Summary

P0C7W0

Homolog: B1ARI9.
Function: Proline-rich protein 29.

Statistics

Total GO Annotation: 19
Unique PROST Go: 19
Unique BLAST Go: 0

Total Homologs: 14
Unique PROST Homologs: 11
Unique BLAST Homologs: 1

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was B1ARI9 (Proline-rich protein 29) with a FATCAT P-Value: 2.28e-05 and RMSD of 2.63 angstrom. The sequence alignment identity is 64.1%.
Structural alignment shown in left. Query protein P0C7W0 colored as red in alignment, homolog B1ARI9 colored as blue. Query protein P0C7W0 is also shown in right top, homolog B1ARI9 showed in right bottom. They are colored based on secondary structures. 

  P0C7W0 MAS-GAGGSW-GRSPPQSAVPTPWVTFLQPLSWAVPPAPPQPGRVKEDLLELMMLQNAQMHQLLLSRLVAGALQPRPASPCPQVYLEVPQEEPEEEEEEM 98
  B1ARI9 MASLGS-GNWSG-VPTQSTAPMPWVTILQPFPWTVPSSQPQHNRVKEDLLELMMLQNAQMHQLLLGQLVADALNPGPEWPSPPVHTD--SHE-EQMEEEM 95

  P0C7W0 DVREKGPLVFHHHYLPYLMP-SP-GAL-LPWPAPFFPTPACQPYLQDVPRIQHC-PASREREVRAVPPPPPPSATGTVGADVPPASDYYDAESLL 189
  B1ARI9 EMQEQEPLVYHHHYLP--CPVTPLGPMSL-WPASFLPVPPHQPPWQGEPRIQHQPPASRQEEVRDVPPPPPPSATGTVGADVPPASDYYDAESLP 187

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0032418 lysosome localization
2. P GO:0030968 endoplasmic reticulum unfolded protein response
2. P GO:0016192 vesicle-mediated transport
2. P GO:0006990 positive regulation of transcription from RNA polymerase II promoter involved in unfolded protein response
2. P GO:0007186 G protein-coupled receptor signaling pathway
2. P GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
2. P GO:0000398 mRNA splicing, via spliceosome
2. P GO:0099078 BORC complex
2. P GO:0006364 rRNA processing
2. P GO:0006355 regulation of transcription, DNA-templated
2. P GO:0030308 negative regulation of cell growth
2. P GO:0010674 negative regulation of transcription from RNA polymerase II promoter involved in meiotic cell cycle
2. P GO:0030688 preribosome, small subunit precursor
2. P GO:0031225 anchored component of membrane
2. P GO:0045893 positive regulation of transcription, DNA-templated
2. P GO:0005730 nucleolus
2. P GO:0034976 response to endoplasmic reticulum stress
2. P GO:0005684 U2-type spliceosomal complex
2. P GO:0005765 lysosomal membrane

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB P0C7W0 Proline-rich protein 29 0 1.81e-155 7.06e-133
1. PB B1ARI9 Proline-rich protein 29 2.28e-05 1.17e-57 2.91e-56
2. P Q9UJW9 SERTA domain-containing protein 3 1.90e-01 9.41e-03 NA
2. P Q6DBR9 KxDL motif-containing protein 1 6.88e-02 4.66e-03 NA
2. P Q9ERC3 SERTA domain-containing protein 3 1.32e-01 4.91e-03 NA
2. P B8AN27 Guanine nucleotide-binding protein subunit gamma 1 5.24e-02 1.11e-02 NA
2. P P41546 Transcriptional activator HAC1 7.80e-02 3.99e-03 NA
2. P A1CF47 rRNA-processing protein efg1 2.97e-01 2.42e-02 NA
2. P Q75WU1 Guanine nucleotide-binding protein subunit gamma 1 6.63e-02 1.11e-02 NA
2. P P53854 Pre-mRNA-splicing factor CWC25 1.10e-01 1.22e-03 NA
2. P A6RVU0 rRNA-processing protein efg1 1.67e-01 2.54e-02 NA
2. P A7EPT0 rRNA-processing protein efg1 1.54e-01 1.20e-03 NA
2. P Q10019 Uncharacterized protein T25D10.4 1.46e-01 4.77e-07 NA
3. B P58505 Uncharacterized protein C21orf58 6.08e-02 NA 0.002