Summary

P0C221

Homolog: Q5PQJ9.
Function: Coiled-coil domain-containing protein 175.

Statistics

Total GO Annotation: 305
Unique PROST Go: 267
Unique BLAST Go: 37

Total Homologs: 233
Unique PROST Homologs: 225
Unique BLAST Homologs: 4

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q5PQJ9 (Coiled-coil domain-containing protein 175) with a FATCAT P-Value: 3.06e-12 and RMSD of 9.31 angstrom. The sequence alignment identity is 51.6%.
Structural alignment shown in left. Query protein P0C221 colored as red in alignment, homolog Q5PQJ9 colored as blue. Query protein P0C221 is also shown in right top, homolog Q5PQJ9 showed in right bottom. They are colored based on secondary structures. 

  P0C221 MALSPWTPGLG-AGEKLVQAAAVSTGPSLELCTLPSTLGSSVAVEALEQLFVVEQSLQSDYFKCNEEAKIFLKDIAVAVKKLEEMRKATIDLLEIESMEL 99
  Q5PQJ9 MAMRSWTPDQGFVDRKLVRPASVSTSLSLELCTFPSTLGSSVAANALEQLLVVEKSLQGDYFTCNEEVKTFLKDITVAVKKLEEMRKNTIELLEIESMEL 100

  P0C221 NKLYYLLETLPNSIKRELEECVRDARRLNLFEINTIKMRITRTENEIELLKKKITDLTKYNEALGEKQEELARKHARFVLSLNQTMEKKATTTVYINETY 199
  Q5PQJ9 SRLYFLLETVPNSMHKELQECILEARRLNILEISQVKGKIEKTNDEIKFLNDKIIELKNMNEALGIKQVELAKQHAKFVLLLNQTLEEKAVATICINDTY 200

  P0C221 TKINLKREDIALQKKCIQEAEELMEKERAEYLIRKQELTAQINEFENTREVKRMETYQKKKELDKLQTKMSKIKETVTVSAAVLSDHNLEIARLHESIRY 299
  Q5PQJ9 TRIKFEKEEIGLQKQCLQDATDLIEKHKQEHRKKKERLAERIKDVKQSCEEKRKEAYNKRKELTRLQNKIIKMKQTVTTNAVMINDKSLEIMRLRETADL 300

  P0C221 WEQEVSELKKDLAILEAKLCFFTDNKEKLDDISNDEKNEFLNKIKQLVETLHAARMEYKDLREKMKTLARQYKIVLSEEEKAFLQKQKIHDENQKQLTFI 399
  Q5PQJ9 WKKKVEDMKRVCESLEEKLLFFLTHKQQIDSVSSEKKSGFISQIQQVAEKLQKINKENKDLRDRLNTLLKQYKITLKEEEAMSLQRQKMAEEHQKQMELL 400

  P0C221 SQKEYFLSQKRVDIKNMEEGLITLQELQQATKTVYQQQIKILSANLERESQRCVITQWKMACLRKKHARWTAKIKAEI-QAITEKIQNAEVRRIELLNET 498
  Q5PQJ9 NQKETFLTQRKLDIKNMEEGFSTLRDLNVATKEVYRKQIKLLTENLERELQRWVVNQWRLLCSRKRHSRWLHKTKLTLRKIITE-IEIAEEKRRQLLKET 499

  P0C221 SFRQQEISGFVAQIEKLTTELKEEEKAFVNKEKMLMKELSKYEEIFVKETQINKEKEEELVEYLPQLQVAEQEYKEKRRKLEELSNIITAQRQEEDLLNN 598
  Q5PQJ9 KRRQKEISRFVNQIETIKEQLEVEEKEYIKKEKKLMKELNKYEDLIIKEAQINKVKEEQLVETLPRLQIAEDDFQEKSRTLKSLQNDISAKKQEETLLST 599

  P0C221 HIFLFTRDFSRYISNMEDVKQELQQLRDQESKKNKDHFETLKNLENGFYINDQKADLLLLENKKLKEYILYLKNNIEKYREGQEALMHTSSDLSRQLIAQ 698
  Q5PQJ9 YIFRYRKDIIRCTNNTETVKRDMRHIRTLESEKTQSHFEALKNLENEIYVNDQKLALLILENKKLRDYLAYLKKHTKEYSEKQIVTVQNSGDLSWQLIAQ 699

  P0C221 EAQYKDLWAEFQTTVKILVDNGEETLQDINNLTDKLRERDEKMQHVSTWLRGSLEGLRLLVEQESPM-----DLLK---KKKHIRTRVHF-PVVKCTEKN 789
  Q5PQJ9 HSQYSDLLAEFQIKIKELVDTGEETLQEIRSLASKLRYRDEKIESISAWLLGGIERLHSLMEEESPSSLSKEDLQKAGMKQKEEKT-LRFSPSLH-TRRD 797

