Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 3. B was
Q566C8
(Ankyrin repeat domain-containing protein 54) with a FATCAT P-Value: 1.13e-08 and RMSD of 1.24 angstrom. The sequence alignment identity is 14.0%.
Structural alignment shown in left. Query protein P0C6C1 colored as red in alignment, homolog Q566C8 colored as blue.
Query protein P0C6C1 is also shown in right top, homolog Q566C8 showed in right bottom. They are colored based on secondary structures.
P0C6C1 --------------------------------------MMDDDTELRTDGNSLL-KAVWLGR----LRLTRLL----LE----------GGAYINESN-D 42 Q566C8 MAATGGGAEDESRSGRSSSEGECAVAPEPLAEAGGLFSFADLGAALGS-GAGLPGRAV--GRAQSPLRYLQVLWQQDVEPRDELRCKIPAGRLRRAARPH 97 P0C6C1 K--GETALMVACITKHV-DQQSISKSKMVKYLLDNRADPNIQDKSGKTALIH--ACIRRAGGE-VVSLLLENGADPSLEDRTGASALVYAINADDKDALK 136 Q566C8 RRLGPTGKEVHAL-KRLRDSANANDIETVQQLLEDGADPCAADDKGRTAL-HFASC---NGNDQIVQLLLDHGADPNQQDGLGNTPL------------- 179 P0C6C1 HLLDACKAKGKEVIIITTDKSSSGTKTTKQYLNVPPSPKVE--DRH-SPPLCASPSDIELKALGLDSPLTEKEDDFFSLQAGHPSSCNTSKAVN-EPGSP 232 Q566C8 HLA-ACT---NHVPVITT-------------L-LRGGARVDALDRAGRTPLHLAKS----K-LNI-------------LQEGH-SQC--LEAVRLE---- 236 P0C6C1 TRKVSNLKRARLPQLKR-LQSEPWGL--IAPSVLAASTRQ--DETHGASTDNEVIKSISDI-----SFPKRGPLSRTNSIDSKDPTLFHTVTEQVLKIPV 322 Q566C8 VKQIIHMLREYLERLGRHEQRE--RLDDLCTRLQMTSTKEQVDEV----TD--LLASFTSLSLQMQSMEKR----------------------------- 299 P0C6C1 SSAPASWKAAYEKGQAPHPRLARRGTLPVDQEKCGMGPSGPSALKEPASLKWLENDLYDLDIQPGPDPPNSISLESGKGPLDRKKLNSSHLSLFHGSRES 422 Q566C8 ---------------------------------------------------------------------------------------------------- 299 P0C6C1 LDTVPSTSPSSARRRPPHLLERRGSGTLLLDRISHTRPGFLPPLNVNLNPPIPDIRSSSKPSCSLASGLKSMVPVAPSSPKRVDLRSKKKLLRRHSMQIE 522 Q566C8 ---------------------------------------------------------------------------------------------------- 299 P0C6C1 QMKQLSDFEEIMT 535 Q566C8 ------------- 299
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0030155 | regulation of cell adhesion |
| 1. PB | GO:0097543 | ciliary inversin compartment |
| 1. PB | GO:0017124 | SH3 domain binding |
| 1. PB | GO:0030507 | spectrin binding |
| 1. PB | GO:0030154 | cell differentiation |
| 1. PB | GO:0043005 | neuron projection |
| 1. PB | GO:0046822 | regulation of nucleocytoplasmic transport |
| 1. PB | GO:0004857 | enzyme inhibitor activity |
| 1. PB | GO:0007098 | centrosome cycle |
| 1. PB | GO:0019901 | protein kinase binding |
| 1. PB | GO:0043197 | dendritic spine |
| 1. PB | GO:0001822 | kidney development |
| 1. PB | GO:0072357 | PTW/PP1 phosphatase complex |
| 1. PB | GO:0019208 | phosphatase regulator activity |
| 1. PB | GO:0090090 | negative regulation of canonical Wnt signaling pathway |
| 1. PB | GO:0007283 | spermatogenesis |
| 1. PB | GO:0043086 | negative regulation of catalytic activity |
| 1. PB | GO:1901187 | regulation of ephrin receptor signaling pathway |
| 1. PB | GO:0008022 | protein C-terminus binding |
| 1. PB | GO:0007507 | heart development |
| 1. PB | GO:0001701 | in utero embryonic development |
| 1. PB | GO:0032421 | stereocilium bundle |
| 1. PB | GO:0007368 | determination of left/right symmetry |
| 1. PB | GO:0005829 | cytosol |
| 1. PB | GO:0071889 | 14-3-3 protein binding |
| 1. PB | GO:0035508 | positive regulation of myosin-light-chain-phosphatase activity |
| 1. PB | GO:0014069 | postsynaptic density |
| 1. PB | GO:0003779 | actin binding |
| 1. PB | GO:0031672 | A band |
| 1. PB | GO:2000096 | positive regulation of Wnt signaling pathway, planar cell polarity pathway |
| 1. PB | GO:0005856 | cytoskeleton |
| 1. PB | GO:0043194 | axon initial segment |
| 1. PB | GO:0005929 | cilium |
| 1. PB | GO:0000776 | kinetochore |
| 1. PB | GO:0030018 | Z disc |
| 1. PB | GO:0043292 | contractile fiber |
| 1. PB | GO:0005938 | cell cortex |
| 1. PB | GO:0007165 | signal transduction |
| 1. PB | GO:0035507 | regulation of myosin-light-chain-phosphatase activity |
| 1. PB | GO:0005654 | nucleoplasm |
| 2. P | GO:0031932 | TORC2 complex |
| 2. P | GO:0005902 | microvillus |
| 2. P | GO:0051015 | actin filament binding |
| 2. P | GO:0032426 | stereocilium tip |
| 2. P | GO:0030034 | microvillar actin bundle assembly |
| 2. P | GO:0051491 | positive regulation of filopodium assembly |
| 2. P | GO:0030175 | filopodium |
| 2. P | GO:0060122 | inner ear receptor cell stereocilium organization |
| 2. P | GO:0030054 | cell junction |
| 2. P | GO:1904106 | protein localization to microvillus |
| 2. P | GO:0016323 | basolateral plasma membrane |
| 2. P | GO:0060113 | inner ear receptor cell differentiation |
| 2. P | GO:0021555 | midbrain-hindbrain boundary morphogenesis |
| 2. P | GO:0097120 | receptor localization to synapse |
| 2. P | GO:0050957 | equilibrioception |
| 2. P | GO:0006937 | regulation of muscle contraction |
| 2. P | GO:0015629 | actin cytoskeleton |
| 2. P | GO:0043113 | receptor clustering |
| 2. P | GO:0048013 | ephrin receptor signaling pathway |
| 2. P | GO:0048793 | pronephros development |
| 2. P | GO:0051639 | actin filament network formation |
| 2. P | GO:0035690 | |
| 2. P | GO:0046330 | positive regulation of JNK cascade |
| 2. P | GO:0007626 | locomotory behavior |
| 2. P | GO:0006929 | substrate-dependent cell migration |
| 2. P | GO:0001650 | fibrillar center |
| 2. P | GO:0045197 | establishment or maintenance of epithelial cell apical/basal polarity |
| 2. P | GO:0000278 | mitotic cell cycle |
| 2. P | GO:0034976 | response to endoplasmic reticulum stress |
| 2. P | GO:0032391 | photoreceptor connecting cilium |
| 2. P | GO:0030046 | parallel actin filament bundle assembly |
| 2. P | GO:0031929 | TOR signaling |
| 2. P | GO:0007605 | sensory perception of sound |
| 2. P | GO:0060028 | convergent extension involved in axis elongation |
| 2. P | GO:0051017 | actin filament bundle assembly |
| 2. P | GO:0042472 | inner ear morphogenesis |
| 2. P | GO:1904970 | brush border assembly |
| 2. P | GO:0005903 | brush border |
| 2. P | GO:2000059 | negative regulation of ubiquitin-dependent protein catabolic process |
| 2. P | GO:0006470 | protein dephosphorylation |
| 2. P | GO:0005813 | centrosome |
| 2. P | GO:0030950 | establishment or maintenance of actin cytoskeleton polarity |
| 2. P | GO:0070650 | actin filament bundle distribution |
| 2. P | GO:0098609 | cell-cell adhesion |
| 2. P | GO:0036064 | ciliary basal body |
| 2. P | GO:0046875 | ephrin receptor binding |
| 2. P | GO:0045494 | photoreceptor cell maintenance |
| 2. P | GO:0050953 | sensory perception of light stimulus |
| 2. P | GO:0051494 | negative regulation of cytoskeleton organization |
| 2. P | GO:0031941 | filamentous actin |
| 2. P | GO:0032420 | stereocilium |
| 2. P | GO:0001917 | photoreceptor inner segment |
| 2. P | GO:0034622 | |
| 2. P | GO:0010976 | positive regulation of neuron projection development |
| 2. P | GO:0099061 | integral component of postsynaptic density membrane |
| 2. P | GO:0016322 | neuron remodeling |
| 3. B | GO:0005770 | late endosome |
| 3. B | GO:0007094 | mitotic spindle assembly checkpoint signaling |
| 3. B | GO:0034765 | regulation of ion transmembrane transport |
| 3. B | GO:0071625 | vocalization behavior |
| 3. B | GO:0000122 | negative regulation of transcription by RNA polymerase II |
| 3. B | GO:0050729 | positive regulation of inflammatory response |
| 3. B | GO:0060292 | long-term synaptic depression |
| 3. B | GO:0051835 | positive regulation of synapse structural plasticity |
| 3. B | GO:0048709 | oligodendrocyte differentiation |
| 3. B | GO:0006511 | ubiquitin-dependent protein catabolic process |
| 3. B | GO:0035148 | tube formation |
| 3. B | GO:0070563 | negative regulation of vitamin D receptor signaling pathway |
| 3. B | GO:0030334 | regulation of cell migration |
| 3. B | GO:0003270 | Notch signaling pathway involved in regulation of secondary heart field cardioblast proliferation |
| 3. B | GO:0010812 | negative regulation of cell-substrate adhesion |
| 3. B | GO:0060412 | ventricular septum morphogenesis |
| 3. B | GO:2001259 | positive regulation of cation channel activity |
| 3. B | GO:0001756 | somitogenesis |
| 3. B | GO:0070372 | regulation of ERK1 and ERK2 cascade |
| 3. B | GO:1903522 | regulation of blood circulation |
| 3. B | GO:0033184 | positive regulation of histone ubiquitination |
| 3. B | GO:0097190 | apoptotic signaling pathway |
| 3. B | GO:0003252 | negative regulation of cell proliferation involved in heart valve morphogenesis |
| 3. B | GO:0085020 | protein K6-linked ubiquitination |
| 3. B | GO:0006959 | humoral immune response |
| 3. B | GO:0004842 | ubiquitin-protein transferase activity |
| 3. B | GO:0007140 | male meiotic nuclear division |
| 3. B | GO:0001837 | epithelial to mesenchymal transition |
| 3. B | GO:0045070 | positive regulation of viral genome replication |
| 3. B | GO:0003950 | NAD+ ADP-ribosyltransferase activity |
| 3. B | GO:0050885 | neuromuscular process controlling balance |
| 3. B | GO:0021519 | spinal cord association neuron specification |
| 3. B | GO:0015095 | magnesium ion transmembrane transporter activity |
| 3. B | GO:0045611 | negative regulation of hemocyte differentiation |
| 3. B | GO:2000822 | regulation of behavioral fear response |
| 3. B | GO:0045737 | positive regulation of cyclin-dependent protein serine/threonine kinase activity |
| 3. B | GO:0045036 | protein targeting to chloroplast |
| 3. B | GO:0033257 | Bcl3/NF-kappaB2 complex |
| 3. B | GO:0043254 | regulation of protein-containing complex assembly |
