Summary

P0C7I6

Homolog: Q8C963.
Function: Coiled-coil domain-containing protein 159.

Statistics

Total GO Annotation: 112
Unique PROST Go: 112
Unique BLAST Go: 0

Total Homologs: 74
Unique PROST Homologs: 72
Unique BLAST Homologs: 1

Structures and Sequence Alignment

The best structural homolog that predicted by 3. B was Q8C963 (Coiled-coil domain-containing protein 159) with a FATCAT P-Value: 3.41e-11 and RMSD of 1.80 angstrom. The sequence alignment identity is 53.2%.
Structural alignment shown in left. Query protein P0C7I6 colored as red in alignment, homolog Q8C963 colored as blue. Query protein P0C7I6 is also shown in right top, homolog Q8C963 showed in right bottom. They are colored based on secondary structures. 

  P0C7I6 ---------------------------------------------------------------------------------------------------- 0
  Q8C963 MGEHERVVCCSSDSLLAGLSRDSDDCVSHLCTPPLLAITSWAAKERSQYSPPPGEPGPSSDKALDCMTHWSRVLEPEIVNTASEQAGKSGAWEKEWDSEP 100

  P0C7I6 ------------MGE---HEQ--V--------KPLETSSSKVKAKTIVMIPDSQKLLRCELESLKSQLQAQTKAFEFLNHSVTMLEKESCLQQIKIQQLE 75
  Q8C963 QPHEGTPCSSSDVNKDHYHDQDLVKRNHCVAKKSLEPSSAKVKVKNTMIIPDSQKLLRCELESLRSQLQAQSKAFEFLNHSVTMLEKESCLQQIKIQQLE 200

  P0C7I6 EVLSPTGRQGEKEEHKWGMEQGRQELYGALTQGLQGLEKTLRDSEEMQRARTTRCLQLLAQEIRDSKKFLWEELELVREEVTFIYQKLQAQEDEISENLV 175
  Q8C963 EVLSPTSRQGEKYGRKWSTE---QELYGALAQGLQGLQKTLKEGEELQRARTTRCLQLLAREIRDSKKFLWEELELVREEVTFIYQKLQDQEDEISENLL 297

  P0C7I6 NIQKMQKTQVKCRKILTKMKQQGHETAACPETEEIP-QGASGCWKDDLQKELSDIWSAVHVLQNSIDSLTLCSGACPKASSLRGHKGHQCLSPPLPSWDS 274
  Q8C963 NIQKMQKTQVKCRKVLTKMKQQAYDS--WPEAEGVPTEG-NGCCKDDLQKELGDIWSAVHSLQSSIDCLALSMGTRPRASSLRGQKGHQCKSSQCPSWDS 394