  P0C221 TLTK---------------- 793
  Q5PQJ9 TLSRNCKMIKKRSRSPKNKP 817

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0008022 protein C-terminus binding
2. P GO:0097539 ciliary transition fiber
2. P GO:0006611 protein export from nucleus
2. P GO:0070530 K63-linked polyubiquitin modification-dependent protein binding
2. P GO:0007094 mitotic spindle assembly checkpoint signaling
2. P GO:0045141 meiotic telomere clustering
2. P GO:0090161 Golgi ribbon formation
2. P GO:0005874 microtubule
2. P GO:0051026 chiasma assembly
2. P GO:1903251 multi-ciliated epithelial cell differentiation
2. P GO:0035148 tube formation
2. P GO:0048786 presynaptic active zone
2. P GO:0030992 intraciliary transport particle B
2. P GO:0044615 nuclear pore nuclear basket
2. P GO:0048874 host-mediated regulation of intestinal microbiota composition
2. P GO:0007507 heart development
2. P GO:0030010 establishment of cell polarity
2. P GO:0031122 cytoplasmic microtubule organization
2. P GO:0009903 chloroplast avoidance movement
2. P GO:1904526 regulation of microtubule binding
2. P GO:0048193 Golgi vesicle transport
2. P GO:0044877 protein-containing complex binding
2. P GO:0000138 Golgi trans cisterna
2. P GO:1904417 positive regulation of xenophagy
2. P GO:0008340 determination of adult lifespan
2. P GO:0071907 determination of digestive tract left/right asymmetry
2. P GO:0035092 sperm DNA condensation
2. P GO:0008017 microtubule binding
2. P GO:0007032 endosome organization
2. P GO:0007020 microtubule nucleation
2. P GO:0032982 myosin filament
2. P GO:0120103 centriolar subdistal appendage
2. P GO:0048790 maintenance of presynaptic active zone structure
2. P GO:0032663 regulation of interleukin-2 production
2. P GO:0001673 male germ cell nucleus
2. P GO:0097431 mitotic spindle pole
2. P GO:0090166 Golgi disassembly
2. P GO:0022027 interkinetic nuclear migration
2. P GO:0034067 protein localization to Golgi apparatus
2. P GO:0030897 HOPS complex
2. P GO:0051301 cell division
2. P GO:0002756 MyD88-independent toll-like receptor signaling pathway
2. P GO:0008356 asymmetric cell division
2. P GO:0044774 mitotic DNA integrity checkpoint signaling
2. P GO:0010507 negative regulation of autophagy
2. P GO:0000802 transverse filament
2. P GO:0071910 determination of liver left/right asymmetry
2. P GO:0007283 spermatogenesis
2. P GO:0030324 lung development
2. P GO:0051878 lateral element assembly
2. P GO:0043025 neuronal cell body
2. P GO:0060287 epithelial cilium movement involved in determination of left/right asymmetry
2. P GO:0071955 recycling endosome to Golgi transport
2. P GO:0032725 positive regulation of granulocyte macrophage colony-stimulating factor production
2. P GO:0042130 negative regulation of T cell proliferation
2. P GO:0120229 protein localization to motile cilium
2. P GO:0005886 plasma membrane
2. P GO:0032815 negative regulation of natural killer cell activation
2. P GO:0008104 protein localization
2. P GO:0001520 outer dense fiber
2. P GO:0015031 protein transport
2. P GO:0036159 inner dynein arm assembly
2. P GO:0006913 nucleocytoplasmic transport
2. P GO:0051649 establishment of localization in cell
2. P GO:0005816 spindle pole body
2. P GO:0005863 striated muscle myosin thick filament
2. P GO:0008333 endosome to lysosome transport
2. P GO:1905232 cellular response to L-glutamate
2. P GO:0060077 inhibitory synapse
2. P GO:0042734 presynaptic membrane
2. P GO:0010564 regulation of cell cycle process
2. P GO:0036126 sperm flagellum
2. P GO:0031985 Golgi cisterna
2. P GO:0110120 gamma-tubulin complex localization to nuclear side of mitotic spindle pole body
2. P GO:0035889 otolith tethering
2. P GO:0020035 cytoadherence to microvasculature, mediated by symbiont protein
2. P GO:0007249 I-kappaB kinase/NF-kappaB signaling
2. P GO:0072686 mitotic spindle
2. P GO:0001947 heart looping
2. P GO:0043515 kinetochore binding
2. P GO:0006897 endocytosis
2. P GO:0070695 FHF complex
2. P GO:0000242 pericentriolar material
2. P GO:0036064 ciliary basal body
2. P GO:0031593 polyubiquitin modification-dependent protein binding
2. P GO:0030276 clathrin binding
2. P GO:0016064 immunoglobulin mediated immune response
2. P GO:0120317 sperm mitochondrial sheath assembly
2. P GO:0005930 axoneme
2. P GO:0090268 activation of mitotic cell cycle spindle assembly checkpoint
2. P GO:0007010 cytoskeleton organization
2. P GO:0051660 establishment of centrosome localization
2. P GO:0097225 sperm midpiece
2. P GO:0003146 heart jogging
2. P GO:0033116 endoplasmic reticulum-Golgi intermediate compartment membrane
2. P GO:0060294 cilium movement involved in cell motility
2. P GO:0003677 DNA binding
2. P GO:0048471 perinuclear region of cytoplasm
2. P GO:0030031 cell projection assembly
2. P GO:0051289 protein homotetramerization
2. P GO:0000775 chromosome, centromeric region
2. P GO:1900017 positive regulation of cytokine production involved in inflammatory response