| 3. B | GO:0035641 | locomotory exploration behavior |
| 3. B | GO:2000291 | regulation of myoblast proliferation |
| 3. B | GO:0010765 | positive regulation of sodium ion transport |
| 3. B | GO:0071546 | pi-body |
| 3. B | GO:0003162 | atrioventricular node development |
| 3. B | GO:0007492 | endoderm development |
| 3. B | GO:0048549 | positive regulation of pinocytosis |
| 3. B | GO:0030534 | adult behavior |
| 3. B | GO:0031069 | hair follicle morphogenesis |
| 3. B | GO:0008542 | visual learning |
| 3. B | GO:0072659 | protein localization to plasma membrane |
| 3. B | GO:0086015 | SA node cell action potential |
| 3. B | GO:0032466 | negative regulation of cytokinesis |
| 3. B | GO:1990404 | protein ADP-ribosylase activity |
| 3. B | GO:0097107 | postsynaptic density assembly |
| 3. B | GO:0007520 | myoblast fusion |
| 3. B | GO:0003151 | outflow tract morphogenesis |
| 3. B | GO:0006913 | nucleocytoplasmic transport |
| 3. B | GO:0002437 | inflammatory response to antigenic stimulus |
| 3. B | GO:0031286 | negative regulation of sorocarp stalk cell differentiation |
| 3. B | GO:0002052 | positive regulation of neuroblast proliferation |
| 3. B | GO:0042734 | presynaptic membrane |
| 3. B | GO:2000393 | negative regulation of lamellipodium morphogenesis |
| 3. B | GO:0031462 | Cul2-RING ubiquitin ligase complex |
| 3. B | GO:0048715 | negative regulation of oligodendrocyte differentiation |
| 3. B | GO:0018026 | peptidyl-lysine monomethylation |
| 3. B | GO:0005123 | death receptor binding |
| 3. B | GO:0008608 | attachment of spindle microtubules to kinetochore |
| 3. B | GO:0043409 | negative regulation of MAPK cascade |
| 3. B | GO:1900273 | positive regulation of long-term synaptic potentiation |
| 3. B | GO:0003160 | endocardium morphogenesis |
| 3. B | GO:0005764 | lysosome |
| 3. B | GO:0050894 | determination of affect |
| 3. B | GO:0000209 | protein polyubiquitination |
| 3. B | GO:0097546 | ciliary base |
| 3. B | GO:0001947 | heart looping |
| 3. B | GO:0035116 | embryonic hindlimb morphogenesis |
| 3. B | GO:0090201 | negative regulation of release of cytochrome c from mitochondria |
| 3. B | GO:0002027 | regulation of heart rate |
| 3. B | GO:0099562 | maintenance of postsynaptic density structure |
| 3. B | GO:0044325 | transmembrane transporter binding |
| 3. B | GO:0008593 | regulation of Notch signaling pathway |
| 3. B | GO:0030496 | midbody |
| 3. B | GO:0005634 | nucleus |
| 3. B | GO:0072116 | pronephros formation |
| 3. B | GO:1990760 | osmolarity-sensing cation channel activity |
| 3. B | GO:1904357 | negative regulation of telomere maintenance via telomere lengthening |
| 3. B | GO:0072044 | collecting duct development |
| 3. B | GO:0046826 | negative regulation of protein export from nucleus |
| 3. B | GO:0030660 | Golgi-associated vesicle membrane |
| 3. B | GO:0002789 | negative regulation of antifungal peptide production |
| 3. B | GO:1900246 | positive regulation of RIG-I signaling pathway |
| 3. B | GO:0060999 | positive regulation of dendritic spine development |
| 3. B | GO:0007253 | cytoplasmic sequestering of NF-kappaB |
| 3. B | GO:0005516 | calmodulin binding |
| 3. B | GO:0045603 | positive regulation of endothelial cell differentiation |
| 3. B | GO:0001568 | blood vessel development |
| 3. B | GO:0097604 | temperature-gated cation channel activity |
| 3. B | GO:0070213 | protein auto-ADP-ribosylation |
| 3. B | GO:0004672 | protein kinase activity |
| 3. B | GO:0046427 | positive regulation of receptor signaling pathway via JAK-STAT |
| 3. B | GO:0031877 | somatostatin receptor binding |
| 3. B | GO:0033292 | T-tubule organization |
| 3. B | GO:0005769 | early endosome |
| 3. B | GO:0036369 | transcription factor catabolic process |
| 3. B | GO:0045665 | negative regulation of neuron differentiation |
| 3. B | GO:0071372 | cellular response to follicle-stimulating hormone stimulus |
| 3. B | GO:1904108 | protein localization to ciliary inversin compartment |
| 3. B | GO:0030514 | negative regulation of BMP signaling pathway |
| 3. B | GO:1900245 | positive regulation of MDA-5 signaling pathway |
| 3. B | GO:0045747 | positive regulation of Notch signaling pathway |
| 3. B | GO:0006915 | apoptotic process |
| 3. B | GO:0035924 | cellular response to vascular endothelial growth factor stimulus |
| 3. B | GO:0097114 | NMDA glutamate receptor clustering |
| 3. B | GO:0000792 | heterochromatin |
| 3. B | GO:0014832 | urinary bladder smooth muscle contraction |
| 3. B | GO:0090521 | glomerular visceral epithelial cell migration |
| 3. B | GO:0031436 | BRCA1-BARD1 complex |
| 3. B | GO:0034605 | cellular response to heat |
| 3. B | GO:0032436 | positive regulation of proteasomal ubiquitin-dependent protein catabolic process |
| 3. B | GO:0050768 | negative regulation of neurogenesis |
| 3. B | GO:0099092 | postsynaptic density, intracellular component |
| 3. B | GO:0005249 | voltage-gated potassium channel activity |
| 3. B | GO:0045211 | postsynaptic membrane |
| 3. B | GO:0036336 | dendritic cell migration |
| 3. B | GO:0016055 | Wnt signaling pathway |
| 3. B | GO:0048873 | homeostasis of number of cells within a tissue |
| 3. B | GO:0061195 | taste bud formation |
| 3. B | GO:0031398 | positive regulation of protein ubiquitination |
| 3. B | GO:0018345 | protein palmitoylation |
| 3. B | GO:0021515 | cell differentiation in spinal cord |
| 3. B | GO:0071212 | subsynaptic reticulum |
| 3. B | GO:0014807 | regulation of somitogenesis |
| 3. B | GO:0031670 | cellular response to nutrient |
| 3. B | GO:0030279 | negative regulation of ossification |
| 3. B | GO:0048663 | neuron fate commitment |
| 3. B | GO:0060743 | epithelial cell maturation involved in prostate gland development |
| 3. B | GO:0003182 | coronary sinus valve morphogenesis |
| 3. B | GO:0055117 | regulation of cardiac muscle contraction |
| 3. B | GO:1902339 | positive regulation of apoptotic process involved in morphogenesis |
| 3. B | GO:0007409 | axonogenesis |
| 3. B | GO:0045171 | intercellular bridge |
| 3. B | GO:0035255 | ionotropic glutamate receptor binding |
| 3. B | GO:1902260 | negative regulation of delayed rectifier potassium channel activity |
| 3. B | GO:0050678 | regulation of epithelial cell proliferation |
| 3. B | GO:0031430 | M band |
| 3. B | GO:0008306 | associative learning |
| 3. B | GO:0043046 | DNA methylation involved in gamete generation |
| 3. B | GO:0070198 | protein localization to chromosome, telomeric region |
| 3. B | GO:0007030 | Golgi organization |
| 3. B | GO:0045838 | positive regulation of membrane potential |
| 3. B | GO:1902263 | apoptotic process involved in embryonic digit morphogenesis |
| 3. B | GO:0036371 | protein localization to T-tubule |
| 3. B | GO:0003344 | pericardium morphogenesis |
| 3. B | GO:0044030 | regulation of DNA methylation |
| 3. B | GO:0060076 | excitatory synapse |
| 3. B | GO:0070742 | C2H2 zinc finger domain binding |
| 3. B | GO:0140627 | ubiquitin-dependent protein catabolic process via the C-end degron rule pathway |
| 3. B | GO:0003208 | cardiac ventricle morphogenesis |
| 3. B | GO:0003214 | cardiac left ventricle morphogenesis |
| 3. B | GO:2000812 | regulation of barbed-end actin filament capping |
| 3. B | GO:0014731 | spectrin-associated cytoskeleton |
| 3. B | GO:0044309 | neuron spine |
| 3. B | GO:0005737 | cytoplasm |
| 3. B | GO:0098978 | glutamatergic synapse |
| 3. B | GO:2000001 | regulation of DNA damage checkpoint |
| 3. B | GO:0055013 | cardiac muscle cell development |
| 3. B | GO:0072114 | pronephros morphogenesis |
| 3. B | GO:0061630 | ubiquitin protein ligase activity |
| 3. B | GO:0010882 | regulation of cardiac muscle contraction by calcium ion signaling |
| 3. B | GO:2001257 | regulation of cation channel activity |
| 3. B | GO:0098871 | postsynaptic actin cytoskeleton |
| 3. B | GO:0014704 | intercalated disc |
| 3. B | GO:0097113 | AMPA glutamate receptor clustering |
| 3. B | GO:0046959 | habituation |
| 3. B | GO:0001955 | blood vessel maturation |
| 3. B | GO:0099519 | dense core granule cytoskeletal transport |
| 3. B | GO:0007219 | Notch signaling pathway |
| 3. B | GO:0060354 | negative regulation of cell adhesion molecule production |
| 3. B | GO:0010881 | regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion |
| 3. B | GO:0031441 | negative regulation of mRNA 3'-end processing |
| 3. B | GO:0032232 | negative regulation of actin filament bundle assembly |
| 3. B | GO:0021546 | rhombomere development |
| 3. B | GO:0003332 | negative regulation of extracellular matrix constituent secretion |
| 3. B | GO:0043001 | Golgi to plasma membrane protein transport |
| 3. B | GO:0046976 | histone methyltransferase activity (H3-K27 specific) |
| 3. B | GO:1905274 | regulation of modification of postsynaptic actin cytoskeleton |
| 3. B | GO:0045794 | negative regulation of cell volume |
| 3. B | GO:0120163 | negative regulation of cold-induced thermogenesis |
| 3. B | GO:1904717 | regulation of AMPA glutamate receptor clustering |
| 3. B | GO:0031047 | gene silencing by RNA |
| 3. B | GO:0042048 | olfactory behavior |
| 3. B | GO:0071447 | cellular response to hydroperoxide |
| 3. B | GO:0032580 | Golgi cisterna membrane |
| 3. B | GO:0035914 | skeletal muscle cell differentiation |
| 3. B | GO:0016529 | sarcoplasmic reticulum |
| 3. B | GO:0071800 | podosome assembly |
| 3. B | GO:0051225 | spindle assembly |
| 3. B | GO:0140374 | antiviral innate immune response |