  P0C7I6 DSDCDQDLSQPPFSKSGRSFPPA 297
  Q8C963 DSDWER-----PFSKSG-SYPPA 411

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0032509 endosome transport via multivesicular body sorting pathway
2. P GO:0034142 toll-like receptor 4 signaling pathway
2. P GO:0005770 late endosome
2. P GO:0070530 K63-linked polyubiquitin modification-dependent protein binding
2. P GO:1901970 positive regulation of mitotic sister chromatid separation
2. P GO:0008608 attachment of spindle microtubules to kinetochore
2. P GO:0051028 mRNA transport
2. P GO:0000151 ubiquitin ligase complex
2. P GO:0003382 epithelial cell morphogenesis
2. P GO:0071539 protein localization to centrosome
2. P GO:1905561 positive regulation of kinetochore assembly
2. P GO:0034501 protein localization to kinetochore
2. P GO:1990450 linear polyubiquitin binding
2. P GO:0045022 early endosome to late endosome transport
2. P GO:0030670 phagocytic vesicle membrane
2. P GO:0042809 vitamin D receptor binding
2. P GO:0070286 axonemal dynein complex assembly
2. P GO:0031625 ubiquitin protein ligase binding
2. P GO:0036158 outer dynein arm assembly
2. P GO:0003713 transcription coactivator activity
2. P GO:0003352 regulation of cilium movement
2. P GO:0031902 late endosome membrane
2. P GO:0072686 mitotic spindle
2. P GO:0035630 bone mineralization involved in bone maturation
2. P GO:0006366 transcription by RNA polymerase II
2. P GO:0008385 IkappaB kinase complex
2. P GO:0010796 regulation of multivesicular body size
2. P GO:0006974 cellular response to DNA damage stimulus
2. P GO:0007030 Golgi organization
2. P GO:0036064 ciliary basal body
2. P GO:0008017 microtubule binding
2. P GO:0005929 cilium
2. P GO:0043122 regulation of I-kappaB kinase/NF-kappaB signaling
2. P GO:0005930 axoneme
2. P GO:0042975 peroxisome proliferator activated receptor binding
2. P GO:0090268 activation of mitotic cell cycle spindle assembly checkpoint
2. P GO:0045732 positive regulation of protein catabolic process
2. P GO:0001782 B cell homeostasis
2. P GO:1901214 regulation of neuron death
2. P GO:0098535 de novo centriole assembly involved in multi-ciliated epithelial cell differentiation
2. P GO:0070676 intralumenal vesicle formation
2. P GO:0043123 positive regulation of I-kappaB kinase/NF-kappaB signaling
2. P GO:0046983 protein dimerization activity
2. P GO:1990498 mitotic spindle microtubule
2. P GO:0060294 cilium movement involved in cell motility
2. P GO:0046966 thyroid hormone receptor binding
2. P GO:0016239 positive regulation of macroautophagy
2. P GO:0051301 cell division
2. P GO:0002756 MyD88-independent toll-like receptor signaling pathway
2. P GO:0032695 negative regulation of interleukin-12 production
2. P GO:0097028 dendritic cell differentiation
2. P GO:0098536 deuterosome
2. P GO:0005136 interleukin-4 receptor binding
2. P GO:0031393 negative regulation of prostaglandin biosynthetic process
2. P GO:0005814 centriole
2. P GO:0050862 positive regulation of T cell receptor signaling pathway
2. P GO:0007098 centrosome cycle
2. P GO:0036157 outer dynein arm
2. P GO:0042976 activation of Janus kinase activity
2. P GO:0051650 establishment of vesicle localization
2. P GO:0007079 mitotic chromosome movement towards spindle pole
2. P GO:1903445 protein transport from ciliary membrane to plasma membrane
2. P GO:0051959 dynein light intermediate chain binding
2. P GO:0065003 protein-containing complex assembly
2. P GO:0034452 dynactin binding
2. P GO:1905342 positive regulation of protein localization to kinetochore
2. P GO:0000922 spindle pole
2. P GO:0070097 delta-catenin binding
2. P GO:0007250 activation of NF-kappaB-inducing kinase activity
2. P GO:0042532 negative regulation of tyrosine phosphorylation of STAT protein
2. P GO:0043231 intracellular membrane-bounded organelle
2. P GO:0043276 anoikis
2. P GO:0031267 small GTPase binding
2. P GO:0048309 endoplasmic reticulum inheritance
2. P GO:0044565 dendritic cell proliferation
2. P GO:0010696 positive regulation of mitotic spindle pole body separation
2. P GO:0060271 cilium assembly
2. P GO:1990459 transferrin receptor binding
2. P GO:0003009 skeletal muscle contraction
2. P GO:0031514 motile cilium
2. P GO:1905824 positive regulation of mitotic sister chromatid arm separation
2. P GO:0060285 cilium-dependent cell motility
2. P GO:0007288 sperm axoneme assembly
2. P GO:0055107 Golgi to secretory granule transport
2. P GO:1902423 regulation of attachment of mitotic spindle microtubules to kinetochore
2. P GO:0070847 core mediator complex
2. P GO:0005813 centrosome
2. P GO:0032815 negative regulation of natural killer cell activation
2. P GO:0044691 tooth eruption
2. P GO:0051092 positive regulation of NF-kappaB transcription factor activity
2. P GO:0032991 protein-containing complex
2. P GO:0003712 transcription coregulator activity
2. P GO:0005829 cytosol
2. P GO:0000795 synaptonemal complex
2. P GO:0005694 chromosome
2. P GO:0070652 HAUS complex
2. P GO:0043001 Golgi to plasma membrane protein transport
2. P GO:0044458 motile cilium assembly
2. P GO:0000137 Golgi cis cisterna
2. P GO:0007130 synaptonemal complex assembly
2. P GO:0008333 endosome to lysosome transport
2. P GO:1902236 negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway
2. P GO:0016592 mediator complex
2. P GO:0042177 negative regulation of protein catabolic process
2. P GO:0005912 adherens junction
2. P GO:0000801 central element
2. P GO:0045453 bone resorption
2. P GO:0051225 spindle assembly
2. P GO:0005858 axonemal dynein complex
2. P GO:0031076 embryonic camera-type eye development
2. P GO:0005654 nucleoplasm
2. P GO:0060261 positive regulation of transcription initiation from RNA polymerase II promoter

