Summary

P0C7A2

Homolog: Q9UHL3.
Function: Protein FAM153A.

Statistics

Total GO Annotation: 38
Unique PROST Go: 38
Unique BLAST Go: 0

Total Homologs: 42
Unique PROST Homologs: 40
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q9UHL3 (Protein FAM153A) with a FATCAT P-Value: 0.000103 and RMSD of 6.79 angstrom. The sequence alignment identity is 78.6%.
Structural alignment shown in left. Query protein P0C7A2 colored as red in alignment, homolog Q9UHL3 colored as blue. Query protein P0C7A2 is also shown in right top, homolog Q9UHL3 showed in right bottom. They are colored based on secondary structures. 

  P0C7A2 MGCAYSCCLEVCCGEDEIVYPRMPGESTVCHREREKPITYHWYHWHPGHIYPRVASMEDYDEDLVQEASSEDVLGVHMVDKDTERDIEMKRQLRRLRELH 100
  Q9UHL3 -----------------------------------------------------------------------------MVDKDTERDIEMKRQLRRLRELH 23

  P0C7A2 LYSTWKKYQEAMKTSLGVPQCERDEGSLGKPLCPPEILSETLPGSVKKRVCFPSEDHLEEFIAEHLPEASNQSLLTVAHADTGIQTNGDLEDLEEHGPGQ 200
  Q9UHL3 LYSTWKKYQEAMKTSLGVPQCERDEGSLGKPLCPPEILSETLPGSVKKRVCFPSEDHLEEFIAEHLPEASNQSLLTVAHADAGTQTNGDLEDLEEHGPGQ 123

  P0C7A2 TVSEEATEVHMMEGDPDTLAELLIRDVLQELSSYNGEEEDPEEVKTSLGVPQRGDLEDLEEHVPGQTVSEEATGVHMMQVDPATPAKSDLEDLEEHVPGQ 300
  Q9UHL3 TVSEEATEVHTMEGDPDTLAEFLIRDVLQELSSYNGEEEDPEEVKTSLGVPQRGDLEDLEEHVPGQTVSEEATGVHMMQVDPATLAKSDLEDLEEHVPEQ 223

  P0C7A2 TVSEEATGVHMMQVDPATLAKQLEDSTITGSHQQMSASPSSAPAEEATEKTKVEEEVKTRKPKKKTRKPSKKSRWNVLKCWDIFNIF 387
  Q9UHL3 TVSEEATGVHMMQVDPATLAKQLEDSTITGSHQQMSASPSSAPAEEATEKTKVEEEVKTRKPKKKTRKPSKKSRWNVLKCWDIFNIF 310

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0018149 peptide cross-linking
2. P GO:0032496 response to lipopolysaccharide
2. P GO:0030216 keratinocyte differentiation
2. P GO:0030154 cell differentiation
2. P GO:0034053 modulation by symbiont of host defense-related programmed cell death
2. P GO:0070062 extracellular exosome
2. P GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide
2. P GO:0001960 negative regulation of cytokine-mediated signaling pathway
2. P GO:0048240 sperm capacitation
2. P GO:0002020 protease binding
2. P GO:0007320 insemination
2. P GO:0044162 host cell cytoplasmic vesicle membrane
2. P GO:0008063 Toll signaling pathway
2. P GO:0019841 retinol binding
2. P GO:0031424 keratinization
2. P GO:0090281 negative regulation of calcium ion import
2. P GO:0030317 flagellated sperm motility
2. P GO:0044164 host cell cytosol
2. P GO:0039503 suppression by virus of host innate immune response
2. P GO:0045667 regulation of osteoblast differentiation
2. P GO:0005813 centrosome
2. P GO:0007088 regulation of mitotic nuclear division
2. P GO:0097228 sperm principal piece
2. P GO:0001533 cornified envelope
2. P GO:0019731 antibacterial humoral response
2. P GO:0005576 extracellular region
2. P GO:1900005 positive regulation of serine-type endopeptidase activity
2. P GO:0001669 acrosomal vesicle
2. P GO:0000226 microtubule cytoskeleton organization
2. P GO:0010224 response to UV-B
2. P GO:0019033 viral tegument
2. P GO:0050817 coagulation
2. P GO:0005615 extracellular space
2. P GO:0046760 viral budding from Golgi membrane
2. P GO:1990393 3M complex
2. P GO:0042628 mating plug formation
2. P GO:0005654 nucleoplasm
2. P GO:1901318 negative regulation of flagellated sperm motility