| 3. B | GO:1990830 | cellular response to leukemia inhibitory factor |
| 3. B | GO:1904743 | negative regulation of telomeric DNA binding |
| 3. B | GO:1900383 | regulation of synaptic plasticity by receptor localization to synapse |
| 3. B | GO:0030216 | keratinocyte differentiation |
| 3. B | GO:0003241 | growth involved in heart morphogenesis |
| 3. B | GO:0072660 | maintenance of protein location in plasma membrane |
| 3. B | GO:0086004 | regulation of cardiac muscle cell contraction |
| 3. B | GO:0055007 | cardiac muscle cell differentiation |
| 3. B | GO:0045668 | negative regulation of osteoblast differentiation |
| 3. B | GO:0031674 | I band |
| 3. B | GO:0003198 | epithelial to mesenchymal transition involved in endocardial cushion formation |
| 3. B | GO:0005112 | Notch binding |
| 3. B | GO:0039529 | RIG-I signaling pathway |
| 3. B | GO:0036309 | protein localization to M-band |
| 3. B | GO:0050750 | low-density lipoprotein particle receptor binding |
| 3. B | GO:0060317 | cardiac epithelial to mesenchymal transition |
| 3. B | GO:0060948 | cardiac vascular smooth muscle cell development |
| 3. B | GO:0097117 | guanylate kinase-associated protein clustering |
| 3. B | GO:0098919 | structural constituent of postsynaptic density |
| 3. B | GO:0045732 | positive regulation of protein catabolic process |
| 3. B | GO:0002357 | defense response to tumor cell |
| 3. B | GO:0086069 | bundle of His cell to Purkinje myocyte communication |
| 3. B | GO:0002070 | epithelial cell maturation |
| 3. B | GO:0031432 | titin binding |
| 3. B | GO:0051968 | positive regulation of synaptic transmission, glutamatergic |
| 3. B | GO:0034112 | positive regulation of homotypic cell-cell adhesion |
| 3. B | GO:0031100 | animal organ regeneration |
| 3. B | GO:0060442 | branching involved in prostate gland morphogenesis |
| 3. B | GO:0006471 | protein ADP-ribosylation |
| 3. B | GO:0070531 | BRCA1-A complex |
| 3. B | GO:0060842 | arterial endothelial cell differentiation |
| 3. B | GO:0086070 | SA node cell to atrial cardiac muscle cell communication |
| 3. B | GO:1900452 | regulation of long-term synaptic depression |
| 3. B | GO:1902253 | regulation of intrinsic apoptotic signaling pathway by p53 class mediator |
| 3. B | GO:0045955 | negative regulation of calcium ion-dependent exocytosis |
| 3. B | GO:0070972 | protein localization to endoplasmic reticulum |
| 3. B | GO:0090160 | Golgi to lysosome transport |
| 3. B | GO:2001027 | negative regulation of endothelial cell chemotaxis |
| 3. B | GO:0038180 | nerve growth factor signaling pathway |
| 3. B | GO:0043268 | positive regulation of potassium ion transport |
| 3. B | GO:0016021 | integral component of membrane |
| 3. B | GO:0031267 | small GTPase binding |
| 3. B | GO:0060035 | notochord cell development |
| 3. B | GO:0002193 | MAML1-RBP-Jkappa- ICN1 complex |
| 3. B | GO:0046579 | positive regulation of Ras protein signal transduction |
| 3. B | GO:0021654 | rhombomere boundary formation |
| 3. B | GO:0045685 | regulation of glial cell differentiation |
| 3. B | GO:0030513 | positive regulation of BMP signaling pathway |
| 3. B | GO:2000737 | negative regulation of stem cell differentiation |
| 3. B | GO:0048754 | branching morphogenesis of an epithelial tube |
| 3. B | GO:0010001 | glial cell differentiation |
| 3. B | GO:1902531 | regulation of intracellular signal transduction |
| 3. B | GO:0000062 | fatty-acyl-CoA binding |
| 3. B | GO:1900827 | positive regulation of membrane depolarization during cardiac muscle cell action potential |
| 3. B | GO:0031960 | response to corticosteroid |
| 3. B | GO:0003256 | regulation of transcription from RNA polymerase II promoter involved in myocardial precursor cell differentiation |
| 3. B | GO:1901201 | regulation of extracellular matrix assembly |
| 3. B | GO:0048892 | lateral line nerve development |
| 3. B | GO:0045807 | positive regulation of endocytosis |
| 3. B | GO:0008093 | cytoskeletal anchor activity |
| 3. B | GO:0019730 | antimicrobial humoral response |
| 3. B | GO:0042802 | identical protein binding |
| 3. B | GO:0035640 | exploration behavior |
| 3. B | GO:0048708 | astrocyte differentiation |
| 3. B | GO:0030674 | protein-macromolecule adaptor activity |
| 3. B | GO:0034058 | endosomal vesicle fusion |
| 3. B | GO:0003222 | ventricular trabecula myocardium morphogenesis |
| 3. B | GO:0030837 | negative regulation of actin filament polymerization |
| 3. B | GO:0060740 | prostate gland epithelium morphogenesis |
| 3. B | GO:0071286 | cellular response to magnesium ion |
| 3. B | GO:0090309 | positive regulation of DNA methylation-dependent heterochromatin assembly |
| 3. B | GO:0060411 | cardiac septum morphogenesis |
| 3. B | GO:0042006 | masculinization of hermaphroditic germ-line |
| 3. B | GO:0045967 | negative regulation of growth rate |
| 3. B | GO:0043034 | costamere |
| 3. B | GO:0018230 | peptidyl-L-cysteine S-palmitoylation |
| 3. B | GO:0031297 | replication fork processing |
| 3. B | GO:0046843 | dorsal appendage formation |
| 3. B | GO:0016567 | protein ubiquitination |
| 3. B | GO:0039022 | pronephric duct development |
| 3. B | GO:0070986 | left/right axis specification |
| 3. B | GO:0005576 | extracellular region |
| 3. B | GO:0019887 | protein kinase regulator activity |
| 3. B | GO:0046974 | histone methyltransferase activity (H3-K9 specific) |
| 3. B | GO:0098908 | regulation of neuronal action potential |
| 3. B | GO:0010468 | regulation of gene expression |
| 3. B | GO:0045814 | negative regulation of gene expression, epigenetic |
| 3. B | GO:0021915 | neural tube development |
| 3. B | GO:0002467 | germinal center formation |
| 3. B | GO:0036377 | arbuscular mycorrhizal association |
| 3. B | GO:0043063 | intercellular bridge organization |
| 3. B | GO:0061419 | positive regulation of transcription from RNA polymerase II promoter in response to hypoxia |
| 3. B | GO:0099612 | protein localization to axon |
| 3. B | GO:0007221 | positive regulation of transcription of Notch receptor target |
| 3. B | GO:1902041 | regulation of extrinsic apoptotic signaling pathway via death domain receptors |
| 3. B | GO:0005524 | ATP binding |
| 3. B | GO:0007416 | synapse assembly |
| 3. B | GO:0097422 | tubular endosome |
| 3. B | GO:0018027 | peptidyl-lysine dimethylation |
| 3. B | GO:0035176 | social behavior |
| 3. B | GO:0010960 | magnesium ion homeostasis |
| 3. B | GO:0042826 | histone deacetylase binding |
| 3. B | GO:0005886 | plasma membrane |
| 3. B | GO:0035418 | protein localization to synapse |
| 3. B | GO:0042325 | regulation of phosphorylation |
| 3. B | GO:0010614 | negative regulation of cardiac muscle hypertrophy |
| 3. B | GO:0035646 | endosome to melanosome transport |
| 3. B | GO:0090212 | negative regulation of establishment of blood-brain barrier |
| 3. B | GO:0001841 | neural tube formation |
| 3. B | GO:0048899 | anterior lateral line development |
| 3. B | GO:0033147 | negative regulation of intracellular estrogen receptor signaling pathway |
| 3. B | GO:0062043 | positive regulation of cardiac epithelial to mesenchymal transition |
| 3. B | GO:0007009 | plasma membrane organization |
| 3. B | GO:0045607 | regulation of inner ear auditory receptor cell differentiation |
| 3. B | GO:0032996 | Bcl3-Bcl10 complex |
| 3. B | GO:0019843 | rRNA binding |
| 3. B | GO:0070212 | protein poly-ADP-ribosylation |
| 3. B | GO:1900271 | regulation of long-term synaptic potentiation |
| 3. B | GO:2000048 | negative regulation of cell-cell adhesion mediated by cadherin |
| 3. B | GO:1904058 | positive regulation of sensory perception of pain |
| 3. B | GO:0060979 | vasculogenesis involved in coronary vascular morphogenesis |
| 3. B | GO:0000151 | ubiquitin ligase complex |
| 3. B | GO:0030160 | synaptic receptor adaptor activity |
| 3. B | GO:0045662 | negative regulation of myoblast differentiation |
| 3. B | GO:0019228 | neuronal action potential |
| 3. B | GO:0072017 | distal tubule development |
| 3. B | GO:0007440 | foregut morphogenesis |
| 3. B | GO:0048711 | positive regulation of astrocyte differentiation |
| 3. B | GO:0045859 | regulation of protein kinase activity |
| 3. B | GO:0072073 | kidney epithelium development |
| 3. B | GO:0035023 | regulation of Rho protein signal transduction |
| 3. B | GO:0007386 | compartment pattern specification |
| 3. B | GO:0009925 | basal plasma membrane |
| 3. B | GO:0010650 | positive regulation of cell communication by electrical coupling |
| 3. B | GO:0003181 | atrioventricular valve morphogenesis |
| 3. B | GO:0090051 | negative regulation of cell migration involved in sprouting angiogenesis |
| 3. B | GO:0021773 | striatal medium spiny neuron differentiation |
| 3. B | GO:0010638 | positive regulation of organelle organization |
| 3. B | GO:0045874 | positive regulation of sevenless signaling pathway |
| 3. B | GO:0060768 | regulation of epithelial cell proliferation involved in prostate gland development |
| 3. B | GO:0060998 | regulation of dendritic spine development |
| 3. B | GO:2000811 | negative regulation of anoikis |
| 3. B | GO:0006897 | endocytosis |
| 3. B | GO:0045608 | negative regulation of inner ear auditory receptor cell differentiation |
| 3. B | GO:0055008 | cardiac muscle tissue morphogenesis |
| 3. B | GO:0000242 | pericentriolar material |
| 3. B | GO:0003197 | endocardial cushion development |
| 3. B | GO:0016604 | nuclear body |
| 3. B | GO:0098907 | regulation of SA node cell action potential |