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB P0C7I6 Coiled-coil domain-containing protein 159 0 1.56e-144 0.0
2. P A6NI56 Coiled-coil domain-containing protein 154 1.76e-05 4.77e-07 NA
2. P Q4R7Y8 Basal body-orientation factor 1 6.89e-07 2.97e-05 NA
2. P P0CF95 BICD family-like cargo adapter 1 NA 9.00e-04 NA
2. P Q9CQS9 HAUS augmin-like complex subunit 2 1.11e-04 1.26e-03 NA
2. P Q5XHZ2 Synaptonemal complex central element protein 1 7.62e-09 1.56e-02 NA
2. P Q8R2X8 Golgin-45 3.26e-05 2.70e-04 NA
2. P Q5XIJ8 Dynein regulatory complex subunit 2 6.39e-07 1.04e-05 NA
2. P Q9NVX0 HAUS augmin-like complex subunit 2 4.82e-05 5.19e-03 NA
2. P A9QT41 NF-kappa-B essential modulator 2.31e-08 4.54e-03 NA
2. P Q2TA00 Coiled-coil domain-containing protein 83 6.21e-07 7.13e-07 NA
2. P C5DLA5 SWI5-dependent HO expression protein 3 2.10e-07 5.19e-06 NA
2. P Q96NA2 Rab-interacting lysosomal protein 1.62e-06 1.90e-03 NA
2. P Q08C53 Basal body-orientation factor 1 1.19e-07 4.74e-06 NA
2. P D6RF30 Golgin subfamily A member 8K 4.06e-06 1.28e-02 NA
2. P Q6FK56 Autophagy-related protein 23 1.61e-05 7.45e-03 NA
2. P Q9JJC6 RILP-like protein 1 3.71e-07 1.53e-04 NA
2. P Q8IXS2 Dynein regulatory complex subunit 2 7.43e-08 6.26e-04 NA
2. P A8JF70 Outer dynein arm protein 1 2.28e-06 2.66e-02 NA
2. P Q0IHE5 RILP-like protein 1 1.37e-07 7.18e-03 NA
2. P Q4V7B0 Cilia- and flagella-associated protein 157 9.86e-07 5.95e-04 NA
2. P Q0VFX2 Cilia- and flagella-associated protein 157 4.43e-06 1.81e-06 NA
2. P Q96KP6 TNFAIP3-interacting protein 3 1.51e-07 8.81e-07 NA
2. P Q4R7G7 Dynein regulatory complex subunit 2 2.58e-07 8.73e-04 NA
2. P Q32LK9 Synaptonemal complex central element protein 1 1.26e-06 5.45e-03 NA
2. P O88522 NF-kappa-B essential modulator 1.95e-07 5.00e-03 NA
2. P Q9NPJ6 Mediator of RNA polymerase II transcription subunit 4 1.23e-03 9.89e-03 NA
2. P A2CEM9 Coiled-coil domain-containing protein 85B 3.28e-06 5.54e-04 NA
2. P Q5T0J7 Testis-expressed protein 35 1.16e-03 6.40e-05 NA
2. P Q8NA03 Fibrous sheath-interacting protein 1 7.41e-02 7.04e-03 NA
2. P Q5RD40 5-azacytidine-induced protein 2 4.67e-07 1.53e-03 NA
2. P A2BDR7 Cilia- and flagella-associated protein 157 7.45e-08 1.05e-08 NA
2. P Q6PDY0 Coiled-coil domain-containing protein 85B 9.69e-06 2.49e-02 NA
2. P A0JMY4 Basal body-orientation factor 1 1.76e-07 4.43e-06 NA
2. P Q9D495 Synaptonemal complex central element protein 1 6.03e-06 1.23e-02 NA
2. P P0CW27 Coiled-coil domain-containing protein 166 1.05e-06 3.06e-04 NA
2. P Q3V079 Basal body-orientation factor 1 5.12e-06 2.14e-07 NA
