Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
Q9UHL3
(Protein FAM153A) with a FATCAT P-Value: 0.000103 and RMSD of 6.79 angstrom. The sequence alignment identity is 78.6%.
Structural alignment shown in left. Query protein P0C7A2 colored as red in alignment, homolog Q9UHL3 colored as blue.
Query protein P0C7A2 is also shown in right top, homolog Q9UHL3 showed in right bottom. They are colored based on secondary structures.
P0C7A2 MGCAYSCCLEVCCGEDEIVYPRMPGESTVCHREREKPITYHWYHWHPGHIYPRVASMEDYDEDLVQEASSEDVLGVHMVDKDTERDIEMKRQLRRLRELH 100 Q9UHL3 -----------------------------------------------------------------------------MVDKDTERDIEMKRQLRRLRELH 23 P0C7A2 LYSTWKKYQEAMKTSLGVPQCERDEGSLGKPLCPPEILSETLPGSVKKRVCFPSEDHLEEFIAEHLPEASNQSLLTVAHADTGIQTNGDLEDLEEHGPGQ 200 Q9UHL3 LYSTWKKYQEAMKTSLGVPQCERDEGSLGKPLCPPEILSETLPGSVKKRVCFPSEDHLEEFIAEHLPEASNQSLLTVAHADAGTQTNGDLEDLEEHGPGQ 123 P0C7A2 TVSEEATEVHMMEGDPDTLAELLIRDVLQELSSYNGEEEDPEEVKTSLGVPQRGDLEDLEEHVPGQTVSEEATGVHMMQVDPATPAKSDLEDLEEHVPGQ 300 Q9UHL3 TVSEEATEVHTMEGDPDTLAEFLIRDVLQELSSYNGEEEDPEEVKTSLGVPQRGDLEDLEEHVPGQTVSEEATGVHMMQVDPATLAKSDLEDLEEHVPEQ 223 P0C7A2 TVSEEATGVHMMQVDPATLAKQLEDSTITGSHQQMSASPSSAPAEEATEKTKVEEEVKTRKPKKKTRKPSKKSRWNVLKCWDIFNIF 387 Q9UHL3 TVSEEATGVHMMQVDPATLAKQLEDSTITGSHQQMSASPSSAPAEEATEKTKVEEEVKTRKPKKKTRKPSKKSRWNVLKCWDIFNIF 310
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 2. P | GO:0018149 | peptide cross-linking |
| 2. P | GO:0032496 | response to lipopolysaccharide |
| 2. P | GO:0030216 | keratinocyte differentiation |
| 2. P | GO:0030154 | cell differentiation |
| 2. P | GO:0034053 | modulation by symbiont of host defense-related programmed cell death |
| 2. P | GO:0070062 | extracellular exosome |
| 2. P | GO:0061844 | antimicrobial humoral immune response mediated by antimicrobial peptide |
| 2. P | GO:0001960 | negative regulation of cytokine-mediated signaling pathway |
| 2. P | GO:0048240 | sperm capacitation |
| 2. P | GO:0002020 | protease binding |
| 2. P | GO:0007320 | insemination |
| 2. P | GO:0044162 | host cell cytoplasmic vesicle membrane |
| 2. P | GO:0008063 | Toll signaling pathway |
| 2. P | GO:0019841 | retinol binding |
| 2. P | GO:0031424 | keratinization |
| 2. P | GO:0090281 | negative regulation of calcium ion import |
| 2. P | GO:0030317 | flagellated sperm motility |
| 2. P | GO:0044164 | host cell cytosol |
| 2. P | GO:0039503 | suppression by virus of host innate immune response |
| 2. P | GO:0045667 | regulation of osteoblast differentiation |
| 2. P | GO:0005813 | centrosome |
| 2. P | GO:0007088 | regulation of mitotic nuclear division |
| 2. P | GO:0097228 | sperm principal piece |
| 2. P | GO:0001533 | cornified envelope |
| 2. P | GO:0019731 | antibacterial humoral response |
| 2. P | GO:0005576 | extracellular region |
| 2. P | GO:1900005 | positive regulation of serine-type endopeptidase activity |
| 2. P | GO:0001669 | acrosomal vesicle |
| 2. P | GO:0000226 | microtubule cytoskeleton organization |
| 2. P | GO:0010224 | response to UV-B |
| 2. P | GO:0019033 | viral tegument |
| 2. P | GO:0050817 | coagulation |
| 2. P | GO:0005615 | extracellular space |
| 2. P | GO:0046760 | viral budding from Golgi membrane |