| 3. B | GO:0003203 | endocardial cushion morphogenesis |
| 3. B | GO:0003408 | optic cup formation involved in camera-type eye development |
| 3. B | GO:1901981 | phosphatidylinositol phosphate binding |
| 3. B | GO:0003677 | DNA binding |
| 3. B | GO:0031594 | neuromuscular junction |
| 3. B | GO:0086014 | atrial cardiac muscle cell action potential |
| 3. B | GO:0016409 | palmitoyltransferase activity |
| 3. B | GO:0003184 | pulmonary valve morphogenesis |
| 3. B | GO:0043518 | negative regulation of DNA damage response, signal transduction by p53 class mediator |
| 3. B | GO:0003169 | coronary vein morphogenesis |
| 3. B | GO:1904908 | negative regulation of maintenance of mitotic sister chromatid cohesion, telomeric |
| 3. B | GO:0060528 | secretory columnal luminar epithelial cell differentiation involved in prostate glandular acinus development |
| 3. B | GO:0010832 | negative regulation of myotube differentiation |
| 3. B | GO:0071532 | ankyrin repeat binding |
| 3. B | GO:0070936 | protein K48-linked ubiquitination |
| 3. B | GO:0070682 | proteasome regulatory particle assembly |
| 3. B | GO:0140439 | protein-cysteine S-stearoyltransferase activity |
| 3. B | GO:0051438 | regulation of ubiquitin-protein transferase activity |
| 3. B | GO:0045648 | positive regulation of erythrocyte differentiation |
| 3. B | GO:0032495 | response to muramyl dipeptide |
| 3. B | GO:0071244 | cellular response to carbon dioxide |
| 3. B | GO:0060982 | coronary artery morphogenesis |
| 3. B | GO:0045687 | positive regulation of glial cell differentiation |
| 3. B | GO:0007616 | long-term memory |
| 3. B | GO:0002268 | follicular dendritic cell differentiation |
| 3. B | GO:0031359 | integral component of chloroplast outer membrane |
| 3. B | GO:0010780 | meiotic DNA double-strand break formation involved in reciprocal meiotic recombination |
| 3. B | GO:0031867 | EP4 subtype prostaglandin E2 receptor binding |
| 3. B | GO:0048103 | somatic stem cell division |
| 3. B | GO:0043266 | regulation of potassium ion transport |
| 3. B | GO:0050955 | thermoception |
| 3. B | GO:0060843 | venous endothelial cell differentiation |
| 3. B | GO:0001838 | embryonic epithelial tube formation |
| 3. B | GO:0060153 | modulation by virus of host cell cycle |
| 3. B | GO:2000651 | positive regulation of sodium ion transmembrane transporter activity |
| 3. B | GO:0140031 | phosphorylation-dependent protein binding |
| 3. B | GO:0051306 | mitotic sister chromatid separation |
| 3. B | GO:0003207 | cardiac chamber formation |
| 3. B | GO:0061384 | heart trabecula morphogenesis |
| 3. B | GO:0043619 | regulation of transcription from RNA polymerase II promoter in response to oxidative stress |
| 3. B | GO:0030315 | T-tubule |
| 3. B | GO:0043161 | proteasome-mediated ubiquitin-dependent protein catabolic process |
| 3. B | GO:0043280 | positive regulation of cysteine-type endopeptidase activity involved in apoptotic process |
| 3. B | GO:0003209 | cardiac atrium morphogenesis |
| 3. B | GO:1905936 | regulation of germ cell proliferation |
| 3. B | GO:0090263 | positive regulation of canonical Wnt signaling pathway |
| 3. B | GO:0032091 | negative regulation of protein binding |
| 3. B | GO:2000969 | positive regulation of AMPA receptor activity |
| 3. B | GO:0097062 | dendritic spine maintenance |
| 3. B | GO:0045869 | negative regulation of single stranded viral RNA replication via double stranded DNA intermediate |
| 3. B | GO:0003213 | cardiac right atrium morphogenesis |
| 3. B | GO:0098910 | regulation of atrial cardiac muscle cell action potential |
| 3. B | GO:0009912 | auditory receptor cell fate commitment |
| 3. B | GO:0030941 | chloroplast targeting sequence binding |
| 3. B | GO:0048265 | response to pain |
| 3. B | GO:0043066 | negative regulation of apoptotic process |
| 3. B | GO:1904355 | positive regulation of telomere capping |
| 3. B | GO:0033270 | paranode region of axon |
| 3. B | GO:0001895 | retina homeostasis |
| 3. B | GO:0045184 | establishment of protein localization |
| 3. B | GO:1901223 | negative regulation of NIK/NF-kappaB signaling |
| 3. B | GO:0048170 | positive regulation of long-term neuronal synaptic plasticity |
| 3. B | GO:0048854 | brain morphogenesis |
| 3. B | GO:0003219 | cardiac right ventricle formation |
| 3. B | GO:0072144 | glomerular mesangial cell development |
| 3. B | GO:0009610 | response to symbiotic fungus |
| 3. B | GO:0016235 | aggresome |
| 3. B | GO:0060956 | endocardial cell differentiation |
| 3. B | GO:0042383 | sarcolemma |
| 3. B | GO:1901189 | positive regulation of ephrin receptor signaling pathway |
| 3. B | GO:0050931 | pigment cell differentiation |
| 3. B | GO:0060038 | cardiac muscle cell proliferation |
| 3. B | GO:0032212 | positive regulation of telomere maintenance via telomerase |
| 3. B | GO:0042297 | vocal learning |
| 3. B | GO:0002040 | sprouting angiogenesis |
| 3. B | GO:2000310 | regulation of NMDA receptor activity |
| 3. B | GO:0061001 | regulation of dendritic spine morphogenesis |
| 3. B | GO:0001894 | tissue homeostasis |
| 3. B | GO:0061025 | membrane fusion |
| 3. B | GO:0051386 | regulation of neurotrophin TRK receptor signaling pathway |
| 3. B | GO:0097110 | scaffold protein binding |
| 3. B | GO:1990393 | 3M complex |
| 3. B | GO:0045618 | positive regulation of keratinocyte differentiation |
| 3. B | GO:0003180 | aortic valve morphogenesis |
| 3. B | GO:0060013 | righting reflex |
| 3. B | GO:0099175 | regulation of postsynapse organization |
| 3. B | GO:0050968 | detection of chemical stimulus involved in sensory perception of pain |
| 3. B | GO:0042246 | tissue regeneration |
| 3. B | GO:0003157 | endocardium development |
| 3. B | GO:0030159 | signaling receptor complex adaptor activity |
| 3. B | GO:0090314 | positive regulation of protein targeting to membrane |
| 3. B | GO:1900451 | positive regulation of glutamate receptor signaling pathway |
| 3. B | GO:1903343 | positive regulation of meiotic DNA double-strand break formation |
| 3. B | GO:0090029 | negative regulation of pheromone-dependent signal transduction involved in conjugation with cellular fusion |
| 3. B | GO:0046533 | negative regulation of photoreceptor cell differentiation |
| 3. B | GO:0097150 | neuronal stem cell population maintenance |
| 3. B | GO:0060045 | positive regulation of cardiac muscle cell proliferation |
| 3. B | GO:1903147 | negative regulation of autophagy of mitochondrion |
| 3. B | GO:1901019 | regulation of calcium ion transmembrane transporter activity |
| 3. B | GO:1903849 | positive regulation of aorta morphogenesis |
| 3. B | GO:0045162 | clustering of voltage-gated sodium channels |
| 3. B | GO:0050728 | negative regulation of inflammatory response |
| 3. B | GO:0003192 | mitral valve formation |
| 3. B | GO:0048920 | posterior lateral line neuromast primordium migration |
| 3. B | GO:0043065 | positive regulation of apoptotic process |
| 3. B | GO:0033268 | node of Ranvier |
| 3. B | GO:0003264 | regulation of cardioblast proliferation |
| 3. B | GO:0019705 | protein-cysteine S-myristoyltransferase activity |
| 3. B | GO:0043596 | nuclear replication fork |
| 3. B | GO:0050807 | regulation of synapse organization |
| 3. B | GO:0061314 | Notch signaling involved in heart development |
| 3. B | GO:0008092 | cytoskeletal protein binding |
| 3. B | GO:0071709 | membrane assembly |
| 3. B | GO:0015278 | calcium-release channel activity |
| 3. B | GO:0043422 | protein kinase B binding |
| 3. B | GO:0085042 | periarbuscular membrane |
| 3. B | GO:1990756 | ubiquitin ligase-substrate adaptor activity |
| 3. B | GO:0060992 | response to fungicide |
| 3. B | GO:2000463 | positive regulation of excitatory postsynaptic potential |
| 3. B | GO:0030673 | axolemma |
| 3. B | GO:0014732 | skeletal muscle atrophy |
| 3. B | GO:0019899 | enzyme binding |
| 3. B | GO:0060361 | flight |
| 3. B | GO:0099173 | postsynapse organization |
| 3. B | GO:0034587 | piRNA metabolic process |
| 3. B | GO:2000974 | negative regulation of pro-B cell differentiation |
| 3. B | GO:0031532 | actin cytoskeleton reorganization |
| 3. B | GO:0060997 | dendritic spine morphogenesis |
| 3. B | GO:0048845 | venous blood vessel morphogenesis |
| 3. B | GO:1901018 | positive regulation of potassium ion transmembrane transporter activity |
| 3. B | GO:2000311 | regulation of AMPA receptor activity |
| 3. B | GO:0086066 | atrial cardiac muscle cell to AV node cell communication |
| 3. B | GO:1901021 | positive regulation of calcium ion transmembrane transporter activity |
| 3. B | GO:0060253 | negative regulation of glial cell proliferation |
| 3. B | GO:0050966 | detection of mechanical stimulus involved in sensory perception of pain |
| 3. B | GO:0014031 | mesenchymal cell development |
| 3. B | GO:0051151 | negative regulation of smooth muscle cell differentiation |
| 3. B | GO:0043293 | apoptosome |
| 3. B | GO:0046872 | metal ion binding |
| 3. B | GO:0035544 | negative regulation of SNARE complex assembly |
| 3. B | GO:0097553 | calcium ion transmembrane import into cytosol |
| 3. B | GO:0007528 | neuromuscular junction development |
| 3. B | GO:2000821 | regulation of grooming behavior |
| 3. B | GO:0000139 | Golgi membrane |
| 3. B | GO:0035556 | intracellular signal transduction |
| 3. B | GO:0019706 | protein-cysteine S-palmitoyltransferase activity |
| 3. B | GO:0003273 | cell migration involved in endocardial cushion formation |
| 3. B | GO:0048916 | posterior lateral line development |
