e-07 | 4.13e-06 | NA |
| 2. P | P35417 | Paramyosin | 6.05e-05 | 9.51e-06 | NA |
| 2. P | Q24185 | Protein hook | 1.62e-04 | 4.78e-04 | NA |
| 2. P | Q9H257 | Caspase recruitment domain-containing protein 9 | 5.65e-05 | 3.47e-02 | NA |
| 2. P | Q6FS63 | Spindle assembly checkpoint component MAD1 | 2.54e-08 | 3.58e-05 | NA |
| 2. P | Q5ZKK5 | Outer dense fiber protein 2 | 1.93e-09 | 2.06e-10 | NA |
| 2. P | Q8R5M4 | Optineurin | 5.42e-08 | 6.89e-04 | NA |
| 2. P | Q5M9N0 | Coiled-coil domain-containing protein 158 | 8.41e-08 | 1.31e-04 | NA |
| 2. P | Q8CDI7 | Coiled-coil domain-containing protein 150 | 2.01e-06 | 1.42e-06 | NA |
| 2. P | Q6NY15 | Testis-specific gene 10 protein | 5.22e-09 | 2.56e-07 | NA |
| 2. P | Q5PQ23 | Outer dense fiber protein 2 | 6.42e-08 | 1.44e-06 | NA |
| 2. P | D3Z8K2 | Coiled-coil domain-containing protein 39 | 1.94e-08 | 6.72e-12 | NA |
| 2. P | Q2YDH9 | Coiled-coil domain-containing protein 172 | 2.76e-07 | 7.94e-05 | NA |
| 2. P | Q6PH08 | ERC protein 2 | 4.90e-08 | 1.05e-02 | NA |
| 2. P | B8JK76 | Serologically defined colon cancer antigen 8 homolog | 1.24e-10 | 8.61e-04 | NA |
| 2. P | Q96KP6 | TNFAIP3-interacting protein 3 | 3.92e-07 | 6.38e-03 | NA |
| 2. P | Q15431 | Synaptonemal complex protein 1 | 6.66e-07 | 2.71e-06 | NA |
| 2. P | F1R4Y7 | Centrosomal protein of 83 kDa | 7.11e-09 | 2.97e-17 | NA |
| 2. P | O15083 | ERC protein 2 | 8.71e-09 | 4.96e-03 | NA |
| 2. P | Q8K3K8 | Optineurin | 3.09e-07 | 1.36e-02 | NA |
| 2. P | Q6DFC2 | Coiled-coil domain-containing protein 77 | 4.28e-06 | 2.15e-08 | NA |
| 2. P | Q8HZ59 | Coiled-coil alpha-helical rod protein 1 | 3.34e-08 | 8.53e-03 | NA |
| 2. P | Q6C452 | Spindle assembly checkpoint component MAD1 | 4.47e-06 | 8.75e-06 | NA |
| 2. P | Q01202 | Paramyosin | 2.75e-07 | 1.48e-07 | NA |
| 2. P | Q8TD31 | Coiled-coil alpha-helical rod protein 1 | 5.93e-08 | 1.41e-02 | NA |
| 2. P | Q8BHN1 | Gamma-taxilin | 4.33e-04 | 1.71e-04 | NA |
| 2. P | Q7PWT9 | Protein hook | 4.78e-06 | 1.10e-02 | NA |
| 2. P | Q9D4H2 | GRIP and coiled-coil domain-containing protein 1 | 8.91e-05 | 1.95e-03 | NA |
| 2. P | Q6FY25 | Spindle pole body component 110 | 2.79e-09 | 3.30e-07 | NA |
| 2. P | Q9LS42 | Protein CASP | 2.45e-06 | 1.85e-04 | NA |
| 2. P | Q874L7 | Spindle assembly checkpoint component MAD1 | 1.13e-07 | 1.57e-03 | NA |
| 2. P | Q9D5R3 | Centrosomal protein of 83 kDa | 2.53e-08 | 6.89e-11 | NA |
| 2. P | Q8BIL5 | Protein Hook homolog 1 | 1.57e-02 | 6.48e-05 | NA |
| 2. P | Q92805 | Golgin subfamily A member 1 | 6.83e-08 | 2.09e-04 | NA |
| 2. P | Q6BSY1 | Spindle assembly checkpoint component MAD1 | 1.41e-06 | 1.06e-03 | NA |
| 2. P | Q9FMN1 | Protein WEAK CHLOROPLAST MOVEMENT UNDER BLUE LIGHT-like 3 | 5.13e-07 | 1.11e-02 | NA |