| 2. P | GO:1990393 | 3M complex |
| 2. P | GO:0042628 | mating plug formation |
| 2. P | GO:0005654 | nucleoplasm |
| 2. P | GO:1901318 | negative regulation of flagellated sperm motility |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q9UHL3 | Protein FAM153A | 1.03e-04 | 5.25e-20 | 0.0 |
| 1. PB | P0C7A2 | Protein FAM153B | 0 | 9.98e-160 | 0.0 |
| 2. P | Q8C633 | Calcium-binding and spermatid-specific protein 1 | 8.36e-01 | 3.60e-03 | NA |
| 2. P | Q4ZJZ1 | Protease inhibitor Egf1.5b | NA | 2.25e-04 | NA |
| 2. P | Q2GIB5 | SUMOylated effector protein AmpA | 2.66e-01 | 4.02e-06 | NA |
| 2. P | A6NDB9 | Paralemmin-3 | 2.73e-01 | 4.32e-04 | NA |
| 2. P | Q5U7N3 | Semenogelin-2 | 3.93e-01 | 3.44e-02 | NA |
| 2. P | P05995 | Seminal vesicle major clotting proteins | 4.78e-01 | 8.31e-04 | NA |
| 2. P | Q6IC83 | Uncharacterized protein C22orf42 | 1.28e-01 | 1.76e-02 | NA |
| 2. P | A0A0J9YY54 | Testis-expressed protein 13D | 3.17e-01 | 2.00e-03 | NA |
| 2. P | Q12815 | Tastin | 1.49e-01 | 2.35e-03 | NA |
| 2. P | P0C7A5 | Semenogelin-2 | 4.65e-01 | 1.65e-05 | NA |
| 2. P | Q5SRN2 | Testis-expressed basic protein 1 | 5.18e-01 | 1.51e-03 | NA |
| 2. P | Q24702 | DVA-1 polyprotein | 9.65e-01 | 1.76e-02 | NA |
| 2. P | Q5XHC1 | UPF0602 protein C4orf47 homolog | 6.34e-01 | 1.20e-03 | NA |
| 2. P | Q5U7N4 | Semenogelin-2 | NA | 4.30e-03 | NA |
| 2. P | Q02383 | Semenogelin-2 | 4.60e-01 | 6.68e-06 | NA |
| 2. P | O77733 | Semenogelin-1 | 3.37e-01 | 1.23e-03 | NA |
| 2. P | Q5U7M7 | Semenogelin-2 | NA | 9.19e-06 | NA |
| 2. P | B7W112 | Aspartic and glutamic acid-rich protein | 1.18e-01 | 4.08e-04 | NA |
| 2. P | Q32L62 | Hemogen | 2.23e-02 | 1.95e-02 | NA |
| 2. P | P62521 | Coiled-coil domain-containing protein 8 | 1.09e-01 | 4.48e-02 | NA |
| 2. P | P0CG14 | Decreased expression in renal and prostate cancer protein | 8.42e-01 | 2.31e-02 | NA |
| 2. P | Q4ZJZ3 | Protease inhibitor Egf1.5a | NA | 5.09e-03 | NA |
| 2. P | Q5U7M9 | Semenogelin-2 | NA | 2.02e-06 | NA |
| 2. P | Q5U7M8 | Semenogelin-2 | 2.48e-01 | 1.60e-07 | NA |
| 2. P | Q02752 | Acidic phosphoprotein | 7.69e-02 | 1.76e-06 | NA |
| 2. P | P0C7A4 | Semenogelin-2 | 1.78e-01 | 1.65e-05 | NA |
| 2. P | Q5U7N1 | Semenogelin-2 | 3.80e-01 | 1.79e-05 | NA |
| 2. P | P0C2X8 | Cell division cycle-associated protein 3 | 7.08e-02 | 6.46e-05 | NA |
| 2. P | Q6X2M3 | Semenogelin-2 | 8.67e-02 | 6.83e-07 | NA |
| 2. P | Q6GZQ1 | Uncharacterized protein 074L | NA | 1.46e-03 | NA |
| 2. P | Q66642 | Cytoplasmic envelopment protein 3 | NA | 3.27e-02 | NA |
| 2. P | P04279 | Semenogelin-1 | 3.67e-01 | 5.11e-05 | NA |
| 2. P | Q196W1 | Uncharacterized protein 099R | NA | 5.90e-06 | NA |
| 2. P | Q5U7N0 | Semenogelin-2 | NA | 2.38e-07 | NA |
| 2. P | Q9RBS0 | Protein PopA1 | 2.31e-01 | 1.35e-02 | NA |
| 2. P | A2TJV2 | Paralemmin-3 | 3.08e-01 | 8.55e-05 | NA |
| 2. P | P24709 | Involucrin | 1.97e-01 | 1.39e-03 | NA |
| 2. P | Q9BXL5 | Hemogen | 1.19e-01 | 3.45e-03 | NA |
| 2. P | Q08DY0 | Glutamate-rich protein 5 | 2.39e-01 | 1.57e-06 | NA |
| 2. P | Q9H0W5 | Coiled-coil domain-containing protein 8 | 1.24e-01 | 3.28e-08 | NA |