| 3. B | GO:1903793 | positive regulation of anion transport |
| 3. B | GO:0070168 | negative regulation of biomineral tissue development |
| 3. B | GO:0044354 | macropinosome |
| 3. B | GO:0060074 | synapse maturation |
| 3. B | GO:0061344 | regulation of cell adhesion involved in heart morphogenesis |
| 3. B | GO:0032088 | negative regulation of NF-kappaB transcription factor activity |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q6ZW76 | Ankyrin repeat and SAM domain-containing protein 3 | 1.74e-02 | 6.34e-04 | 3.14e-05 |
| 1. PB | Q5XJ13 | Ankyrin repeat and SAM domain-containing protein 6 | 2.70e-03 | 4.24e-09 | 4.96e-06 |
| 1. PB | A2ARS0 | Ankyrin repeat domain-containing protein 63 | 2.21e-03 | 1.58e-04 | 4.13e-04 |
| 1. PB | Q9Y2G4 | Ankyrin repeat domain-containing protein 6 | 4.70e-02 | 3.91e-11 | 6.28e-06 |
| 1. PB | Q5U312 | Ankycorbin | 1.33e-02 | 3.91e-02 | 2.25e-06 |
| 1. PB | O14974 | Protein phosphatase 1 regulatory subunit 12A | 3.40e-02 | 1.26e-02 | 0.005 |
| 1. PB | P0C0T2 | Ankyrin repeat and SAM domain-containing protein 6 | 2.05e-02 | 2.07e-05 | 1.05e-05 |
| 1. PB | Q69YU3 | Ankyrin repeat domain-containing protein 34A | 2.34e-05 | 1.41e-42 | 8.71e-103 |
| 1. PB | Q3UUF8 | Ankyrin repeat domain-containing protein 34B | 2.85e-08 | 8.60e-45 | 8.94e-110 |
| 1. PB | Q80VM7 | Ankyrin repeat domain-containing protein 24 | 2.49e-01 | 1.29e-02 | 2.14e-05 |
| 1. PB | Q9EP71 | Ankycorbin | 3.71e-02 | 3.91e-02 | 1.68e-06 |
| 1. PB | Q5PQ89 | Ankyrin repeat domain-containing protein 34B | 1.75e-04 | 5.64e-55 | 1.56e-148 |
| 1. PB | Q69ZU8 | Ankyrin repeat domain-containing protein 6 | 1.19e-01 | 5.43e-12 | 2.39e-06 |
| 1. PB | Q8BLB8 | Ankyrin repeat domain-containing protein 34C | 2.39e-05 | 3.59e-90 | 0.0 |
| 1. PB | Q90623 | Protein phosphatase 1 regulatory subunit 12A | 3.54e-02 | 5.20e-09 | 4.53e-04 |
| 1. PB | P0C6C1 | Ankyrin repeat domain-containing protein 34C | 0 | 6.48e-128 | 0.0 |
| 1. PB | Q68DC2 | Ankyrin repeat and SAM domain-containing protein 6 | 7.78e-03 | 2.86e-05 | 1.51e-05 |
| 1. PB | C9JTQ0 | Ankyrin repeat domain-containing protein 63 | 1.49e-04 | 1.08e-02 | 2.09e-04 |
| 1. PB | Q10728 | Protein phosphatase 1 regulatory subunit 12A | 3.04e-02 | 6.39e-03 | 0.004 |
| 1. PB | Q9P0K7 | Ankycorbin | 1.69e-02 | 7.92e-03 | 8.10e-05 |
| 1. PB | Q9DBR7 | Protein phosphatase 1 regulatory subunit 12A | 3.33e-03 | 1.13e-02 | 0.004 |
| 1. PB | O60237 | Protein phosphatase 1 regulatory subunit 12B | 1.14e-01 | 1.09e-10 | 3.96e-07 |
| 1. PB | Q6GQX6 | Ankyrin repeat and SAM domain-containing protein 6 | 9.58e-03 | 2.94e-07 | 5.49e-06 |
| 1. PB | A5PLL1 | Ankyrin repeat domain-containing protein 34B | 7.55e-05 | 8.96e-50 | 9.76e-114 |
| 1. PB | Q5BJT1 | Ankyrin repeat domain-containing protein 34A | 1.85e-06 | 1.17e-43 | 3.32e-103 |
| 1. PB | Q8BG95 | Protein phosphatase 1 regulatory subunit 12B | 5.28e-02 | 8.59e-11 | 3.64e-06 |
| 1. PB | Q5M9H0 | Ankyrin repeat and SAM domain-containing protein 3 | 3.97e-02 | 3.46e-02 | 1.37e-06 |
| 2. P | Q6AI12 | Ankyrin repeat domain-containing protein 40 | 2.11e-02 | 2.21e-02 | NA |
| 2. P | Q8K3X6 | Ankyrin repeat and SAM domain-containing protein 4B | 4.14e-03 | 5.92e-06 | NA |
| 2. P | P59672 | Ankyrin repeat and SAM domain-containing protein 1A | 2.89e-02 | 4.16e-02 | NA |
| 2. P | B1AK53 | Espin | 6.23e-03 | 3.66e-03 | NA |
| 2. P | Q9ET47 | Espin | 1.17e-02 | 6.70e-05 | NA |
| 2. P | Q495M9 | Usher syndrome type-1G protein | 4.10e-02 | 7.17e-08 | NA |
| 2. P | Q8N8V4 | Ankyrin repeat and SAM domain-containing protein 4B | 6.71e-03 | 5.01e-06 | NA |
| 2. P | Q8VHK1 | Caskin-2 | 5.99e-02 | 2.33e-03 | NA |
| 2. P | P70587 | Leucine-rich repeat-containing protein 7 | 7.11e-01 | 4.38e-03 | NA |
| 2. P | Q80T11 | Usher syndrome type-1G protein homolog | 4.61e-02 | 2.58e-07 | NA |
| 2. P | Q9BZL4 | Protein phosphatase 1 regulatory subunit 12C | 3.91e-02 | 5.66e-05 | NA |
| 2. P | Q3KP44 | Ankyrin repeat domain-containing protein 55 | 2.55e-03 | 1.73e-03 | NA |
| 2. P | Q80TE7 | Leucine-rich repeat-containing protein 7 | 6.90e-01 | 9.89e-03 | NA |
| 2. P | Q3UMT1 | Protein phosphatase 1 regulatory subunit 12C | 5.27e-03 | 2.68e-05 | NA |
| 2. P | Q6DRG7 | Protein phosphatase 1 regulatory subunit 12A | 8.73e-02 | 7.21e-04 | NA |
| 2. P | Q63618 | Espin | 2.02e-03 | 2.08e-03 | NA |
| 2. P | Q3UYR4 | Espin-like protein | 3.86e-02 | 3.16e-04 | NA |
| 2. P | Q6ZVH7 | Espin-like protein | 4.38e-02 | 1.17e-03 | NA |
| 2. P | Q04749 | Target of rapamycin complex 2 subunit AVO2 | 1.93e-03 | 2.36e-06 | NA |
| 3. B | Q9H560 | Putative ankyrin repeat domain-containing protein 19 | 2.93e-07 | NA | 0.042 |
| 3. B | A2VDR2 | Acyl-CoA-binding domain-containing protein 6 | 6.71e-08 | NA | 2.36e-06 |
| 3. B | Q8VHS6 | Ankyrin repeat and SOCS box protein 15 | 5.02e-03 | NA | 0.004 |
| 3. B | Q00PJ1 | Cortactin-binding protein 2 | 8.70e-01 | NA | 4.27e-06 |
| 3. B | Q54BA2 | Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 | 4.05e-02 | NA | 0.003 |
| 3. B | Q9VCA8 | Ankyrin repeat and KH domain-containing protein mask | NA | NA | 1.15e-05 |
| 3. B | Q9J5H9 | Putative ankyrin repeat protein FPV022 | NA | NA | 0.024 |
| 3. B | Q8IUH5 | Palmitoyltransferase ZDHHC17 | 2.47e-04 | NA | 0.002 |
| 3. B | F1MJR8 | Inactive serine/threonine-protein kinase TEX14 | 7.58e-01 | NA | 1.03e-05 |
| 3. B | Q99NH0 | Ankyrin repeat domain-containing protein 17 | 3.83e-01 | NA | 4.26e-08 |
| 3. B | Q2QL84 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.68e-03 | NA | 3.20e-04 |
| 3. B | A9JR78 | Tonsoku-like protein | 1.03e-01 | NA | 0.005 |
| 3. B | Q86YT6 | E3 ubiquitin-protein ligase MIB1 | 1.58e-02 | NA | 5.06e-04 |
| 3. B | Q9BXX3 | Ankyrin repeat domain-containing protein 30A | 2.50e-01 | NA | 0.003 |
| 3. B | Q6P9J5 | KN motif and ankyrin repeat domain-containing protein 4 | 5.05e-01 | NA | 2.87e-06 |
| 3. B | Q499M5 | Ankyrin repeat domain-containing protein 16 | 2.48e-05 | NA | 0.042 |
| 3. B | O89019 | Inversin | 3.70e-02 | NA | 4.94e-11 |
| 3. B | Q2QLB5 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.05e-04 | NA | 0.015 |
| 3. B | Q66JD7 | Acyl-CoA-binding domain-containing protein 6 | 4.62e-05 | NA | 3.12e-05 |
| 3. B | Q53RE8 | Ankyrin repeat domain-containing protein 39 | 1.50e-06 | NA | 0.006 |
| 3. B | P0C6P7 | Protein fem-1 homolog B | 2.02e-03 | NA | 4.24e-08 |
| 3. B | Q8CEF1 | Protein fem-1 homolog C | 2.65e-04 | NA | 6.42e-08 |
| 3. B | Q9J5H8 | Putative ankyrin repeat protein FPV023 | NA | NA | 3.20e-07 |
| 3. B | D3J162 | Protein VAPYRIN | 3.61e-03 | NA | 3.54e-04 |
| 3. B | Q8WMX8 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 5.88e-05 | NA | 8.25e-08 |
| 3. B | Q4UJ75 | Putative ankyrin repeat domain-containing protein 20A4 | 3.35e-03 | NA | 2.69e-04 |
| 3. B | Q06527 | Ankyrin homolog | 1.88e-04 | NA | 8.12e-11 |
| 3. B | Q0JKV1 | Potassium channel AKT1 | 7.65e-02 | NA | 1.27e-04 |
| 3. B | Q566C8 | Ankyrin repeat domain-containing protein 54 | 1.13e-08 | NA | 0.001 |
| 3. B | Q641X1 | Ankyrin repeat domain-containing protein 61 | 3.24e-05 | NA | 0.048 |
| 3. B | Q5UPG7 | Putative ankyrin repeat protein L91 | NA | NA | 1.09e-07 |
| 3. B | O14593 | DNA-binding protein RFXANK | 8.63e-06 | NA | 4.42e-04 |
| 3. B | Q2IBB2 | Cortactin-binding protein 2 | 8.18e-01 | NA | 3.86e-05 |
| 3. B | Q9EQG6 | Kinase D-interacting substrate of 220 kDa | 3.74e-01 | NA | 1.81e-07 |
| 3. B | Q07E41 | Cortactin-binding protein 2 | 7.29e-01 | NA | 6.73e-05 |
| 3. B | Q00PJ3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 5.99e-05 | NA | 0.003 |
| 3. B | Q2QLG9 | Cortactin-binding protein 2 | 8.72e-01 | NA | 7.85e-05 |
| 3. B | Q9Z2X2 | 26S proteasome non-ATPase regulatory subunit 10 | 3.18e-05 | NA | 0.004 |
| 3. B | Q9J5A7 | Putative ankyrin repeat protein FPV115 | NA | NA | 3.61e-07 |
| 3. B | Q9WV06 | Ankyrin repeat domain-containing protein 2 | 5.69e-04 | NA | 1.90e-04 |
| 3. B | B2RU33 | POTE ankyrin domain family member C | 2.18e-03 | NA | 2.19e-08 |
| 3. B | Q07E17 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 5.72e-05 | NA | 3.88e-04 |
| 3. B | Q02357 | Ankyrin-1 | 6.67e-01 | NA | 1.67e-04 |
| 3. B | Q6NSI1 | Putative ankyrin repeat domain-containing protein 26-like protein | 1.60e-04 | NA | 1.62e-06 |
| 3. B | P0CG38 | POTE ankyrin domain family member I | 4.67e-03 | NA | 1.18e-07 |
| 3. B | A0JP26 | POTE ankyrin domain family member B3 | 1.26e-03 | NA | 2.44e-09 |
| 3. B | O74205 | Transcription factor TOXE | 1.24e-05 | NA | 0.017 |
| 3. B | Q09YJ5 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 7.75e-05 | NA | 7.52e-06 |
| 3. B | Q2QLC6 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 7.18e-05 | NA | 3.94e-04 |
| 3. B | Q4ULZ2 | Putative ankyrin repeat protein RF_0580 | 1.16e-05 | NA | 2.40e-05 |
| 3. B | Q8N8A2 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B | 2.95e-03 | NA | 4.60e-04 |
| 3. B | Q9D504 | Ankyrin repeat domain-containing protein 7 | 2.84e-04 | NA | 0.001 |
| 3. B | Q9NU02 | Ankyrin repeat and EF-hand domain-containing protein 1 | 1.65e-02 | NA | 0.002 |
| 3. B | Q29RM5 | Protein fem-1 homolog A | 3.95e-03 | NA | 2.71e-04 |
| 3. B | Q8WMX6 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 5.79e-05 | NA | 0.024 |
| 3. B | Q6S5H5 | POTE ankyrin domain family member G | 2.83e-04 | NA | 1.20e-08 |
| 3. B | Q5F478 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B | 1.74e-03 | NA | 2.52e-04 |
| 3. B | Q21920 | Ankyrin repeat and KH domain-containing protein mask-1 | 7.16e-01 | NA | 4.57e-04 |