2. P GO:0005814 centriole
2. P GO:0061734 parkin-mediated stimulation of mitophagy in response to mitochondrial depolarization
2. P GO:0043330 response to exogenous dsRNA
2. P GO:0034452 dynactin binding
2. P GO:0005776 autophagosome
2. P GO:0000794 condensed nuclear chromosome
2. P GO:0061760 antifungal innate immune response
2. P GO:0030241 skeletal muscle myosin thick filament assembly
2. P GO:0003356 regulation of cilium beat frequency
2. P GO:1902426 deactivation of mitotic spindle assembly checkpoint
2. P GO:0044691 tooth eruption
2. P GO:0007368 determination of left/right symmetry
2. P GO:0032495 response to muramyl dipeptide
2. P GO:0097228 sperm principal piece
2. P GO:0015630 microtubule cytoskeleton
2. P GO:0000795 synaptonemal complex
2. P GO:0032740 positive regulation of interleukin-17 production
2. P GO:0035735 intraciliary transport involved in cilium assembly
2. P GO:0000137 Golgi cis cisterna
2. P GO:0005801 cis-Golgi network
2. P GO:0051220 cytoplasmic sequestering of protein
2. P GO:0007274 neuromuscular synaptic transmission
2. P GO:0000776 kinetochore
2. P GO:0050768 negative regulation of neurogenesis
2. P GO:0044782 cilium organization
2. P GO:0000077 DNA damage checkpoint signaling
2. P GO:0045880 positive regulation of smoothened signaling pathway
2. P GO:0035773 insulin secretion involved in cellular response to glucose stimulus
2. P GO:0005635 nuclear envelope
2. P GO:0048788 cytoskeleton of presynaptic active zone
2. P GO:2000769 regulation of establishment or maintenance of cell polarity regulating cell shape
2. P GO:0005768 endosome
2. P GO:0050772 positive regulation of axonogenesis
2. P GO:0035082 axoneme assembly
2. P GO:0098831 presynaptic active zone cytoplasmic component
2. P GO:0060050 positive regulation of protein glycosylation
2. P GO:0097224 sperm connecting piece
2. P GO:0030705 cytoskeleton-dependent intracellular transport
2. P GO:0080115 myosin XI tail binding
2. P GO:0071539 protein localization to centrosome
2. P GO:0045503 dynein light chain binding
2. P GO:0003351 epithelial cilium movement involved in extracellular fluid movement
2. P GO:0030016 myofibril
2. P GO:2000318 positive regulation of T-helper 17 type immune response
2. P GO:0001819 positive regulation of cytokine production
2. P GO:0034451 centriolar satellite
2. P GO:0098882 structural constituent of presynaptic active zone
2. P GO:2000179 positive regulation of neural precursor cell proliferation
2. P GO:1902254 negative regulation of intrinsic apoptotic signaling pathway by p53 class mediator
2. P GO:1905198 manchette assembly
2. P GO:0032091 negative regulation of protein binding
2. P GO:1902440 protein localization to mitotic spindle pole body
2. P GO:0007030 Golgi organization
2. P GO:1902018 negative regulation of cilium assembly
2. P GO:0005929 cilium
2. P GO:0051645 Golgi localization
2. P GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport
2. P GO:0098535 de novo centriole assembly involved in multi-ciliated epithelial cell differentiation
2. P GO:0048487 beta-tubulin binding
2. P GO:0000711 meiotic DNA repair synthesis
2. P GO:0032494 response to peptidoglycan
2. P GO:0000301 retrograde transport, vesicle recycling within Golgi
2. P GO:0007420 brain development
2. P GO:0045505 dynein intermediate chain binding
2. P GO:0051315 attachment of mitotic spindle microtubules to kinetochore
2. P GO:0097120 receptor localization to synapse
2. P GO:0003341 cilium movement
2. P GO:0007098 centrosome cycle
2. P GO:0031023 microtubule organizing center organization
2. P GO:0019901 protein kinase binding
2. P GO:0032880 regulation of protein localization
2. P GO:0051959 dynein light intermediate chain binding
2. P GO:1901925 negative regulation of protein import into nucleus during spindle assembly checkpoint
2. P GO:0000922 spindle pole
2. P GO:0050700 CARD domain binding
2. P GO:0005802 trans-Golgi network
2. P GO:0007129 homologous chromosome pairing at meiosis
2. P GO:0060285 cilium-dependent cell motility
2. P GO:0045089 positive regulation of innate immune response
2. P GO:0048167 regulation of synaptic plasticity
2. P GO:0007288 sperm axoneme assembly
2. P GO:0010457 centriole-centriole cohesion
2. P GO:0030030 cell projection organization
2. P GO:0030165 PDZ domain binding
2. P GO:0005694 chromosome
2. P GO:0090306 meiotic spindle assembly
2. P GO:0043001 Golgi to plasma membrane protein transport
2. P GO:0051298 centrosome duplication
2. P GO:0007130 synaptonemal complex assembly
2. P GO:1905515 non-motile cilium assembly
2. P GO:0061676 importin-alpha family protein binding
2. P GO:0005856 cytoskeleton
2. P GO:0090235 regulation of metaphase plate congression
2. P GO:0032722 positive regulation of chemokine production
2. P GO:0046600 negative regulation of centriole replication
2. P GO:0032580 Golgi cisterna membrane
2. P GO:0000801 central element
