Summary

P0C5K7

Homolog: Q6U949.
Function: Putative insulin-like growth factor 2 antisense gene protein.

Statistics

Total GO Annotation: 7
Unique PROST Go: 7
Unique BLAST Go: 0

Total Homologs: 16
Unique PROST Homologs: 15
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was Q6U949 (Putative insulin-like growth factor 2 antisense gene protein) with a FATCAT P-Value: 0.0338 and RMSD of 3.09 angstrom. The sequence alignment identity is 18.6%.
Structural alignment shown in left. Query protein P0C5K7 colored as red in alignment, homolog Q6U949 colored as blue. Query protein P0C5K7 is also shown in right top, homolog Q6U949 showed in right bottom. They are colored based on secondary structures. 

  P0C5K7 MMHTTSYR--------RLSPPHLTDQPSAYSHTHRTFSHFSCGSQ-----PAAQRLHVELWNADLQSEFLCPCLGLTLYLTCNPQLGKRKFCSHSSEDMS 87
  Q6U949 -MSKRKWRGFRGAQQERAQPPAASPQPCPAPH-----AGLPGGSRRRAPAPAGQQ---QM-RAESRS-------G------AQRRRGSARRGAH--REAG 75

  P0C5K7 KMVSRRNVKDSHEVSGSL-QA--TLQVISFSFPFL-------LH-TCSHPLS--------HPTSGQRR-------------------------- 136
  Q6U949 GCVRGRTRSSGSERSNALWQAVDAAEALALSSP-LRRPWDQAQHFTNPAPFSKGPQSAPPSPPAGRRRRGADLALTPLAGEGHTRWRQPGRPGK 168

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0031225 anchored component of membrane
2. P GO:0005929 cilium
2. P GO:0044782 cilium organization
2. P GO:0016021 integral component of membrane
2. P GO:0016324 apical plasma membrane
2. P GO:0036064 ciliary basal body
2. P GO:0033644 host cell membrane

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB P0C5K7 Cancer/testis antigen 62 0 1.21e-144 9.44e-98
2. P P22440 Protein VP5 NA 4.55e-04 NA
2. P P0C5N8 Putative uncharacterized protein YHR180W-A 2.21e-01 2.01e-03 NA
2. P Q02786 Long chronological lifespan protein 1 6.35e-01 2.10e-03 NA
2. P A0A023PXE8 Putative uncharacterized protein YHR028W-A 3.25e-01 2.63e-02 NA
2. P P17142 Uncharacterized protein IRL3 NA 2.75e-02 NA
2. P Q69015 Uncharacterized protein VP3 NA 4.14e-02 NA
2. P P25620 Uncharacterized protein YCR022C 7.51e-01 3.11e-02 NA
2. P P15481 Protein VP5 NA 8.91e-03 NA
2. P Q6ZSR3 Putative uncharacterized protein FLJ45275, mitochondrial 1.13e-01 6.86e-03 NA
2. P P25221 Protein VP5 NA 1.82e-03 NA
2. P Q6U949 Putative insulin-like growth factor 2 antisense gene protein 3.38e-02 2.20e-03 NA
2. P Q9C0X4 Putative uncharacterized protein C12C2.14c 4.00e-02 4.18e-04 NA
2. P Q6P8X9 Protein Flattop 5.28e-01 7.64e-03 NA
2. P Q10493 Meiotically up-regulated gene 106 protein 3.85e-01 4.29e-03 NA
2. P Q3SZT6 Protein Flattop 4.19e-01 1.14e-02 NA