| 3. B | Q62422 | Osteoclast-stimulating factor 1 | 4.96e-08 | NA | 0.035 |
| 3. B | Q9J507 | Putative ankyrin repeat protein FPV228 | NA | NA | 0.007 |
| 3. B | S0DPL8 | Apicidin F cluster transcription factor apf2 | 7.23e-05 | NA | 1.32e-06 |
| 3. B | Q9Z2G0 | Protein fem-1 homolog B | 4.74e-04 | NA | 4.16e-08 |
| 3. B | A1ZBY1 | Protein fem-1 homolog B | 2.70e-04 | NA | 4.18e-06 |
| 3. B | Q5UQ58 | Putative ankyrin repeat protein R664 | NA | NA | 0.005 |
| 3. B | Q554E7 | Putative ZDHHC-type palmitoyltransferase 5 | 6.83e-04 | NA | 6.19e-06 |
| 3. B | A6QL64 | Ankyrin repeat domain-containing protein 36A | 2.81e-01 | NA | 1.32e-07 |
| 3. B | Q9VUX2 | E3 ubiquitin-protein ligase mind-bomb | 3.49e-01 | NA | 3.75e-05 |
| 3. B | G5E8K5 | Ankyrin-3 | 8.15e-01 | NA | 4.44e-05 |
| 3. B | Q8K0L0 | Ankyrin repeat and SOCS box protein 2 | 1.31e-03 | NA | 5.88e-04 |
| 3. B | Q9SQK3 | Ankyrin repeat domain-containing protein EMB506, chloroplastic | 1.22e-05 | NA | 0.010 |
| 3. B | A0PJZ0 | Putative ankyrin repeat domain-containing protein 20A5 | 4.22e-08 | NA | 4.01e-06 |
| 3. B | V6CLA2 | E3 ubiquitin-protein ligase hecd-1 | 9.03e-01 | NA | 0.022 |
| 3. B | Q7T0Q1 | Myotrophin | 3.68e-07 | NA | 0.032 |
| 3. B | Q3TYA6 | M-phase phosphoprotein 8 | 2.46e-01 | NA | 4.17e-06 |
| 3. B | Q8TF21 | Ankyrin repeat domain-containing protein 24 | 7.10e-02 | NA | 8.32e-06 |
| 3. B | A0A0A6YYL3 | POTE ankyrin domain family member B | 2.86e-03 | NA | 2.81e-09 |
| 3. B | Q6P6B7 | Ankyrin repeat domain-containing protein 16 | 2.15e-05 | NA | 0.029 |
| 3. B | O70511 | Ankyrin-3 | 8.94e-01 | NA | 2.55e-05 |
| 3. B | Q3U0D9 | E3 ubiquitin-protein ligase HACE1 | 6.78e-02 | NA | 0.002 |
| 3. B | Q96HA7 | Tonsoku-like protein | 7.52e-02 | NA | 0.004 |
| 3. B | Q5CZ79 | Ankyrin repeat domain-containing protein 20B | 5.80e-03 | NA | 5.00e-04 |
| 3. B | Q99549 | M-phase phosphoprotein 8 | 2.15e-01 | NA | 4.96e-06 |
| 3. B | Q9Z2X3 | 26S proteasome non-ATPase regulatory subunit 10 | 3.31e-05 | NA | 7.90e-04 |
| 3. B | Q54HC6 | Ankyrin repeat-containing protein kinase A | 3.65e-01 | NA | 8.69e-04 |
| 3. B | Q7T163 | Kinase D-interacting substrate of 220 kDa B | 8.52e-01 | NA | 8.23e-08 |
| 3. B | A1X154 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 6.83e-03 | NA | 0.014 |
| 3. B | Q6RI86 | Transient receptor potential cation channel subfamily A member 1 | 1.05e-02 | NA | 0.007 |
| 3. B | Q9WV48 | SH3 and multiple ankyrin repeat domains protein 1 | 6.24e-01 | NA | 6.20e-05 |
| 3. B | Q8N2N9 | Ankyrin repeat domain-containing protein 36B | 8.09e-02 | NA | 5.72e-08 |
| 3. B | Q07DV1 | Cortactin-binding protein 2 | 8.64e-01 | NA | 2.51e-05 |
| 3. B | Q9NWX5 | Ankyrin repeat and SOCS box protein 6 | 3.70e-05 | NA | 0.009 |
| 3. B | Q5W7F2 | ADP-ribosylation factor GTPase-activating protein AGD3 | 3.99e-01 | NA | 0.002 |
| 3. B | A2A690 | Protein TANC2 | 2.75e-01 | NA | 9.78e-07 |
| 3. B | A5A3E0 | POTE ankyrin domain family member F | 4.70e-02 | NA | 4.52e-08 |
| 3. B | Q07DW4 | Cortactin-binding protein 2 | 6.90e-01 | NA | 3.95e-06 |
| 3. B | Q4R3S3 | Ankyrin repeat domain-containing protein 7 | 2.78e-04 | NA | 2.02e-05 |
| 3. B | Q07DX4 | Cortactin-binding protein 2 | 8.41e-01 | NA | 1.54e-04 |
| 3. B | Q8BTZ5 | Ankyrin repeat domain-containing protein 46 | 1.95e-06 | NA | 0.016 |
| 3. B | Q8BLA8 | Transient receptor potential cation channel subfamily A member 1 | 1.09e-02 | NA | 0.047 |
| 3. B | Q8H569 | Potassium channel AKT3 | 2.99e-01 | NA | 0.023 |
| 3. B | A6NI47 | Putative POTE ankyrin domain family member M | 9.20e-05 | NA | 1.10e-08 |
| 3. B | Q5UQV3 | Putative ankyrin repeat protein L371 | NA | NA | 0.019 |
| 3. B | Q7T3P8 | Protein fem-1 homolog C | 2.20e-03 | NA | 4.72e-07 |
| 3. B | Q2QLA2 | Cortactin-binding protein 2 | 7.22e-01 | NA | 5.35e-06 |
| 3. B | P12932 | Ankyrin repeat domain-containing protein CP77 | NA | NA | 0.030 |
| 3. B | Q5UPX1 | Putative ankyrin repeat protein L289 | NA | NA | 5.54e-06 |
| 3. B | P17221 | Sex-determining protein fem-1 | 1.29e-03 | NA | 1.06e-05 |
| 3. B | Q9Z2F6 | B-cell lymphoma 3 protein homolog | 1.09e-03 | NA | 0.006 |
| 3. B | O75179 | Ankyrin repeat domain-containing protein 17 | 5.17e-01 | NA | 3.88e-08 |
| 3. B | Q9HYV6 | Putative ankyrin repeat protein PA3287 | 3.81e-08 | NA | 0.006 |
| 3. B | Q8BXP5 | Photoreceptor ankyrin repeat protein | 1.20e-02 | NA | 0.010 |
| 3. B | O83515 | Putative ankyrin repeat-containing protein TP_0502 | 2.14e-05 | NA | 7.49e-06 |
| 3. B | Q09YM8 | Cortactin-binding protein 2 | 5.96e-01 | NA | 3.01e-06 |
| 3. B | A7MB89 | Protein fem-1 homolog C | 2.67e-04 | NA | 6.05e-08 |
| 3. B | Q9WTK5 | Nuclear factor NF-kappa-B p100 subunit | 1.15e-01 | NA | 0.013 |
| 3. B | Q9WTT2 | Caseinolytic peptidase B protein homolog | 1.10e-03 | NA | 0.003 |
| 3. B | Q6GPE5 | Protein fem-1 homolog B | 2.15e-04 | NA | 1.66e-04 |
| 3. B | Q9D2J7 | Ankyrin repeat and EF-hand domain-containing protein 1 | 1.22e-02 | NA | 0.032 |
| 3. B | Q9H2K2 | Poly [ADP-ribose] polymerase tankyrase-2 | 3.05e-02 | NA | 1.86e-04 |
| 3. B | Q07E30 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 5.03e-05 | NA | 1.80e-04 |
| 3. B | Q9D061 | Acyl-CoA-binding domain-containing protein 6 | 7.18e-08 | NA | 7.16e-05 |
| 3. B | Q5DW34 | Histone-lysine N-methyltransferase EHMT1 | 6.64e-01 | NA | 1.70e-04 |
| 3. B | Q9BXX2 | Ankyrin repeat domain-containing protein 30B | 3.79e-02 | NA | 1.40e-04 |
| 3. B | Q80YE7 | Death-associated protein kinase 1 | 2.63e-02 | NA | 2.18e-06 |
| 3. B | Q5UPG0 | Putative ankyrin repeat protein L86 | NA | NA | 3.92e-08 |
| 3. B | Q4UMP3 | Putative ankyrin repeat protein RF_0314 | 7.28e-05 | NA | 7.65e-04 |
| 3. B | E9PTT0 | Palmitoyltransferase ZDHHC17 | 2.24e-04 | NA | 0.005 |
| 3. B | Q5RCK5 | Ankyrin repeat and SOCS box protein 7 | 1.52e-05 | NA | 0.022 |
| 3. B | Q8UVC1 | Inversin | 2.20e-01 | NA | 1.63e-08 |
| 3. B | Q5SQ80 | Putative ankyrin repeat domain-containing protein 20A2 | 5.58e-03 | NA | 2.84e-04 |
| 3. B | Q8GSP8 | Zygote-specific protein 3 | 1.13e-03 | NA | 0.008 |
| 3. B | Q2IBD4 | Cortactin-binding protein 2 | 8.72e-01 | NA | 2.98e-05 |
| 3. B | P0CG39 | POTE ankyrin domain family member J | 7.30e-02 | NA | 1.20e-07 |
| 3. B | Q978J0 | Putative ankyrin repeat protein TV1425 | 1.92e-08 | NA | 2.42e-04 |
| 3. B | Q2IBF5 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 4.92e-05 | NA | 0.021 |
| 3. B | Q9VSA4 | Tonsoku-like protein | 1.64e-01 | NA | 3.87e-05 |
| 3. B | Q2IBE3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 4.46e-05 | NA | 0.005 |
| 3. B | Q8IWZ3 | Ankyrin repeat and KH domain-containing protein 1 | 6.15e-01 | NA | 9.20e-07 |
| 3. B | B9EJA2 | Cortactin-binding protein 2 | 7.55e-01 | NA | 8.70e-06 |
| 3. B | Q8MJ50 | Osteoclast-stimulating factor 1 | 3.68e-08 | NA | 0.005 |
| 3. B | Q4V890 | Protein fem-1 homolog A | 1.60e-03 | NA | 1.11e-04 |
| 3. B | Q8CGB3 | Uveal autoantigen with coiled-coil domains and ankyrin repeats | 1.04e-02 | NA | 2.85e-04 |
| 3. B | Q9J5H5 | Putative ankyrin repeat protein FPV026 | NA | NA | 7.92e-04 |
| 3. B | Q8IVF6 | Ankyrin repeat domain-containing protein 18A | 3.30e-03 | NA | 0.005 |
| 3. B | Q8IWB6 | Inactive serine/threonine-protein kinase TEX14 | 3.81e-01 | NA | 1.27e-04 |
| 3. B | Q3UES3 | Poly [ADP-ribose] polymerase tankyrase-2 | 6.75e-02 | NA | 1.26e-04 |
| 3. B | Q9J504 | Putative ankyrin repeat protein FPV231 | NA | NA | 0.003 |
| 3. B | Q9J4Z4 | Putative ankyrin repeat protein FPV246 | NA | NA | 0.017 |
| 3. B | A6NC57 | Ankyrin repeat domain-containing protein 62 | 1.25e-01 | NA | 4.56e-04 |
| 3. B | Q4ACU6 | SH3 and multiple ankyrin repeat domains protein 3 | 2.40e-02 | NA | 0.035 |
| 3. B | B0G124 | Ankyrin repeat-containing protein DDB_G0279043 | 1.84e-06 | NA | 0.044 |
| 3. B | Q8C6Y6 | Ankyrin repeat and SOCS box protein 14 | 8.63e-04 | NA | 6.38e-04 |
| 3. B | Q5UPJ9 | Putative ankyrin repeat protein L122 | NA | NA | 6.12e-07 |
| 3. B | Q5AL27 | Palmitoyltransferase AKR1 | 1.59e-03 | NA | 0.002 |
| 3. B | Q54F46 | Homeobox protein Wariai | 2.17e-02 | NA | 4.55e-05 |
| 3. B | F1LTE0 | Protein TANC2 | 7.92e-02 | NA | 9.78e-07 |
| 3. B | Q108T9 | Cortactin-binding protein 2 | 5.86e-01 | NA | 5.86e-07 |
| 3. B | Q9H672 | Ankyrin repeat and SOCS box protein 7 | 1.67e-05 | NA | 0.026 |
| 3. B | Q9P2R3 | Rabankyrin-5 | 3.45e-02 | NA | 4.31e-04 |
| 3. B | Q05921 | 2-5A-dependent ribonuclease | 7.28e-04 | NA | 1.44e-04 |
| 3. B | Q8UVC3 | Inversin | 1.37e-02 | NA | 0.020 |
| 3. B | Q9GKW8 | Ankyrin repeat and death domain-containing protein 1A (Fragment) | 3.95e-05 | NA | 2.43e-04 |
| 3. B | Q5ZIJ9 | E3 ubiquitin-protein ligase MIB2 | 6.91e-02 | NA | 0.001 |
| 3. B | Q9SCX5 | Probable potassium channel AKT5 | 4.30e-02 | NA | 0.005 |
| 3. B | Q05823 | 2-5A-dependent ribonuclease | 1.72e-02 | NA | 3.09e-06 |
| 3. B | Q8ZWC4 | Putative ankyrin repeat protein PAE1861 | 2.60e-04 | NA | 0.002 |
| 3. B | Q12013 | Probable palmitoyltransferase AKR2 | 2.23e-03 | NA | 4.00e-04 |
| 3. B | Q4X251 | Palmitoyltransferase akr1 | 1.40e-03 | NA | 0.008 |
| 3. B | Q8WMX7 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.42e-03 | NA | 0.009 |
| 3. B | Q5UPG6 | Putative ankyrin repeat protein L92 | NA | NA | 3.79e-09 |
| 3. B | Q1RHT6 | Putative ankyrin repeat protein RBE_0997 | 2.25e-03 | NA | 7.33e-06 |
| 3. B | B7WN72 | Protein shank | 1.12e-02 | NA | 0.042 |
| 3. B | Q9Z205 | DNA-binding protein RFXANK | 1.29e-05 | NA | 1.25e-04 |