2. P GO:0043124 negative regulation of I-kappaB kinase/NF-kappaB signaling
2. P GO:0097729 9+2 motile cilium
2. P GO:0001155 TFIIIA-class transcription factor binding
2. P GO:0051225 spindle assembly
2. P GO:0097298 regulation of nucleus size
2. P GO:0030500 regulation of bone mineralization
2. P GO:0002446 neutrophil mediated immunity
2. P GO:1905719 protein localization to perinuclear region of cytoplasm
2. P GO:0045022 early endosome to late endosome transport
2. P GO:0097150 neuronal stem cell population maintenance
2. P GO:0061512 protein localization to cilium
2. P GO:0070286 axonemal dynein complex assembly
2. P GO:0003334 keratinocyte development
2. P GO:0009904 chloroplast accumulation movement
2. P GO:0045162 clustering of voltage-gated sodium channels
2. P GO:0007131 reciprocal meiotic recombination
2. P GO:0090660 cerebrospinal fluid circulation
2. P GO:0030134 COPII-coated ER to Golgi transport vesicle
2. P GO:0033630 positive regulation of cell adhesion mediated by integrin
2. P GO:0099518 vesicle cytoskeletal trafficking
2. P GO:0003355 cilium movement involved in otolith formation
2. P GO:0035630 bone mineralization involved in bone maturation
2. P GO:0008385 IkappaB kinase complex
2. P GO:0097733 photoreceptor cell cilium
2. P GO:0048278 vesicle docking
2. P GO:0007099 centriole replication
2. P GO:0043122 regulation of I-kappaB kinase/NF-kappaB signaling
2. P GO:0035469 determination of pancreatic left/right asymmetry
2. P GO:0061966 establishment of left/right asymmetry
2. P GO:0090307 mitotic spindle assembly
2. P GO:0016459 myosin complex
2. P GO:1903566 positive regulation of protein localization to cilium
2. P GO:0034613 cellular protein localization
2. P GO:0035686 sperm fibrous sheath
2. P GO:0007040 lysosome organization
2. P GO:0034454 microtubule anchoring at centrosome
2. P GO:0030154 cell differentiation
2. P GO:0098536 deuterosome
2. P GO:0031393 negative regulation of prostaglandin biosynthetic process
2. P GO:0016082 synaptic vesicle priming
2. P GO:0005798 Golgi-associated vesicle
2. P GO:0005822 inner plaque of spindle pole body
2. P GO:0048538 thymus development
2. P GO:0005794 Golgi apparatus
2. P GO:0098982 GABA-ergic synapse
2. P GO:0007286 spermatid development
2. P GO:0016021 integral component of membrane
2. P GO:0031267 small GTPase binding
2. P GO:0060271 cilium assembly
2. P GO:0030317 flagellated sperm motility
2. P GO:0031514 motile cilium
2. P GO:0099635 voltage-gated calcium channel activity involved in positive regulation of presynaptic cytosolic calcium levels
2. P GO:0005813 centrosome
2. P GO:0005829 cytosol
2. P GO:0046872 metal ion binding
2. P GO:0045202 synapse
2. P GO:0044458 motile cilium assembly
2. P GO:0070861 regulation of protein exit from endoplasmic reticulum
2. P GO:0001669 acrosomal vesicle
2. P GO:0032449 CBM complex
2. P GO:0000139 Golgi membrane
2. P GO:1902017 regulation of cilium assembly
2. P GO:0042770 signal transduction in response to DNA damage
2. P GO:0032874 positive regulation of stress-activated MAPK cascade
2. P GO:0001920 negative regulation of receptor recycling
2. P GO:0019905 syntaxin binding
2. P GO:0042802 identical protein binding
2. P GO:0017080 sodium channel regulator activity
2. P GO:0071439 clathrin complex
3. B GO:0007411 axon guidance
3. B GO:0031594 neuromuscular junction
3. B GO:2000280 regulation of root development
3. B GO:0030155 regulation of cell adhesion
3. B GO:0060445 branching involved in salivary gland morphogenesis
3. B GO:0032224 positive regulation of synaptic transmission, cholinergic
3. B GO:0009888 tissue development
3. B GO:0005608 laminin-3 complex
3. B GO:1902584 positive regulation of response to water deprivation
3. B GO:0005201 extracellular matrix structural constituent
3. B GO:0005604 basement membrane
3. B GO:0002011 morphogenesis of an epithelial sheet
3. B GO:0043197 dendritic spine
3. B GO:0005102 signaling receptor binding
3. B GO:0005606 laminin-1 complex
3. B GO:0016363 nuclear matrix
3. B GO:0043083 synaptic cleft
3. B GO:0040008 regulation of growth
3. B GO:0030334 regulation of cell migration
3. B GO:0042383 sarcolemma
3. B GO:0061304 retinal blood vessel morphogenesis
3. B GO:0005652 nuclear lamina
3. B GO:0005911 cell-cell junction
3. B GO:0048514 blood vessel morphogenesis
3. B GO:0045995 regulation of embryonic development
3. B GO:0045198 establishment of epithelial cell apical/basal polarity
3. B GO:0007517 muscle organ development
3. B GO:0007166 cell surface receptor signaling pathway
3. B GO:0062023 collagen-containing extracellular matrix
3. B GO:0043010 camera-type eye development
3. B GO:0014037 Schwann cell differentiation
3. B GO:0035633 maintenance of blood-brain barrier
3. B GO:0006997 nucleus organization
3. B GO:0043208 glycosphingolipid binding
3. B GO:0007155 cell adhesion
3. B GO:0060441 epithelial tube branching involved in lung morphogenesis
3. B GO:0009887 animal organ morphogenesis