| 2. P | Q8CDI6 | Coiled-coil domain-containing protein 158 | 9.65e-04 | 9.42e-03 | NA |
| 2. P | Q9FLH0 | Protein CROWDED NUCLEI 4 | 4.25e-08 | 1.77e-02 | NA |
| 2. P | Q8N8E3 | Centrosomal protein of 112 kDa | 9.51e-08 | 4.19e-02 | NA |
| 2. P | Q75AF5 | Golgin IMH1 | 9.74e-09 | 2.91e-07 | NA |
| 2. P | Q5PR68 | Centrosomal protein of 112 kDa | 1.15e-07 | 1.15e-03 | NA |
| 2. P | Q5U3Z6 | Deuterosome assembly protein 1 | 3.73e-08 | 1.19e-03 | NA |
| 2. P | A0JNH6 | Coiled-coil domain-containing protein 102A | 8.34e-07 | 6.12e-04 | NA |
| 2. P | Q08B20 | Protein BCAP | 1.95e-08 | 2.11e-05 | NA |
| 2. P | Q80YF0 | Mitotic spindle assembly checkpoint protein MAD1 | 9.14e-07 | 3.53e-06 | NA |
| 2. P | Q499U4 | Dynein regulatory complex subunit 4 | 1.08e-05 | 3.70e-03 | NA |
| 2. P | Q8BUK6 | Protein Hook homolog 3 | 5.51e-02 | 2.02e-04 | NA |
| 2. P | Q9NJA9 | Paramyosin | 3.69e-09 | 5.60e-07 | NA |
| 2. P | Q9EPY0 | Caspase recruitment domain-containing protein 9 | 1.47e-04 | 2.39e-02 | NA |
| 2. P | P35418 | Paramyosin | 9.55e-09 | 2.26e-05 | NA |
| 2. P | Q8TC20 | Cancer-associated gene 1 protein | 1.19e-03 | 5.49e-03 | NA |
| 2. P | O54887 | Testis-specific serine kinase substrate | 1.62e-04 | 2.41e-02 | NA |
| 2. P | Q8BSN3 | outer dynein arm-docking complex subunit 3 | 1.12e-06 | 1.18e-02 | NA |
| 2. P | Q6PGZ0 | Centrosomal protein of 63 kDa | 1.38e-09 | 1.82e-03 | NA |
| 2. P | A8HUA1 | Cilia- and flagella-associated protein 58 | 1.47e-11 | 3.52e-16 | NA |
| 2. P | Q8K2I2 | Coiled-coil alpha-helical rod protein 1 | 2.75e-08 | 8.28e-03 | NA |
| 2. P | C5DY19 | Spindle pole body component 110 | 6.79e-03 | 1.12e-08 | NA |
| 2. P | Q9Z220 | Testis-specific gene 10 protein | 1.61e-09 | 1.83e-06 | NA |
| 2. P | Q95JK1 | Deuterosome assembly protein 1 | 3.19e-07 | 1.91e-03 | NA |
| 2. P | Q6RCE1 | Intraflagellar transport protein 74 | 5.12e-07 | 4.30e-05 | NA |
| 2. P | Q9Y6D9 | Mitotic spindle assembly checkpoint protein MAD1 | 6.54e-07 | 5.06e-06 | NA |
| 2. P | Q8IYT3 | Coiled-coil domain-containing protein 170 | 3.73e-09 | 8.12e-05 | NA |
| 2. P | Q6RUT8 | Coiled-coil domain-containing protein 154 | 3.59e-07 | 1.95e-03 | NA |
| 2. P | C5DJH6 | Spindle pole body component 110 | 1.56e-04 | 6.49e-08 | NA |
| 2. P | Q7M6Y5 | Deuterosome assembly protein 1 | 4.65e-07 | 1.24e-02 | NA |
| 2. P | Q86RN8 | Paramyosin | 2.60e-09 | 9.75e-11 | NA |
| 2. P | Q96CN9 | GRIP and coiled-coil domain-containing protein 1 | 2.08e-06 | 2.85e-05 | NA |
| 2. P | Q811U3 | ELKS/Rab6-interacting/CAST family member 1 | 1.03e-06 | 6.53e-04 | NA |
| 2. P | Q6GQ73 | Protein Hook homolog 3 | 5.12e-08 | 1.98e-04 | NA |
| 2. P | Q60779 | Dynein regulatory complex subunit 4 | 9.72e-06 | 2.40e-03 | NA |