2. P Q95K40 Coiled-coil domain-containing protein 83 1.08e-05 2.63e-07 NA
2. P D3ZUQ0 RILP-like protein 1 1.35e-07 1.69e-04 NA
2. P Q810N9 Coiled-coil domain-containing protein 172 1.34e-08 4.07e-05 NA
2. P Q5RE16 HAUS augmin-like complex subunit 2 2.03e-06 1.37e-02 NA
2. P Q8ND07 Basal body-orientation factor 1 8.55e-07 2.21e-06 NA
2. P Q17695 Spindly-like protein spdl-1 2.11e-06 2.80e-02 NA
2. P A6NNP5 Coiled-coil domain-containing protein 169 5.29e-06 3.71e-02 NA
2. P A2IDD5 Coiled-coil domain-containing protein 78 3.57e-06 4.32e-02 NA
2. P Q5EBL4 RILP-like protein 1 1.61e-07 5.95e-06 NA
2. P A0PJT0 RILP-like protein 1 4.17e-07 1.41e-05 NA
2. P Q0VFN8 Cilia- and flagella-associated protein 157 7.68e-07 1.15e-04 NA
2. P Q561Q8 Mediator of RNA polymerase II transcription subunit 4 2.30e-03 4.54e-03 NA
2. P F4IMQ0 Protein FLC EXPRESSOR 4.72e-09 2.86e-02 NA
2. P Q9CQA5 Mediator of RNA polymerase II transcription subunit 4 6.87e-04 2.38e-02 NA
2. P Q6RUT8 Coiled-coil domain-containing protein 154 3.83e-06 3.29e-04 NA
2. P Q8IWF9 Coiled-coil domain-containing protein 83 4.25e-06 3.50e-07 NA
2. P C5DUI8 SWI5-dependent HO expression protein 3 4.01e-07 4.54e-03 NA
2. P Q6TMG5 NF-kappa-B essential modulator 1.46e-07 5.10e-03 NA
2. P Q75EN7 SWI5-dependent HO expression protein 3 5.29e-07 3.27e-02 NA
2. P Q9D4V3 Coiled-coil domain-containing protein 83 2.40e-06 6.82e-05 NA
2. P Q8N0S2 Synaptonemal complex central element protein 1 2.63e-08 7.74e-03 NA
2. P A7TJJ7 SWI5-dependent HO expression protein 3 4.60e-06 1.11e-02 NA
2. P Q5JU67 Cilia- and flagella-associated protein 157 8.16e-07 5.45e-05 NA
2. P P21651 Recombination protein 107 7.09e-07 2.45e-03 NA
2. P Q2TA16 Dynein regulatory complex subunit 2 1.00e-06 1.08e-03 NA
2. P Q2YDE5 Putative coiled-coil domain-containing protein 196 1.45e-05 3.86e-03 NA
2. P Q4R7J8 Synaptonemal complex central element protein 1 1.02e-08 2.07e-04 NA
2. P Q6AYB8 Golgin-45 8.89e-06 3.03e-03 NA
2. P Q32L17 Spermatogenic leucine zipper protein 1 3.42e-06 4.21e-02 NA
2. P Q17QG3 RILP-like protein 1 6.26e-07 6.79e-04 NA
2. P Q8WXW3 Progesterone-induced-blocking factor 1 8.65e-06 1.78e-02 NA
2. P Q4R3X1 5-azacytidine-induced protein 2 2.23e-07 8.59e-03 NA
2. P A8MYB1 Transmembrane and coiled-coil domain-containing protein 5B 7.68e-09 1.30e-02 NA
2. P Q9H6S1 5-azacytidine-induced protein 2 1.95e-06 1.64e-04 NA
2. P Q6PIF2 Synaptonemal complex central element protein 2 3.47e-05 2.97e-05 NA
2. P Q5ND29 Rab-interacting lysosomal protein 1.95e-06 2.18e-04 NA
3. B Q8C963 Coiled-coil domain-containing protein 159 3.41e-11 NA 8.78e-138