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB P0C221 Coiled-coil domain-containing protein 175 0 5.03e-151 0.0
1. PB Q2T9Z6 Coiled-coil domain-containing protein 175 2.43e-11 9.32e-48 0.0
1. PB Q5PQJ9 Coiled-coil domain-containing protein 175 3.06e-12 2.16e-49 0.0
1. PB E9PVB3 Coiled-coil domain-containing protein 175 1.49e-10 1.42e-37 0.0
2. P A6NI56 Coiled-coil domain-containing protein 154 6.89e-09 1.27e-04 NA
2. P Q3UPP8 Centrosomal protein of 63 kDa 4.46e-09 2.92e-03 NA
2. P Q86SQ7 Serologically defined colon cancer antigen 8 2.53e-02 1.61e-05 NA
2. P Q9NUQ3 Gamma-taxilin 6.94e-04 3.93e-03 NA
2. P Q5T655 Cilia- and flagella-associated protein 58 3.21e-10 4.21e-18 NA
2. P Q5XHZ2 Synaptonemal complex central element protein 1 5.07e-05 4.88e-02 NA
2. P Q62209 Synaptonemal complex protein 1 2.05e-06 5.19e-07 NA
2. P Q9FWW5 WEB family protein At1g12150 2.98e-09 1.57e-03 NA
2. P Q02171 Paramyosin 2.42e-09 2.88e-06 NA
2. P Q5T9S5 Coiled-coil domain-containing protein 18 1.51e-03 2.64e-03 NA
2. P P35415 Paramyosin, long form 1.53e-08 9.80e-09 NA
2. P Q5BJE1 Coiled-coil domain-containing protein 178 4.39e-08 1.09e-12 NA
2. P Q9D5Y1 Coiled-coil domain-containing protein 39 4.10e-07 2.96e-08 NA
2. P Q8HZ60 Coiled-coil alpha-helical rod protein 1 4.15e-09 1.29e-03 NA
2. P Q6DFL0 Coiled-coil domain-containing protein 102A 4.34e-05 2.06e-05 NA
2. P Q5D525 Synaptonemal complex central element protein 1-like 4.28e-04 6.01e-03 NA
2. P Q4KLY0 Centrosomal protein of 63 kDa 7.29e-10 2.70e-08 NA
2. P P39921 Tropomyosin-1 2.31e-07 2.77e-06 NA
2. P Q8C9S4 Coiled-coil domain-containing protein 186 1.98e-07 6.60e-04 NA
2. P B3NL60 Protein hook 4.64e-06 4.94e-04 NA
2. P Q6ZU80 Centrosomal protein of 128 kDa 1.65e-07 4.13e-06 NA
2. P P35417 Paramyosin 6.05e-05 9.51e-06 NA
2. P Q24185 Protein hook 1.62e-04 4.78e-04 NA
2. P Q9H257 Caspase recruitment domain-containing protein 9 5.65e-05 3.47e-02 NA
2. P Q6FS63 Spindle assembly checkpoint component MAD1 2.54e-08 3.58e-05 NA
2. P Q5ZKK5 Outer dense fiber protein 2 1.93e-09 2.06e-10 NA
2. P Q8R5M4 Optineurin 5.42e-08 6.89e-04 NA
2. P Q5M9N0 Coiled-coil domain-containing protein 158 8.41e-08 1.31e-04 NA
2. P Q8CDI7 Coiled-coil domain-containing protein 150 2.01e-06 1.42e-06 NA
2. P Q6NY15 Testis-specific gene 10 protein 5.22e-09 2.56e-07 NA
2. P Q5PQ23 Outer dense fiber protein 2 6.42e-08 1.44e-06 NA
2. P D3Z8K2 Coiled-coil domain-containing protein 39 1.94e-08 6.72e-12 NA
2. P Q2YDH9 Coiled-coil domain-containing protein 172 2.76e-07 7.94e-05 NA
2. P Q6PH08 ERC protein 2 4.90e-08 1.05e-02 NA
2. P B8JK76 Serologically defined colon cancer antigen 8 homolog 1.24e-10 8.61e-04 NA
2. P Q96KP6 TNFAIP3-interacting protein 3 3.92e-07 6.38e-03 NA
2. P Q15431 Synaptonemal complex protein 1 6.66e-07 2.71e-06 NA
2. P F1R4Y7 Centrosomal protein of 83 kDa 7.11e-09 2.97e-17 NA
2. P O15083 ERC protein 2 8.71e-09 4.96e-03 NA
2. P Q8K3K8 Optineurin 3.09e-07 1.36e-02 NA
2. P Q6DFC2 Coiled-coil domain-containing protein 77 4.28e-06 2.15e-08 NA
2. P Q8HZ59 Coiled-coil alpha-helical rod protein 1 3.34e-08 8.53e-03 NA
2. P Q6C452 Spindle assembly checkpoint component MAD1 4.47e-06 8.75e-06 NA
2. P Q01202 Paramyosin 2.75e-07 1.48e-07 NA
2. P Q8TD31 Coiled-coil alpha-helical rod protein 1 5.93e-08 1.41e-02 NA
2. P Q8BHN1 Gamma-taxilin 4.33e-04 1.71e-04 NA
2. P Q7PWT9 Protein hook 4.78e-06 1.10e-02 NA
2. P Q9D4H2 GRIP and coiled-coil domain-containing protein 1 8.91e-05 1.95e-03 NA
2. P Q6FY25 Spindle pole body component 110 2.79e-09 3.30e-07 NA
2. P Q9LS42 Protein CASP 2.45e-06 1.85e-04 NA
2. P Q874L7 Spindle assembly checkpoint component MAD1 1.13e-07 1.57e-03 NA
2. P Q9D5R3 Centrosomal protein of 83 kDa 2.53e-08 6.89e-11 NA
2. P Q8BIL5 Protein Hook homolog 1 1.57e-02 6.48e-05 NA