| 2. P | Q4R8C3 | Outer dense fiber protein 2 | 2.43e-10 | 6.03e-10 | NA |
| 2. P | B4KE73 | Protein hook | 4.59e-03 | 3.04e-03 | NA |
| 2. P | Q0KK56 | Protein FAM184B | 5.48e-07 | 3.18e-02 | NA |
| 2. P | Q8NCX0 | Coiled-coil domain-containing protein 150 | 1.02e-06 | 3.38e-04 | NA |
| 2. P | Q6CMM2 | Spindle assembly checkpoint component MAD1 | 2.41e-08 | 1.11e-03 | NA |
| 2. P | Q7NBF8 | Cytadherence high molecular weight protein 2 | 7.54e-06 | 5.11e-03 | NA |
| 2. P | B4N1C2 | Protein hook | 4.21e-03 | 1.19e-02 | NA |
| 2. P | Q0V9R4 | Coiled-coil domain-containing protein 39 | 4.53e-08 | 1.23e-05 | NA |
| 2. P | Q6AYX5 | Outer dense fiber protein 2 | 1.94e-08 | 6.35e-06 | NA |
| 2. P | A6ZYV5 | Spindle pole body component 110 | 3.01e-08 | 1.16e-03 | NA |
| 2. P | Q0VBY1 | Protein BCAP | 8.15e-07 | 4.44e-08 | NA |
| 2. P | O64584 | WPP domain-associated protein | 3.42e-07 | 2.20e-06 | NA |
| 2. P | O61493 | Protein hook | 6.15e-07 | 1.74e-03 | NA |
| 2. P | A7THU9 | Spindle pole body component 110 | 8.17e-09 | 2.32e-07 | NA |
| 2. P | Q8L7E5 | WPP domain-interacting tail-anchored protein 1 | 2.11e-06 | 1.01e-03 | NA |
| 2. P | Q96A19 | Coiled-coil domain-containing protein 102A | 2.95e-07 | 7.06e-03 | NA |
| 2. P | Q05870 | Paramyosin | 4.66e-08 | 9.78e-04 | NA |
| 2. P | Q56A40 | Coiled-coil domain-containing protein 40 | 7.05e-08 | 1.51e-16 | NA |
| 2. P | Q26789 | 73 kDa paraflagellar rod protein | 2.99e-06 | 2.88e-05 | NA |
| 2. P | Q86VS8 | Protein Hook homolog 3 | 2.33e-06 | 4.43e-04 | NA |
| 2. P | B4JAL5 | Protein hook | 3.46e-06 | 1.82e-03 | NA |
| 2. P | Q756L3 | Spindle pole body component 110 | 7.79e-07 | 1.71e-10 | NA |
| 2. P | Q8WXW3 | Progesterone-induced-blocking factor 1 | 1.86e-08 | 5.20e-08 | NA |
| 2. P | Q921M4 | Golgin subfamily A member 2 | 1.12e-08 | 5.13e-08 | NA |
| 2. P | Q80UF4 | Serologically defined colon cancer antigen 8 homolog | 3.22e-10 | 8.98e-04 | NA |
| 2. P | Q8T305 | Paramyosin | NA | 4.45e-05 | NA |
| 2. P | B3LFU6 | Spindle pole body component 110 | 1.18e-07 | 1.57e-03 | NA |
| 2. P | Q9UFE4 | Coiled-coil domain-containing protein 39 | 7.51e-09 | 1.15e-07 | NA |
| 2. P | Q08379 | Golgin subfamily A member 2 | 4.84e-07 | 8.87e-07 | NA |
| 2. P | Q8BKE9 | Intraflagellar transport protein 74 homolog | 2.24e-05 | 1.70e-04 | NA |
| 2. P | Q5XJN6 | Coiled-coil domain-containing protein 113 | 1.82e-07 | 2.75e-03 | NA |
| 2. P | Q3TMW1 | Coiled-coil domain-containing protein 102A | 5.01e-05 | 7.88e-03 | NA |
| 2. P | P34562 | GRIP and coiled-coil domain-containing protein 2 | 3.15e-06 | 6.85e-03 | NA |
| 2. P | Q6NZW0 | Coiled-coil domain-containing protein 102A | 5.94e-05 | 1.64e-03 | NA |