| 3. B | Q14678 | KN motif and ankyrin repeat domain-containing protein 1 | 7.16e-01 | NA | 0.018 |
| 3. B | Q5ZLC8 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 5.49e-02 | NA | 2.27e-04 |
| 3. B | Q505D1 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A | 2.30e-03 | NA | 0.004 |
| 3. B | Q68LP1 | E3 ubiquitin-protein ligase MIB2 | 9.54e-03 | NA | 0.001 |
| 3. B | Q01484 | Ankyrin-2 | NA | NA | 6.72e-06 |
| 3. B | Q9UK73 | Protein fem-1 homolog B | 2.05e-03 | NA | 4.06e-08 |
| 3. B | Q54GC8 | Acyl-CoA-binding domain-containing protein 6 homolog | 3.26e-06 | NA | 3.58e-04 |
| 3. B | Q9VUW9 | Palmitoyltransferase Hip14 | 1.01e-03 | NA | 3.36e-06 |
| 3. B | Q9UPS8 | Ankyrin repeat domain-containing protein 26 | 1.09e-01 | NA | 5.50e-06 |
| 3. B | Q2QLH1 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 5.73e-05 | NA | 0.001 |
| 3. B | Q9WV71 | Ankyrin repeat and SOCS box protein 4 | 5.96e-05 | NA | 0.003 |
| 3. B | F8W2M1 | E3 ubiquitin-protein ligase HACE1 | 2.54e-03 | NA | 0.009 |
| 3. B | Q96Q27 | Ankyrin repeat and SOCS box protein 2 | 8.27e-04 | NA | 1.56e-04 |
| 3. B | Q9J513 | Putative ankyrin repeat protein FPV222 | NA | NA | 5.87e-06 |
| 3. B | Q9Y283 | Inversin | 1.68e-02 | NA | 7.17e-11 |
| 3. B | Q4UKI1 | Putative ankyrin repeat protein RF_1099 | 1.14e-03 | NA | 1.69e-04 |
| 3. B | Q8R516 | E3 ubiquitin-protein ligase MIB2 | 8.26e-03 | NA | 0.013 |
| 3. B | Q495B1 | Ankyrin repeat and death domain-containing protein 1A | 5.66e-05 | NA | 3.36e-04 |
| 3. B | Q9ULH0 | Kinase D-interacting substrate of 220 kDa | 8.25e-01 | NA | 8.19e-07 |
| 3. B | G3I6Z6 | Neurogenic locus notch homolog protein 1 | NA | NA | 0.005 |
| 3. B | Q9BGT9 | Ankyrin repeat and SOCS box protein 7 | 1.59e-05 | NA | 0.035 |
| 3. B | P14360 | Putative ankyrin repeat protein FPV240 | NA | NA | 0.039 |
| 3. B | Q9C0D5 | Protein TANC1 | 3.58e-01 | NA | 6.77e-07 |
| 3. B | O70445 | BRCA1-associated RING domain protein 1 | 3.75e-01 | NA | 0.003 |
| 3. B | Q4UKJ3 | Putative ankyrin repeat protein RF_1087 | 1.85e-04 | NA | 0.001 |
| 3. B | Q9Z1P7 | KN motif and ankyrin repeat domain-containing protein 3 | 3.82e-01 | NA | 1.05e-05 |
| 3. B | Q5UPG5 | Putative ankyrin repeat protein L93 | NA | NA | 1.98e-13 |
| 3. B | Q86SG2 | Ankyrin repeat domain-containing protein 23 | 6.85e-05 | NA | 2.97e-04 |
| 3. B | Q9WV72 | Ankyrin repeat and SOCS box protein 3 | 1.80e-03 | NA | 0.024 |
| 3. B | Q91WK7 | Ankyrin repeat domain-containing protein 54 | 1.40e-05 | NA | 0.001 |
| 3. B | Q07DZ5 | Cortactin-binding protein 2 | 7.99e-01 | NA | 1.56e-05 |
| 3. B | Q09YN0 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 5.72e-05 | NA | 8.25e-04 |
| 3. B | Q5U2S6 | Ankyrin repeat and SOCS box protein 2 | 5.07e-04 | NA | 8.30e-04 |
| 3. B | D3YZU1 | SH3 and multiple ankyrin repeat domains protein 1 | 4.20e-01 | NA | 6.53e-05 |
| 3. B | Q92527 | Ankyrin repeat domain-containing protein 7 | 7.48e-06 | NA | 6.75e-04 |
| 3. B | Q80SY4 | E3 ubiquitin-protein ligase MIB1 | 2.20e-02 | NA | 4.65e-04 |
| 3. B | Q60J38 | Ankyrin repeat and KH domain-containing protein CBG24701 | 4.42e-01 | NA | 1.52e-04 |
| 3. B | P16157 | Ankyrin-1 | 8.31e-01 | NA | 2.37e-06 |
| 3. B | Q5VUR7 | Putative ankyrin repeat domain-containing protein 20A3 | 4.23e-02 | NA | 2.79e-04 |
| 3. B | Q502M6 | Ankyrin repeat domain-containing protein 29 | 9.19e-06 | NA | 2.39e-04 |
| 3. B | Q6S8J3 | POTE ankyrin domain family member E | 3.75e-02 | NA | 5.47e-08 |
| 3. B | Q8T2Q0 | Putative ZDHHC-type palmitoyltransferase 6 | 8.88e-02 | NA | 5.18e-12 |
| 3. B | Q0VGY8 | Protein TANC1 | 7.88e-02 | NA | 1.18e-06 |
| 3. B | O95271 | Poly [ADP-ribose] polymerase tankyrase-1 | 1.20e-01 | NA | 1.47e-04 |
| 3. B | B2RXR6 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B | 2.65e-03 | NA | 3.02e-04 |
| 3. B | Q502K3 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 5.36e-02 | NA | 1.30e-04 |
| 3. B | Q66H07 | Fibronectin type 3 and ankyrin repeat domains 1 protein | 9.08e-07 | NA | 3.29e-05 |
| 3. B | Q7M6U3 | Inactive serine/threonine-protein kinase TEX14 | 4.26e-01 | NA | 1.71e-05 |
| 3. B | Q2QLB3 | Cortactin-binding protein 2 | 7.29e-01 | NA | 1.74e-04 |
| 3. B | Q05753 | Ankyrin repeat domain-containing protein, chloroplastic | 8.96e-06 | NA | 3.06e-05 |
| 3. B | Q8HYY4 | Uveal autoantigen with coiled-coil domains and ankyrin repeats protein | 3.51e-02 | NA | 3.87e-04 |
| 3. B | Q9Y566 | SH3 and multiple ankyrin repeat domains protein 1 | 4.58e-01 | NA | 8.87e-05 |
| 3. B | Q6UB99 | Ankyrin repeat domain-containing protein 11 | 2.88e-01 | NA | 0.040 |
| 3. B | Q6PFX9 | Poly [ADP-ribose] polymerase tankyrase-1 | 6.48e-01 | NA | 1.51e-04 |
| 3. B | Q9J5I3 | Putative ankyrin repeat protein FPV018 | NA | NA | 1.72e-07 |
| 3. B | Q2IBG0 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 7.73e-05 | NA | 6.80e-04 |
| 3. B | Q6P1S6 | Myotrophin | 2.25e-07 | NA | 0.004 |
| 3. B | Q3SX45 | Ankyrin repeat and SOCS box protein 2 | 6.62e-04 | NA | 2.45e-05 |
| 3. B | Q8MJ49 | Osteoclast-stimulating factor 1 | 3.86e-08 | NA | 0.048 |
| 3. B | C7B178 | Protein VAPYRIN | 9.63e-02 | NA | 5.42e-09 |
| 3. B | Q9SAR5 | Ankyrin repeat domain-containing protein 2A | 4.30e-07 | NA | 0.025 |
| 3. B | Q09103 | Eye-specific diacylglycerol kinase | 7.44e-01 | NA | 0.001 |
| 3. B | Q76K24 | Ankyrin repeat domain-containing protein 46 | 9.42e-07 | NA | 0.013 |
| 3. B | Q4V8X4 | Acyl-CoA-binding domain-containing protein 6 | 5.92e-05 | NA | 1.80e-06 |
| 3. B | Q5R4M7 | Ankyrin repeat and SOCS box protein 6 | 4.03e-05 | NA | 0.009 |
| 3. B | Q71S21 | Inversin-B | 6.05e-02 | NA | 5.66e-04 |
| 3. B | Q8VHK2 | Caskin-1 | 2.75e-02 | NA | 2.90e-05 |
| 3. B | Q29Q26 | Ankyrin repeat domain-containing protein 2B | 2.98e-07 | NA | 0.013 |
| 3. B | Q09YI1 | Cortactin-binding protein 2 | 8.57e-01 | NA | 2.36e-06 |
| 3. B | Q5JPF3 | Ankyrin repeat domain-containing protein 36C | 1.51e-01 | NA | 2.56e-08 |
| 3. B | Q8N6D5 | Ankyrin repeat domain-containing protein 29 | 1.68e-05 | NA | 2.20e-04 |
| 3. B | O15084 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A | 2.43e-03 | NA | 0.012 |
| 3. B | Q96AX9 | E3 ubiquitin-protein ligase MIB2 | 1.18e-02 | NA | 0.004 |
| 3. B | Q9J4Z5 | Putative ankyrin repeat protein FPV245 | NA | NA | 2.94e-04 |
| 3. B | Q6P9Z4 | Protein fem-1 homolog A | 2.50e-04 | NA | 9.94e-07 |
| 3. B | E5RJM6 | Ankyrin repeat domain-containing protein 65 | 2.99e-04 | NA | 3.71e-05 |
| 3. B | Q8BTI7 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 3.87e-01 | NA | 1.13e-04 |
| 3. B | Q9GZV1 | Ankyrin repeat domain-containing protein 2 | 1.11e-03 | NA | 1.02e-04 |
| 3. B | Q108U1 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 4.14e-05 | NA | 0.002 |
| 3. B | Q86YR6 | POTE ankyrin domain family member D | 1.32e-01 | NA | 8.34e-09 |
| 3. B | Q60649 | Caseinolytic peptidase B protein homolog | 1.04e-03 | NA | 3.46e-04 |
| 3. B | Q2IBB1 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 7.43e-05 | NA | 0.009 |
| 3. B | Q59H18 | Serine/threonine-protein kinase TNNI3K | 3.86e-03 | NA | 0.024 |
| 3. B | Q99PE2 | Ankyrin repeat family A protein 2 | 1.94e-05 | NA | 5.73e-06 |
| 3. B | Q7ZYG4 | Osteoclast-stimulating factor 1 | 3.19e-08 | NA | 0.012 |
| 3. B | Q9BSK4 | Protein fem-1 homolog A | 1.22e-02 | NA | 8.03e-05 |
| 3. B | Q9H9B1 | Histone-lysine N-methyltransferase EHMT1 | 7.00e-01 | NA | 1.29e-04 |
| 3. B | Q07E28 | Cortactin-binding protein 2 | 7.74e-01 | NA | 2.09e-07 |
| 3. B | Q5H9F3 | BCL-6 corepressor-like protein 1 | 4.51e-01 | NA | 0.025 |
| 3. B | Q28BK1 | E3 ubiquitin-protein ligase HACE1 | 3.12e-03 | NA | 0.024 |
| 3. B | Q55A55 | Probable serine/threonine-protein kinase DDB_G0272092 | 6.26e-02 | NA | 1.08e-04 |
| 3. B | Q5TYW2 | Ankyrin repeat domain-containing protein 20A1 | 1.90e-02 | NA | 2.19e-04 |
| 3. B | Q9J5I7 | Putative ankyrin repeat protein FPV014 | NA | NA | 2.91e-04 |
| 3. B | H3BUK9 | POTE ankyrin domain family member B2 | 1.20e-03 | NA | 2.81e-09 |
| 3. B | Q92625 | Ankyrin repeat and SAM domain-containing protein 1A | 2.34e-01 | NA | 0.008 |
| 3. B | Q09YI3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 6.76e-05 | NA | 7.17e-08 |
| 3. B | A0M8T5 | Cortactin-binding protein 2 | 8.19e-01 | NA | 2.02e-07 |
| 3. B | Q9BZF9 | Uveal autoantigen with coiled-coil domains and ankyrin repeats | 2.03e-02 | NA | 8.09e-05 |
| 3. B | Q9DAM9 | Fibronectin type 3 and ankyrin repeat domains 1 protein | 5.32e-07 | NA | 3.29e-05 |
| 3. B | Q8N283 | Ankyrin repeat domain-containing protein 35 | 1.58e-01 | NA | 2.47e-09 |
| 3. B | Q2KI79 | Ankyrin repeat family A protein 2 | 8.23e-07 | NA | 5.66e-06 |
| 3. B | Q5ZM55 | Protein fem-1 homolog B | 2.35e-04 | NA | 1.09e-04 |
| 3. B | Q07E15 | Cortactin-binding protein 2 | 6.50e-01 | NA | 3.01e-06 |
| 3. B | A6QPE7 | Ankyrin repeat domain-containing protein 65 | 1.68e-05 | NA | 2.12e-04 |
| 3. B | Q810B6 | Rabankyrin-5 | 2.70e-02 | NA | 7.34e-04 |
| 3. B | Q8Q0U0 | Putative ankyrin repeat protein MM_0045 | 1.22e-08 | NA | 2.67e-10 |
| 3. B | Q09YJ3 | Cortactin-binding protein 2 | 8.49e-01 | NA | 2.53e-06 |
| 3. B | Q12955 | Ankyrin-3 | NA | NA | 1.34e-05 |
| 3. B | Q8VHS5 | Ankyrin repeat and SOCS box protein 16 | 6.52e-05 | NA | 4.65e-04 |
| 3. B | Q8C0T1 | Protein fem-1 homolog A-B | 3.90e-03 | NA | 0.001 |
| 3. B | Q54KH3 | Ankyrin repeat domain-containing protein 39 homolog | 4.61e-06 | NA | 0.007 |
| 3. B | Q2QL82 | Cortactin-binding protein 2 | 8.91e-01 | NA | 6.28e-06 |