2. P Q92805 Golgin subfamily A member 1 6.83e-08 2.09e-04 NA
2. P Q6BSY1 Spindle assembly checkpoint component MAD1 1.41e-06 1.06e-03 NA
2. P Q9FMN1 Protein WEAK CHLOROPLAST MOVEMENT UNDER BLUE LIGHT-like 3 5.13e-07 1.11e-02 NA
2. P Q8CDI6 Coiled-coil domain-containing protein 158 9.65e-04 9.42e-03 NA
2. P Q9FLH0 Protein CROWDED NUCLEI 4 4.25e-08 1.77e-02 NA
2. P Q8N8E3 Centrosomal protein of 112 kDa 9.51e-08 4.19e-02 NA
2. P Q75AF5 Golgin IMH1 9.74e-09 2.91e-07 NA
2. P Q5PR68 Centrosomal protein of 112 kDa 1.15e-07 1.15e-03 NA
2. P Q5U3Z6 Deuterosome assembly protein 1 3.73e-08 1.19e-03 NA
2. P A0JNH6 Coiled-coil domain-containing protein 102A 8.34e-07 6.12e-04 NA
2. P Q08B20 Protein BCAP 1.95e-08 2.11e-05 NA
2. P Q80YF0 Mitotic spindle assembly checkpoint protein MAD1 9.14e-07 3.53e-06 NA
2. P Q499U4 Dynein regulatory complex subunit 4 1.08e-05 3.70e-03 NA
2. P Q8BUK6 Protein Hook homolog 3 5.51e-02 2.02e-04 NA
2. P Q9NJA9 Paramyosin 3.69e-09 5.60e-07 NA
2. P Q9EPY0 Caspase recruitment domain-containing protein 9 1.47e-04 2.39e-02 NA
2. P P35418 Paramyosin 9.55e-09 2.26e-05 NA
2. P Q8TC20 Cancer-associated gene 1 protein 1.19e-03 5.49e-03 NA
2. P O54887 Testis-specific serine kinase substrate 1.62e-04 2.41e-02 NA
2. P Q8BSN3 outer dynein arm-docking complex subunit 3 1.12e-06 1.18e-02 NA
2. P Q6PGZ0 Centrosomal protein of 63 kDa 1.38e-09 1.82e-03 NA
2. P A8HUA1 Cilia- and flagella-associated protein 58 1.47e-11 3.52e-16 NA
2. P Q8K2I2 Coiled-coil alpha-helical rod protein 1 2.75e-08 8.28e-03 NA
2. P C5DY19 Spindle pole body component 110 6.79e-03 1.12e-08 NA
2. P Q9Z220 Testis-specific gene 10 protein 1.61e-09 1.83e-06 NA
2. P Q95JK1 Deuterosome assembly protein 1 3.19e-07 1.91e-03 NA
2. P Q6RCE1 Intraflagellar transport protein 74 5.12e-07 4.30e-05 NA
2. P Q9Y6D9 Mitotic spindle assembly checkpoint protein MAD1 6.54e-07 5.06e-06 NA
2. P Q8IYT3 Coiled-coil domain-containing protein 170 3.73e-09 8.12e-05 NA
2. P Q6RUT8 Coiled-coil domain-containing protein 154 3.59e-07 1.95e-03 NA
2. P C5DJH6 Spindle pole body component 110 1.56e-04 6.49e-08 NA
2. P Q7M6Y5 Deuterosome assembly protein 1 4.65e-07 1.24e-02 NA
2. P Q86RN8 Paramyosin 2.60e-09 9.75e-11 NA
2. P Q96CN9 GRIP and coiled-coil domain-containing protein 1 2.08e-06 2.85e-05 NA
2. P Q811U3 ELKS/Rab6-interacting/CAST family member 1 1.03e-06 6.53e-04 NA
2. P Q6GQ73 Protein Hook homolog 3 5.12e-08 1.98e-04 NA
2. P Q60779 Dynein regulatory complex subunit 4 9.72e-06 2.40e-03 NA
2. P Q4R8C3 Outer dense fiber protein 2 2.43e-10 6.03e-10 NA
2. P B4KE73 Protein hook 4.59e-03 3.04e-03 NA
2. P Q0KK56 Protein FAM184B 5.48e-07 3.18e-02 NA
2. P Q8NCX0 Coiled-coil domain-containing protein 150 1.02e-06 3.38e-04 NA
2. P Q6CMM2 Spindle assembly checkpoint component MAD1 2.41e-08 1.11e-03 NA
2. P Q7NBF8 Cytadherence high molecular weight protein 2 7.54e-06 5.11e-03 NA
2. P B4N1C2 Protein hook 4.21e-03 1.19e-02 NA
2. P Q0V9R4 Coiled-coil domain-containing protein 39 4.53e-08 1.23e-05 NA
2. P Q6AYX5 Outer dense fiber protein 2 1.94e-08 6.35e-06 NA
2. P A6ZYV5 Spindle pole body component 110 3.01e-08 1.16e-03 NA
2. P Q0VBY1 Protein BCAP 8.15e-07 4.44e-08 NA
2. P O64584 WPP domain-associated protein 3.42e-07 2.20e-06 NA
2. P O61493 Protein hook 6.15e-07 1.74e-03 NA
2. P A7THU9 Spindle pole body component 110 8.17e-09 2.32e-07 NA
2. P Q8L7E5 WPP domain-interacting tail-anchored protein 1 2.11e-06 1.01e-03 NA
2. P Q96A19 Coiled-coil domain-containing protein 102A 2.95e-07 7.06e-03 NA
2. P Q05870 Paramyosin 4.66e-08 9.78e-04 NA
2. P Q56A40 Coiled-coil domain-containing protein 40 7.05e-08 1.51e-16 NA
2. P Q26789 73 kDa paraflagellar rod protein 2.99e-06 2.88e-05 NA
2. P Q86VS8 Protein Hook homolog 3 2.33e-06 4.43e-04 NA
2. P B4JAL5 Protein hook 3.46e-06 1.82e-03 NA
2. P Q756L3 Spindle pole body component 110 7.79e-07 1.71e-10 NA