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q9UHL3 Protein FAM153A 1.03e-04 5.25e-20 0.0
1. PB P0C7A2 Protein FAM153B 0 9.98e-160 0.0
2. P Q8C633 Calcium-binding and spermatid-specific protein 1 8.36e-01 3.60e-03 NA
2. P Q4ZJZ1 Protease inhibitor Egf1.5b NA 2.25e-04 NA
2. P Q2GIB5 SUMOylated effector protein AmpA 2.66e-01 4.02e-06 NA
2. P A6NDB9 Paralemmin-3 2.73e-01 4.32e-04 NA
2. P Q5U7N3 Semenogelin-2 3.93e-01 3.44e-02 NA
2. P P05995 Seminal vesicle major clotting proteins 4.78e-01 8.31e-04 NA
2. P Q6IC83 Uncharacterized protein C22orf42 1.28e-01 1.76e-02 NA
2. P A0A0J9YY54 Testis-expressed protein 13D 3.17e-01 2.00e-03 NA
2. P Q12815 Tastin 1.49e-01 2.35e-03 NA
2. P P0C7A5 Semenogelin-2 4.65e-01 1.65e-05 NA
2. P Q5SRN2 Testis-expressed basic protein 1 5.18e-01 1.51e-03 NA
2. P Q24702 DVA-1 polyprotein 9.65e-01 1.76e-02 NA
2. P Q5XHC1 UPF0602 protein C4orf47 homolog 6.34e-01 1.20e-03 NA
2. P Q5U7N4 Semenogelin-2 NA 4.30e-03 NA
2. P Q02383 Semenogelin-2 4.60e-01 6.68e-06 NA
2. P O77733 Semenogelin-1 3.37e-01 1.23e-03 NA
2. P Q5U7M7 Semenogelin-2 NA 9.19e-06 NA
2. P B7W112 Aspartic and glutamic acid-rich protein 1.18e-01 4.08e-04 NA
2. P Q32L62 Hemogen 2.23e-02 1.95e-02 NA
2. P P62521 Coiled-coil domain-containing protein 8 1.09e-01 4.48e-02 NA
2. P P0CG14 Decreased expression in renal and prostate cancer protein 8.42e-01 2.31e-02 NA
2. P Q4ZJZ3 Protease inhibitor Egf1.5a NA 5.09e-03 NA
2. P Q5U7M9 Semenogelin-2 NA 2.02e-06 NA
2. P Q5U7M8 Semenogelin-2 2.48e-01 1.60e-07 NA
2. P Q02752 Acidic phosphoprotein 7.69e-02 1.76e-06 NA
2. P P0C7A4 Semenogelin-2 1.78e-01 1.65e-05 NA
2. P Q5U7N1 Semenogelin-2 3.80e-01 1.79e-05 NA
2. P P0C2X8 Cell division cycle-associated protein 3 7.08e-02 6.46e-05 NA
2. P Q6X2M3 Semenogelin-2 8.67e-02 6.83e-07 NA
2. P Q6GZQ1 Uncharacterized protein 074L NA 1.46e-03 NA
2. P Q66642 Cytoplasmic envelopment protein 3 NA 3.27e-02 NA
2. P P04279 Semenogelin-1 3.67e-01 5.11e-05 NA
2. P Q196W1 Uncharacterized protein 099R NA 5.90e-06 NA
2. P Q5U7N0 Semenogelin-2 NA 2.38e-07 NA
2. P Q9RBS0 Protein PopA1 2.31e-01 1.35e-02 NA
2. P A2TJV2 Paralemmin-3 3.08e-01 8.55e-05 NA
2. P P24709 Involucrin 1.97e-01 1.39e-03 NA
2. P Q9BXL5 Hemogen 1.19e-01 3.45e-03 NA
2. P Q08DY0 Glutamate-rich protein 5 2.39e-01 1.57e-06 NA
2. P Q9H0W5 Coiled-coil domain-containing protein 8 1.24e-01 3.28e-08 NA