| 2. P | B6MFW3 | Protein Hook homolog | 1.01e-07 | 1.12e-03 | NA |
| 2. P | Q9CW79 | Golgin subfamily A member 1 | 6.22e-07 | 1.23e-05 | NA |
| 2. P | Q29N92 | Protein hook | 1.04e-05 | 4.81e-03 | NA |
| 2. P | Q5R829 | Outer dense fiber protein 2 | 2.38e-09 | 5.19e-07 | NA |
| 2. P | Q8IYE0 | Coiled-coil domain-containing protein 146 | 2.73e-07 | 7.81e-21 | NA |
| 2. P | P75471 | Cytadherence high molecular weight protein 2 | 4.30e-07 | 4.57e-02 | NA |
| 2. P | A5D7M3 | Dynein regulatory complex subunit 4 | 1.17e-05 | 1.06e-03 | NA |
| 2. P | O96064 | Paramyosin | 3.25e-09 | 1.90e-05 | NA |
| 2. P | Q8HZ57 | Coiled-coil alpha-helical rod protein 1 | 6.12e-04 | 1.54e-03 | NA |
| 2. P | P06198 | Paramyosin | 6.60e-08 | 1.25e-03 | NA |
| 2. P | Q9WTX8 | Mitotic spindle assembly checkpoint protein MAD1 | 2.10e-06 | 5.33e-07 | NA |
| 2. P | O23564 | Putative WEB family protein At4g17210 | 1.07e-07 | 5.56e-04 | NA |
| 2. P | B2RW38 | Cilia- and flagella-associated protein 58 | 2.10e-09 | 4.32e-15 | NA |
| 2. P | D3ZZL9 | GRIP and coiled-coil domain-containing protein 2 | 1.81e-03 | 6.07e-03 | NA |
| 2. P | E2R1I5 | Coiled-coil domain-containing protein 39 | 4.53e-09 | 1.81e-09 | NA |
| 2. P | Q5BJF6 | Outer dense fiber protein 2 | 2.28e-03 | 1.85e-11 | NA |
| 2. P | Q96NL6 | Sodium channel and clathrin linker 1 | 4.54e-09 | 3.22e-07 | NA |
| 2. P | A8MQR0 | WPP domain-interacting tail-anchored protein 2 | 3.62e-08 | 1.48e-02 | NA |
| 2. P | Q9ULJ1 | Protein BCAP | 6.77e-09 | 6.33e-05 | NA |
| 2. P | Q29RS0 | Coiled-coil domain-containing protein 89 | 5.95e-07 | 6.28e-06 | NA |
| 2. P | P97779 | Hyaluronan-mediated motility receptor | 1.05e-05 | 1.11e-03 | NA |
| 2. P | B4PAF2 | Protein hook | 9.35e-07 | 4.63e-04 | NA |
| 2. P | Q9BZW7 | Testis-specific gene 10 protein | 3.80e-09 | 6.74e-06 | NA |
| 2. P | Q62839 | Golgin subfamily A member 2 | 1.34e-08 | 5.12e-09 | NA |
| 2. P | Q95JI9 | Coiled-coil domain-containing protein 89 | 9.41e-04 | 8.98e-07 | NA |
| 2. P | Q84WU4 | Golgin candidate 3 | 2.34e-07 | 3.71e-02 | NA |
| 2. P | Q7FAD5 | Synaptonemal complex protein ZEP1 | 1.67e-07 | 2.23e-04 | NA |
| 2. P | Q05D60 | Deuterosome assembly protein 1 | 1.09e-09 | 1.08e-03 | NA |
| 2. P | F1QNW4 | Dynein regulatory complex subunit 4 | 2.45e-05 | 9.42e-03 | NA |
| 2. P | Q9Z221 | Polyamine-modulated factor 1-binding protein 1 | 3.88e-09 | 4.70e-02 | NA |
| 2. P | Q9WVQ0 | Polyamine-modulated factor 1-binding protein 1 | 3.15e-09 | 1.18e-03 | NA |
| 2. P | Q90Z16 | Optineurin | 9.18e-08 | 4.02e-04 | NA |
| 2. P | O15697 | Trypanin | 3.54e-06 | 2.34e-06 | NA |
| 2. P | A3KGV1 | Outer dense fiber protein 2 | 4.16e-08 | 1.20e-11 | NA |
| 2. P | Q96LB3 | Intraflagellar transport protein 74 homolog | 7.09e-05 | 1.34e-05 | NA |