2. P Q8WXW3 Progesterone-induced-blocking factor 1 1.86e-08 5.20e-08 NA
2. P Q921M4 Golgin subfamily A member 2 1.12e-08 5.13e-08 NA
2. P Q80UF4 Serologically defined colon cancer antigen 8 homolog 3.22e-10 8.98e-04 NA
2. P Q8T305 Paramyosin NA 4.45e-05 NA
2. P B3LFU6 Spindle pole body component 110 1.18e-07 1.57e-03 NA
2. P Q9UFE4 Coiled-coil domain-containing protein 39 7.51e-09 1.15e-07 NA
2. P Q08379 Golgin subfamily A member 2 4.84e-07 8.87e-07 NA
2. P Q8BKE9 Intraflagellar transport protein 74 homolog 2.24e-05 1.70e-04 NA
2. P Q5XJN6 Coiled-coil domain-containing protein 113 1.82e-07 2.75e-03 NA
2. P Q3TMW1 Coiled-coil domain-containing protein 102A 5.01e-05 7.88e-03 NA
2. P P34562 GRIP and coiled-coil domain-containing protein 2 3.15e-06 6.85e-03 NA
2. P Q6NZW0 Coiled-coil domain-containing protein 102A 5.94e-05 1.64e-03 NA
2. P B6MFW3 Protein Hook homolog 1.01e-07 1.12e-03 NA
2. P Q9CW79 Golgin subfamily A member 1 6.22e-07 1.23e-05 NA
2. P Q29N92 Protein hook 1.04e-05 4.81e-03 NA
2. P Q5R829 Outer dense fiber protein 2 2.38e-09 5.19e-07 NA
2. P Q8IYE0 Coiled-coil domain-containing protein 146 2.73e-07 7.81e-21 NA
2. P P75471 Cytadherence high molecular weight protein 2 4.30e-07 4.57e-02 NA
2. P A5D7M3 Dynein regulatory complex subunit 4 1.17e-05 1.06e-03 NA
2. P O96064 Paramyosin 3.25e-09 1.90e-05 NA
2. P Q8HZ57 Coiled-coil alpha-helical rod protein 1 6.12e-04 1.54e-03 NA
2. P P06198 Paramyosin 6.60e-08 1.25e-03 NA
2. P Q9WTX8 Mitotic spindle assembly checkpoint protein MAD1 2.10e-06 5.33e-07 NA
2. P O23564 Putative WEB family protein At4g17210 1.07e-07 5.56e-04 NA
2. P B2RW38 Cilia- and flagella-associated protein 58 2.10e-09 4.32e-15 NA
2. P D3ZZL9 GRIP and coiled-coil domain-containing protein 2 1.81e-03 6.07e-03 NA
2. P E2R1I5 Coiled-coil domain-containing protein 39 4.53e-09 1.81e-09 NA
2. P Q5BJF6 Outer dense fiber protein 2 2.28e-03 1.85e-11 NA
2. P Q96NL6 Sodium channel and clathrin linker 1 4.54e-09 3.22e-07 NA
2. P A8MQR0 WPP domain-interacting tail-anchored protein 2 3.62e-08 1.48e-02 NA
2. P Q9ULJ1 Protein BCAP 6.77e-09 6.33e-05 NA
2. P Q29RS0 Coiled-coil domain-containing protein 89 5.95e-07 6.28e-06 NA
2. P P97779 Hyaluronan-mediated motility receptor 1.05e-05 1.11e-03 NA
2. P B4PAF2 Protein hook 9.35e-07 4.63e-04 NA
2. P Q9BZW7 Testis-specific gene 10 protein 3.80e-09 6.74e-06 NA
2. P Q62839 Golgin subfamily A member 2 1.34e-08 5.12e-09 NA
2. P Q95JI9 Coiled-coil domain-containing protein 89 9.41e-04 8.98e-07 NA
2. P Q84WU4 Golgin candidate 3 2.34e-07 3.71e-02 NA
2. P Q7FAD5 Synaptonemal complex protein ZEP1 1.67e-07 2.23e-04 NA
2. P Q05D60 Deuterosome assembly protein 1 1.09e-09 1.08e-03 NA
2. P F1QNW4 Dynein regulatory complex subunit 4 2.45e-05 9.42e-03 NA
2. P Q9Z221 Polyamine-modulated factor 1-binding protein 1 3.88e-09 4.70e-02 NA
2. P Q9WVQ0 Polyamine-modulated factor 1-binding protein 1 3.15e-09 1.18e-03 NA
2. P Q90Z16 Optineurin 9.18e-08 4.02e-04 NA
2. P O15697 Trypanin 3.54e-06 2.34e-06 NA
2. P A3KGV1 Outer dense fiber protein 2 4.16e-08 1.20e-11 NA
2. P Q96LB3 Intraflagellar transport protein 74 homolog 7.09e-05 1.34e-05 NA
2. P O95995 Dynein regulatory complex subunit 4 9.19e-06 1.41e-03 NA
2. P Q8L7S4 Microtubule-associated protein 70-2 3.35e-04 1.91e-03 NA
2. P P32380 Spindle pole body component 110 2.54e-05 1.60e-03 NA
2. P Q9C9N6 Protein PLASTID MOVEMENT IMPAIRED 2 1.46e-10 2.89e-03 NA
2. P Q19782 Intermediate filament protein ifd-2 6.53e-07 1.19e-02 NA
2. P Q8MUF6 Paramyosin 1.69e-08 3.90e-09 NA
2. P Q06704 Golgin IMH1 4.22e-05 1.38e-03 NA
2. P P10567 Paramyosin 8.04e-10 3.53e-06 NA
2. P Q8VYU6 Golgin candidate 4 3.80e-07 7.76e-05 NA
2. P Q8K3M6 ERC protein 2 4.93e-05 1.48e-02 NA
2. P Q6CMB5 Spindle pole body component 110 1.43e-04 1.31e-05 NA