| 3. B | Q80TN5 | Palmitoyltransferase ZDHHC17 | 2.48e-04 | NA | 0.005 |
| 3. B | A6NCL7 | Ankyrin repeat domain-containing protein 33B | 7.15e-03 | NA | 0.002 |
| 3. B | Q5VYY1 | Ankyrin repeat domain-containing protein 22 | 2.54e-07 | NA | 0.002 |
| 3. B | Q03017 | NF-kappa-B inhibitor cactus | 3.47e-04 | NA | 0.013 |
| 3. B | Q6P686 | Osteoclast-stimulating factor 1 | 3.37e-08 | NA | 0.035 |
| 3. B | B8N0E6 | Ankyrin-repeat domain containing transcription coregulator asaA | 4.29e-01 | NA | 8.62e-05 |
| 3. B | O75832 | 26S proteasome non-ATPase regulatory subunit 10 | 1.84e-04 | NA | 0.003 |
| 3. B | Q8VD46 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 7.98e-05 | NA | 1.41e-04 |
| 3. B | F1M5M3 | Inactive serine/threonine-protein kinase TEX14 | NA | NA | 5.91e-04 |
| 3. B | Q9CQM6 | Ankyrin repeat domain-containing protein 61 | 3.67e-05 | NA | 0.001 |
| 3. B | Q2IBB4 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 8.91e-05 | NA | 6.56e-04 |
| 3. B | Q9BYB0 | SH3 and multiple ankyrin repeat domains protein 3 | 3.78e-01 | NA | 0.015 |
| 3. B | Q6NY19 | KN motif and ankyrin repeat domain-containing protein 3 | 2.37e-02 | NA | 6.16e-06 |
| 3. B | A0M8S4 | Cortactin-binding protein 2 | 7.73e-01 | NA | 1.31e-04 |
| 3. B | Q8GXE6 | Potassium channel AKT6 | 5.16e-02 | NA | 0.037 |
| 3. B | A0A140LI88 | Ankyrin repeat domain-containing protein 31 | 5.59e-01 | NA | 0.019 |
| 3. B | Q5E9N5 | Caseinolytic peptidase B protein homolog | 9.58e-04 | NA | 0.001 |
| 3. B | Q09YK4 | Cortactin-binding protein 2 | 5.79e-01 | NA | 1.77e-05 |
| 3. B | Q8C8R3 | Ankyrin-2 | NA | NA | 6.28e-06 |
| 3. B | E1C656 | E3 ubiquitin-protein ligase HACE1 | 3.58e-02 | NA | 0.009 |
| 3. B | Q9TU71 | Ankyrin repeat domain-containing protein 1 | 1.35e-04 | NA | 0.041 |
| 3. B | Q6F6B3 | Protein TANC1 | 9.47e-02 | NA | 1.53e-06 |
| 3. B | P17369 | Ankyrin repeat protein 14 | NA | NA | 0.010 |
| 3. B | E9Q4F7 | Ankyrin repeat domain-containing protein 11 | 4.82e-01 | NA | 0.046 |
| 3. B | Q8WWH4 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 6.90e-05 | NA | 0.030 |
| 3. B | Q07DY6 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 7.65e-05 | NA | 0.002 |
| 3. B | Q1RJN6 | Putative ankyrin repeat protein RBE_0347 | 2.90e-05 | NA | 0.005 |
| 3. B | P98150 | Nuclear factor NF-kappa-B p100 subunit | 2.56e-01 | NA | 0.013 |
| 3. B | P40480 | Protein HOS4 | 3.87e-02 | NA | 9.28e-07 |
| 3. B | Q5RF15 | Serine/threonine-protein kinase TNNI3K | 1.22e-03 | NA | 0.005 |
| 3. B | Q9H9E1 | Ankyrin repeat family A protein 2 | 3.48e-07 | NA | 9.50e-06 |
| 3. B | Q6NXT1 | Ankyrin repeat domain-containing protein 54 | 1.06e-05 | NA | 0.003 |
| 3. B | Q5T7N3 | KN motif and ankyrin repeat domain-containing protein 4 | 7.28e-01 | NA | 2.13e-06 |
| 3. B | Q9QZH2 | BRCA1-associated RING domain protein 1 | 6.68e-01 | NA | 0.011 |
| 3. B | Q7ZT11 | Ankyrin repeat domain-containing protein 1 | 6.50e-04 | NA | 0.038 |
| 3. B | Q07E43 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 1.10e-04 | NA | 4.66e-04 |
| 3. B | Q9VFD5 | Protein fem-1 homolog CG6966 | 2.94e-03 | NA | 1.03e-06 |
| 3. B | Q6P9K8 | Caskin-1 | 3.26e-01 | NA | 7.70e-05 |
| 3. B | Q8TC84 | Fibronectin type 3 and ankyrin repeat domains protein 1 | 1.93e-05 | NA | 1.89e-05 |
| 3. B | Q99728 | BRCA1-associated RING domain protein 1 | 6.42e-01 | NA | 0.012 |
| 3. B | Q2IBA2 | Cortactin-binding protein 2 | 8.38e-01 | NA | 1.35e-04 |
| 3. B | Q6S8J7 | POTE ankyrin domain family member A | 9.04e-03 | NA | 6.02e-09 |
| 3. B | Q3UMR0 | Ankyrin repeat domain-containing protein 27 | 1.41e-01 | NA | 9.13e-07 |
| 3. B | Q07008 | Neurogenic locus notch homolog protein 1 | 6.04e-01 | NA | 0.006 |
| 3. B | Q9H078 | Caseinolytic peptidase B protein homolog | 5.93e-03 | NA | 0.008 |
| 3. B | Q811D2 | Ankyrin repeat domain-containing protein 26 | 6.95e-02 | NA | 1.73e-06 |
| 3. B | Q07DY4 | Cortactin-binding protein 2 | 8.72e-01 | NA | 1.35e-04 |
| 3. B | A5PMU4 | Ankyrin repeat and sterile alpha motif domain-containing protein 1B | 5.63e-02 | NA | 0.021 |
| 3. B | Q876A6 | Palmitoyltransferase AKR1 | 1.10e-03 | NA | 0.010 |
| 3. B | Q9HCD6 | Protein TANC2 | 1.31e-01 | NA | 4.19e-07 |
| 3. B | A1X157 | Cortactin-binding protein 2 | 6.64e-01 | NA | 9.72e-07 |
| 3. B | Q9D3J5 | Ankyrin repeat domain-containing protein 22 | 3.22e-07 | NA | 0.029 |
| 3. B | Q6S545 | POTE ankyrin domain family member H | 5.71e-02 | NA | 1.35e-08 |
| 3. B | Q9GL21 | Uveal autoantigen with coiled-coil domains and ankyrin repeats | 1.45e-02 | NA | 2.73e-04 |
| 3. B | Q1RK13 | Putative ankyrin repeat protein RBE_0220 | 4.39e-03 | NA | 5.13e-05 |
| 3. B | Q9CZK6 | Ankyrin repeat and SAM domain-containing protein 3 | 1.18e-02 | NA | 5.29e-06 |
| 3. B | Q5UPF8 | Putative ankyrin repeat protein L88 | NA | NA | 3.31e-08 |
| 3. B | Q2QLF8 | Cortactin-binding protein 2 | 8.87e-01 | NA | 7.09e-05 |
| 3. B | Q2IBF7 | Cortactin-binding protein 2 | 8.47e-01 | NA | 1.25e-04 |
| 3. B | Q71S22 | Inversin-A | 1.72e-02 | NA | 1.82e-07 |
| 3. B | Q9HFE7 | Ankyrin repeat-containing protein P16F5.05c | 5.28e-06 | NA | 0.037 |
| 3. B | Q6GNY1 | E3 ubiquitin-protein ligase mib1 | 3.16e-02 | NA | 5.54e-05 |
| 3. B | Q91ZU0 | Ankyrin repeat and SOCS box protein 7 | 1.60e-05 | NA | 0.025 |
| 3. B | Q5UPV1 | Putative ankyrin repeat protein L271 | NA | NA | 6.94e-04 |
| 3. B | Q9JLU4 | SH3 and multiple ankyrin repeat domains protein 3 | 1.44e-01 | NA | 0.033 |
| 3. B | A0M8T3 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 6.28e-05 | NA | 4.94e-04 |
| 3. B | A2A2Z9 | Ankyrin repeat domain-containing protein 18B | 2.87e-03 | NA | 0.002 |
| 3. B | Q4UMH6 | Putative ankyrin repeat protein RF_0381 | 4.82e-02 | NA | 1.61e-06 |
| 3. B | P53355 | Death-associated protein kinase 1 | 3.17e-02 | NA | 2.28e-06 |
| 3. B | Q804S5 | E3 ubiquitin-protein ligase mib1 | 3.48e-01 | NA | 5.38e-05 |
| 3. B | Q9J5H7 | Putative ankyrin repeat protein FPV024 | NA | NA | 0.001 |
| 3. B | Q09701 | Palmitoyltransferase akr1 | 4.28e-03 | NA | 2.49e-04 |
| 3. B | Q01705 | Neurogenic locus notch homolog protein 1 | 9.02e-01 | NA | 0.005 |
| 3. B | Q9Z2G1 | Protein fem-1 homolog A-A | 1.50e-02 | NA | 9.63e-05 |
| 3. B | P0C550 | Potassium channel AKT1 | 5.23e-02 | NA | 1.25e-04 |
| 3. B | X1WE18 | KN motif and ankyrin repeat domain-containing protein 2 | 4.45e-01 | NA | 9.33e-05 |
| 3. B | Q8IYU2 | E3 ubiquitin-protein ligase HACE1 | 1.95e-02 | NA | 0.002 |
| 3. B | Q875S9 | Palmitoyltransferase AKR1 | 8.48e-04 | NA | 0.008 |
| 3. B | Q6B858 | Fibronectin type 3 and ankyrin repeat domains protein 1 | 9.01e-07 | NA | 1.08e-05 |
| 3. B | Q8WXK1 | Ankyrin repeat and SOCS box protein 15 | 4.95e-03 | NA | 2.01e-05 |
| 3. B | Q2IBF8 | Cortactin-binding protein 2 | 5.48e-01 | NA | 1.39e-05 |
| 3. B | Q2T9K6 | Protein fem-1 homolog C | 2.09e-03 | NA | 3.77e-07 |
| 3. B | Q9ULJ7 | Ankyrin repeat domain-containing protein 50 | 1.55e-01 | NA | 7.22e-08 |
| 3. B | Q8NB46 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 4.74e-02 | NA | 9.81e-05 |
| 3. B | Q5REW9 | Ankyrin repeat domain-containing protein 27 | 3.96e-02 | NA | 2.11e-08 |
| 3. B | Q07DX6 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 6.88e-05 | NA | 0.019 |
| 3. B | Q6JAN1 | Inversin | 4.35e-02 | NA | 7.53e-11 |
| 3. B | G3V8T1 | M-phase phosphoprotein 8 | 4.77e-01 | NA | 4.53e-06 |
| 3. B | Q5RJK8 | Acyl-CoA-binding domain-containing protein 6 | 1.04e-07 | NA | 3.95e-05 |
| 3. B | P46531 | Neurogenic locus notch homolog protein 1 | 5.45e-01 | NA | 0.011 |
| 3. B | Q2IBE6 | Cortactin-binding protein 2 | 8.04e-01 | NA | 1.02e-04 |
| 3. B | D3ZBM7 | E3 ubiquitin-protein ligase HACE1 | 3.61e-02 | NA | 0.004 |
| 3. B | Q4V869 | Acyl-CoA-binding domain-containing protein 6 | 3.93e-05 | NA | 3.06e-05 |
| 3. B | Q09YG9 | Cortactin-binding protein 2 | 5.78e-01 | NA | 1.43e-04 |
| 3. B | Q8HXA6 | Ankyrin repeat and SOCS box protein 15 | 5.18e-03 | NA | 9.30e-06 |
| 3. B | Q2QLA4 | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 | 5.67e-05 | NA | 0.004 |
| 3. B | Q91ZU1 | Ankyrin repeat and SOCS box protein 6 | 3.84e-05 | NA | 0.002 |
| 3. B | Q8WXD9 | Caskin-1 | 2.37e-01 | NA | 7.31e-05 |
| 3. B | Q9C6C3 | ADP-ribosylation factor GTPase-activating protein AGD2 | 4.62e-01 | NA | 0.026 |
| 3. B | Q96JP0 | Protein fem-1 homolog C | 2.13e-04 | NA | 6.15e-08 |
| 3. B | Q9FY48 | E3 ubiquitin-protein ligase KEG | 3.92e-02 | NA | 0.003 |
| 3. B | F1N6G5 | E3 ubiquitin-protein ligase HACE1 | 2.34e-01 | NA | 0.002 |
| 3. B | Q8WZ74 | Cortactin-binding protein 2 | 8.52e-01 | NA | 1.19e-04 |
| 3. B | Q8NFD2 | Ankyrin repeat and protein kinase domain-containing protein 1 | 9.20e-03 | NA | 0.018 |
| 3. B | Q9VBP3 | Poly [ADP-ribose] polymerase tankyrase | 9.01e-03 | NA | 0.031 |
| 3. B | Q9SMX5 | ADP-ribosylation factor GTPase-activating protein AGD4 | 1.90e-01 | NA | 1.65e-04 |
| 3. B | Q6DCL5 | E3 ubiquitin-protein ligase HACE1 | 3.52e-01 | NA | 0.023 |
| 3. B | Q1LZH7 | KN motif and ankyrin repeat domain-containing protein 2 | 8.72e-02 | NA | 0.024 |
| 3. B | Q9BR61 | Acyl-CoA-binding domain-containing protein 6 | 2.22e-05 | NA | 1.29e-05 |
| 3. B | Q96NW4 | Ankyrin repeat domain-containing protein 27 | 2.84e-02 | NA | 5.48e-08 |
| 3. B | P17442 | Phosphate system positive regulatory protein PHO81 | 5.42e-01 | NA | 0.022 |
| 3. B | A7E2S9 | Putative ankyrin repeat domain-containing protein 30B-like | 1.53e-04 | NA | 1.87e-05 |
| 3. B | Q8QN36 | Ankyrin repeat domain-containing protein CP77 | NA | NA | 0.034 |