| 2. P | O95995 | Dynein regulatory complex subunit 4 | 9.19e-06 | 1.41e-03 | NA |
| 2. P | Q8L7S4 | Microtubule-associated protein 70-2 | 3.35e-04 | 1.91e-03 | NA |
| 2. P | P32380 | Spindle pole body component 110 | 2.54e-05 | 1.60e-03 | NA |
| 2. P | Q9C9N6 | Protein PLASTID MOVEMENT IMPAIRED 2 | 1.46e-10 | 2.89e-03 | NA |
| 2. P | Q19782 | Intermediate filament protein ifd-2 | 6.53e-07 | 1.19e-02 | NA |
| 2. P | Q8MUF6 | Paramyosin | 1.69e-08 | 3.90e-09 | NA |
| 2. P | Q06704 | Golgin IMH1 | 4.22e-05 | 1.38e-03 | NA |
| 2. P | P10567 | Paramyosin | 8.04e-10 | 3.53e-06 | NA |
| 2. P | Q8VYU6 | Golgin candidate 4 | 3.80e-07 | 7.76e-05 | NA |
| 2. P | Q8K3M6 | ERC protein 2 | 4.93e-05 | 1.48e-02 | NA |
| 2. P | Q6CMB5 | Spindle pole body component 110 | 1.43e-04 | 1.31e-05 | NA |
| 2. P | Q9D495 | Synaptonemal complex central element protein 1 | 4.88e-05 | 1.41e-03 | NA |
| 2. P | Q7Z3E2 | Coiled-coil domain-containing protein 186 | 2.70e-08 | 1.30e-04 | NA |
| 2. P | B4I5P7 | Protein hook | 4.42e-03 | 6.12e-04 | NA |
| 2. P | Q9BMM8 | Paramyosin | 4.08e-08 | 4.86e-11 | NA |
| 2. P | B0WPU9 | Protein hook | 5.30e-05 | 2.13e-02 | NA |
| 2. P | Q8S2T0 | Protein GRIP | 1.75e-07 | 5.10e-05 | NA |
| 2. P | Q7ZW57 | Coiled-coil domain-containing protein 89 | 1.70e-06 | 2.44e-04 | NA |
| 2. P | P22225 | 69 kDa paraflagellar rod protein | 8.16e-09 | 1.29e-03 | NA |
| 2. P | Q8CDV0 | Coiled-coil domain-containing protein 178 | 5.75e-07 | 8.53e-12 | NA |
| 2. P | Q8N998 | Coiled-coil domain-containing protein 89 | 3.99e-08 | 4.53e-07 | NA |
| 2. P | Q8BI22 | Centrosomal protein of 128 kDa | 4.08e-07 | 1.76e-03 | NA |
| 2. P | Q96ST8 | Centrosomal protein of 89 kDa | 5.12e-06 | 3.85e-02 | NA |
| 2. P | A8IQE0 | Coiled-coil domain-containing protein 39 | 7.15e-05 | 1.95e-12 | NA |
| 2. P | P0CK98 | Coiled-coil domain-containing protein 39 | 3.80e-11 | 2.53e-07 | NA |
| 2. P | Q95XR4 | Ectopic P granules protein 2 | 1.94e-08 | 7.20e-08 | NA |
| 2. P | Q8VYU8 | Interactor of constitutive active ROPs 5 | 3.51e-06 | 2.21e-02 | NA |
| 2. P | Q9DA73 | Coiled-coil domain-containing protein 89 | 4.60e-08 | 6.59e-07 | NA |
| 2. P | Q8TBA6 | Golgin subfamily A member 5 | 1.23e-04 | 1.01e-03 | NA |
| 2. P | Q9LTY1 | Mitotic spindle checkpoint protein MAD1 | 1.31e-06 | 5.41e-08 | NA |
| 2. P | C8Z5R8 | Spindle pole body component 110 | 1.32e-07 | 5.68e-04 | NA |
| 2. P | G5E861 | Sodium channel and clathrin linker 1 | 8.73e-09 | 9.57e-04 | NA |
| 2. P | B2RZ86 | Coiled-coil domain-containing protein 89 | 9.15e-07 | 5.77e-06 | NA |
| 2. P | Q2T9U2 | Outer dense fiber protein 2 | 3.18e-08 | 1.23e-05 | NA |
| 2. P | Q6GNT7 | Golgin subfamily A member 5 | 4.05e-06 | 8.98e-04 | NA |
