Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 2. P was
Q6U949
(Putative insulin-like growth factor 2 antisense gene protein) with a FATCAT P-Value: 0.0338 and RMSD of 3.09 angstrom. The sequence alignment identity is 18.6%.
Structural alignment shown in left. Query protein P0C5K7 colored as red in alignment, homolog Q6U949 colored as blue.
Query protein P0C5K7 is also shown in right top, homolog Q6U949 showed in right bottom. They are colored based on secondary structures.
P0C5K7 MMHTTSYR--------RLSPPHLTDQPSAYSHTHRTFSHFSCGSQ-----PAAQRLHVELWNADLQSEFLCPCLGLTLYLTCNPQLGKRKFCSHSSEDMS 87 Q6U949 -MSKRKWRGFRGAQQERAQPPAASPQPCPAPH-----AGLPGGSRRRAPAPAGQQ---QM-RAESRS-------G------AQRRRGSARRGAH--REAG 75 P0C5K7 KMVSRRNVKDSHEVSGSL-QA--TLQVISFSFPFL-------LH-TCSHPLS--------HPTSGQRR-------------------------- 136 Q6U949 GCVRGRTRSSGSERSNALWQAVDAAEALALSSP-LRRPWDQAQHFTNPAPFSKGPQSAPPSPPAGRRRRGADLALTPLAGEGHTRWRQPGRPGK 168
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 2. P | GO:0031225 | anchored component of membrane |
| 2. P | GO:0005929 | cilium |
| 2. P | GO:0044782 | cilium organization |
| 2. P | GO:0016021 | integral component of membrane |
| 2. P | GO:0016324 | apical plasma membrane |
| 2. P | GO:0036064 | ciliary basal body |
| 2. P | GO:0033644 | host cell membrane |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | P0C5K7 | Cancer/testis antigen 62 | 0 | 1.21e-144 | 9.44e-98 |
| 2. P | P22440 | Protein VP5 | NA | 4.55e-04 | NA |
| 2. P | P0C5N8 | Putative uncharacterized protein YHR180W-A | 2.21e-01 | 2.01e-03 | NA |
| 2. P | Q02786 | Long chronological lifespan protein 1 | 6.35e-01 | 2.10e-03 | NA |
| 2. P | A0A023PXE8 | Putative uncharacterized protein YHR028W-A | 3.25e-01 | 2.63e-02 | NA |
| 2. P | P17142 | Uncharacterized protein IRL3 | NA | 2.75e-02 | NA |
| 2. P | Q69015 | Uncharacterized protein VP3 | NA | 4.14e-02 | NA |
| 2. P | P25620 | Uncharacterized protein YCR022C | 7.51e-01 | 3.11e-02 | NA |
| 2. P | P15481 | Protein VP5 | NA | 8.91e-03 | NA |
| 2. P | Q6ZSR3 | Putative uncharacterized protein FLJ45275, mitochondrial | 1.13e-01 | 6.86e-03 | NA |
| 2. P | P25221 | Protein VP5 | NA | 1.82e-03 | NA |
| 2. P | Q6U949 | Putative insulin-like growth factor 2 antisense gene protein | 3.38e-02 | 2.20e-03 | NA |
| 2. P | Q9C0X4 | Putative uncharacterized protein C12C2.14c | 4.00e-02 | 4.18e-04 | NA |
| 2. P | Q6P8X9 | Protein Flattop | 5.28e-01 | 7.64e-03 | NA |
| 2. P | Q10493 | Meiotically up-regulated gene 106 protein | 3.85e-01 | 4.29e-03 | NA |
| 2. P | Q3SZT6 | Protein Flattop | 4.19e-01 | 1.14e-02 | NA |