2. P Q9D495 Synaptonemal complex central element protein 1 4.88e-05 1.41e-03 NA
2. P Q7Z3E2 Coiled-coil domain-containing protein 186 2.70e-08 1.30e-04 NA
2. P B4I5P7 Protein hook 4.42e-03 6.12e-04 NA
2. P Q9BMM8 Paramyosin 4.08e-08 4.86e-11 NA
2. P B0WPU9 Protein hook 5.30e-05 2.13e-02 NA
2. P Q8S2T0 Protein GRIP 1.75e-07 5.10e-05 NA
2. P Q7ZW57 Coiled-coil domain-containing protein 89 1.70e-06 2.44e-04 NA
2. P P22225 69 kDa paraflagellar rod protein 8.16e-09 1.29e-03 NA
2. P Q8CDV0 Coiled-coil domain-containing protein 178 5.75e-07 8.53e-12 NA
2. P Q8N998 Coiled-coil domain-containing protein 89 3.99e-08 4.53e-07 NA
2. P Q8BI22 Centrosomal protein of 128 kDa 4.08e-07 1.76e-03 NA
2. P Q96ST8 Centrosomal protein of 89 kDa 5.12e-06 3.85e-02 NA
2. P A8IQE0 Coiled-coil domain-containing protein 39 7.15e-05 1.95e-12 NA
2. P P0CK98 Coiled-coil domain-containing protein 39 3.80e-11 2.53e-07 NA
2. P Q95XR4 Ectopic P granules protein 2 1.94e-08 7.20e-08 NA
2. P Q8VYU8 Interactor of constitutive active ROPs 5 3.51e-06 2.21e-02 NA
2. P Q9DA73 Coiled-coil domain-containing protein 89 4.60e-08 6.59e-07 NA
2. P Q8TBA6 Golgin subfamily A member 5 1.23e-04 1.01e-03 NA
2. P Q9LTY1 Mitotic spindle checkpoint protein MAD1 1.31e-06 5.41e-08 NA
2. P C8Z5R8 Spindle pole body component 110 1.32e-07 5.68e-04 NA
2. P G5E861 Sodium channel and clathrin linker 1 8.73e-09 9.57e-04 NA
2. P B2RZ86 Coiled-coil domain-containing protein 89 9.15e-07 5.77e-06 NA
2. P Q2T9U2 Outer dense fiber protein 2 3.18e-08 1.23e-05 NA
2. P Q6GNT7 Golgin subfamily A member 5 4.05e-06 8.98e-04 NA
2. P Q9CZH8 Coiled-coil domain-containing protein 77 3.54e-07 1.04e-03 NA
2. P B4G831 Protein hook 2.14e-06 5.22e-03 NA
2. P B3MNR6 Protein hook 7.95e-06 4.63e-04 NA
2. P Q4R6W3 Testis-specific gene 10 protein 2.13e-08 5.25e-06 NA
2. P Q66H60 Coiled-coil domain-containing protein 146 1.29e-11 6.88e-13 NA
2. P Q59PD6 Spindle assembly checkpoint component MAD1 7.70e-09 1.57e-03 NA
2. P Q9BR77 Coiled-coil domain-containing protein 77 4.54e-06 4.09e-03 NA
2. P Q5U4E6 Golgin subfamily A member 4 2.07e-04 2.33e-03 NA
2. P Q8BVF4 Coiled-coil domain-containing protein 30 4.22e-09 1.52e-10 NA
2. P Q9U5M4 Tropomyosin-2 2.74e-04 5.87e-04 NA
2. P Q9QYE6 Golgin subfamily A member 5 3.10e-05 1.33e-02 NA
2. P Q5BQN5 WPP domain-associated protein (Fragment) 1.63e-08 1.70e-02 NA
2. P Q68CZ6 HAUS augmin-like complex subunit 3 1.14e-06 3.55e-03 NA
2. P Q5NVN6 Centrosomal protein of 63 kDa 1.48e-09 1.53e-06 NA
2. P Q653N3 Microtubule-associated protein 70-3 7.07e-05 8.70e-03 NA
2. P Q8MT08 Dynein regulatory complex subunit 4 1.89e-06 1.99e-02 NA
2. P Q9Y592 Centrosomal protein of 83 kDa 1.32e-09 6.77e-13 NA
2. P Q5TZ80 Protein Hook homolog 1 1.62e-02 9.94e-05 NA
2. P Q03410 Synaptonemal complex protein 1 3.88e-07 4.25e-05 NA
2. P Q66H89 Centrosomal protein of 83 kDa 5.11e-08 2.45e-09 NA
2. P Q17AF4 Protein hook 3.15e-05 8.53e-03 NA
2. P A8IQT2 Coiled-coil domain-containing protein 40 homolog 3.69e-07 1.54e-02 NA
2. P Q10030 Uncharacterized protein C27D6.1 4.78e-09 1.47e-03 NA
2. P Q9D478 Protein BCAP 5.06e-09 8.53e-13 NA
2. P Q9BE52 CDK5 regulatory subunit-associated protein 2 2.07e-08 2.49e-04 NA
2. P B4Q9E6 Protein hook 1.62e-03 5.87e-04 NA
2. P Q66HB6 Cancer-associated gene 1 protein homolog 1.82e-02 3.12e-02 NA
2. P E1BM70 Coiled-coil domain-containing protein 39 1.81e-11 2.03e-10 NA
2. P Q5ZJ27 Protein Hook homolog 1 2.85e-05 3.98e-04 NA
2. P Q9UJC3 Protein Hook homolog 1 1.56e-06 2.26e-04 NA
2. P Q8HZ58 Coiled-coil alpha-helical rod protein 1 1.90e-07 3.27e-04 NA
3. B Q60675 Laminin subunit alpha-2 NA NA 0.027
3. B Q0JJ05 Nuclear matrix constituent protein 1b 2.66e-07 NA 0.035
3. B P24043 Laminin subunit alpha-2 NA NA 0.001
3. B P25391 Laminin subunit alpha-1 NA NA 0.002