| 2. P | Q9CZH8 | Coiled-coil domain-containing protein 77 | 3.54e-07 | 1.04e-03 | NA |
| 2. P | B4G831 | Protein hook | 2.14e-06 | 5.22e-03 | NA |
| 2. P | B3MNR6 | Protein hook | 7.95e-06 | 4.63e-04 | NA |
| 2. P | Q4R6W3 | Testis-specific gene 10 protein | 2.13e-08 | 5.25e-06 | NA |
| 2. P | Q66H60 | Coiled-coil domain-containing protein 146 | 1.29e-11 | 6.88e-13 | NA |
| 2. P | Q59PD6 | Spindle assembly checkpoint component MAD1 | 7.70e-09 | 1.57e-03 | NA |
| 2. P | Q9BR77 | Coiled-coil domain-containing protein 77 | 4.54e-06 | 4.09e-03 | NA |
| 2. P | Q5U4E6 | Golgin subfamily A member 4 | 2.07e-04 | 2.33e-03 | NA |
| 2. P | Q8BVF4 | Coiled-coil domain-containing protein 30 | 4.22e-09 | 1.52e-10 | NA |
| 2. P | Q9U5M4 | Tropomyosin-2 | 2.74e-04 | 5.87e-04 | NA |
| 2. P | Q9QYE6 | Golgin subfamily A member 5 | 3.10e-05 | 1.33e-02 | NA |
| 2. P | Q5BQN5 | WPP domain-associated protein (Fragment) | 1.63e-08 | 1.70e-02 | NA |
| 2. P | Q68CZ6 | HAUS augmin-like complex subunit 3 | 1.14e-06 | 3.55e-03 | NA |
| 2. P | Q5NVN6 | Centrosomal protein of 63 kDa | 1.48e-09 | 1.53e-06 | NA |
| 2. P | Q653N3 | Microtubule-associated protein 70-3 | 7.07e-05 | 8.70e-03 | NA |
| 2. P | Q8MT08 | Dynein regulatory complex subunit 4 | 1.89e-06 | 1.99e-02 | NA |
| 2. P | Q9Y592 | Centrosomal protein of 83 kDa | 1.32e-09 | 6.77e-13 | NA |
| 2. P | Q5TZ80 | Protein Hook homolog 1 | 1.62e-02 | 9.94e-05 | NA |
| 2. P | Q03410 | Synaptonemal complex protein 1 | 3.88e-07 | 4.25e-05 | NA |
| 2. P | Q66H89 | Centrosomal protein of 83 kDa | 5.11e-08 | 2.45e-09 | NA |
| 2. P | Q17AF4 | Protein hook | 3.15e-05 | 8.53e-03 | NA |
| 2. P | A8IQT2 | Coiled-coil domain-containing protein 40 homolog | 3.69e-07 | 1.54e-02 | NA |
| 2. P | Q10030 | Uncharacterized protein C27D6.1 | 4.78e-09 | 1.47e-03 | NA |
| 2. P | Q9D478 | Protein BCAP | 5.06e-09 | 8.53e-13 | NA |
| 2. P | Q9BE52 | CDK5 regulatory subunit-associated protein 2 | 2.07e-08 | 2.49e-04 | NA |
| 2. P | B4Q9E6 | Protein hook | 1.62e-03 | 5.87e-04 | NA |
| 2. P | Q66HB6 | Cancer-associated gene 1 protein homolog | 1.82e-02 | 3.12e-02 | NA |
| 2. P | E1BM70 | Coiled-coil domain-containing protein 39 | 1.81e-11 | 2.03e-10 | NA |
| 2. P | Q5ZJ27 | Protein Hook homolog 1 | 2.85e-05 | 3.98e-04 | NA |
| 2. P | Q9UJC3 | Protein Hook homolog 1 | 1.56e-06 | 2.26e-04 | NA |
| 2. P | Q8HZ58 | Coiled-coil alpha-helical rod protein 1 | 1.90e-07 | 3.27e-04 | NA |
| 3. B | Q60675 | Laminin subunit alpha-2 | NA | NA | 0.027 |
| 3. B | Q0JJ05 | Nuclear matrix constituent protein 1b | 2.66e-07 | NA | 0.035 |
| 3. B | P24043 | Laminin subunit alpha-2 | NA | NA | 0.001 |
| 3. B | P25391 | Laminin subunit alpha-1 | NA | NA | 0.002 |