Summary

P0C843

Homolog: B2V6V1.
Function: 50S ribosomal protein L20.

Statistics

Total GO Annotation: 32
Unique PROST Go: 27
Unique BLAST Go: 5

Total Homologs: 110
Unique PROST Homologs: 105
Unique BLAST Homologs: 4

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was B2V6V1 (50S ribosomal protein L20) with a FATCAT P-Value: 0.000908 and RMSD of 0.91 angstrom. The sequence alignment identity is 22.1%.
Structural alignment shown in left. Query protein P0C843 colored as red in alignment, homolog B2V6V1 colored as blue. Query protein P0C843 is also shown in right top, homolog B2V6V1 showed in right bottom. They are colored based on secondary structures. 

  P0C843 MHLHVQPLRAKG---KRPKDTFNKMA-------HR--KR------HSVTSEFLSKVPDEVRQRYIN-LFVEKYLKVCKTEDEAVYKAKIE--KKAIYERC 79
  B2V6V1 -------MRVKGPSSKKHKKKILKLAKGYYGQKHRSYRRAKEQVMHSLNYAYRDR-KD--RKRQFRALWITR-INAAARLNGLSYSQFINGLKKSGIE-L 88

  P0C843 SRRNMYVNIAVNYLK---KLRD------QGA 101
  B2V6V1 DRK-ILADMAVNDMEAFAKLVETAKKALQAA 118

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0071468 cellular response to acidic pH
2. P GO:0043035 chromatin insulator sequence binding
2. P GO:0071819 DUBm complex
2. P GO:0042788 polysomal ribosome
2. P GO:0007420 brain development
2. P GO:0000746 conjugation
2. P GO:1905786 positive regulation of anaphase-promoting complex-dependent catabolic process
2. P GO:0005762 mitochondrial large ribosomal subunit
2. P GO:0032543 mitochondrial translation
2. P GO:0045926 negative regulation of growth
2. P GO:0045842 positive regulation of mitotic metaphase/anaphase transition
2. P GO:0072324 ascus epiplasm
2. P GO:0005680 anaphase-promoting complex
2. P GO:0051726 regulation of cell cycle
2. P GO:0031145 anaphase-promoting complex-dependent catabolic process
2. P GO:0016578 histone deubiquitination
2. P GO:0000027 ribosomal large subunit assembly
2. P GO:0003735 structural constituent of ribosome
2. P GO:0039592 suppression by virus of G2/M transition of host mitotic cell cycle
2. P GO:0005840 ribosome
2. P GO:0022625 cytosolic large ribosomal subunit
2. P GO:0070390 transcription export complex 2
2. P GO:0006412 translation
2. P GO:0019843 rRNA binding
2. P GO:0002181 cytoplasmic translation
2. P GO:0005761 mitochondrial ribosome
2. P GO:0022626 cytosolic ribosome
3. B GO:0016604 nuclear body
3. B GO:0005634 nucleus
3. B GO:0003676 nucleic acid binding
3. B GO:0005654 nucleoplasm
3. B GO:0004527 exonuclease activity

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB P0C843 Putative uncharacterized protein encoded by LINC00032 0 1.14e-129 6.56e-71
2. P Q90YT2 60S ribosomal protein L36 1.42e-02 1.32e-02 NA
2. P P11191 Anti-RecBCD protein 2 NA 2.06e-02 NA
2. P Q9ZCV0 50S ribosomal protein L20 1.23e-03 6.44e-03 NA
2. P A6LLI5 50S ribosomal protein L20 1.15e-03 2.29e-02 NA
2. P Q891T2 50S ribosomal protein L20 3.28e-03 4.05e-02 NA
2. P Q6DER2 60S ribosomal protein L36 1.57e-02 1.34e-02 NA
2. P P0A244 Uncharacterized 9.1 kDa protein in spaS 3'region 2.93e-03 1.58e-03 NA
2. P A8GP89 50S ribosomal protein L20 1.19e-03 1.00e-02 NA
2. P Q3ZC04 Ribosomal protein 63, mitochondrial 1.57e-01 7.71e-04 NA
2. P C5CE41 50S ribosomal protein L20 1.35e-03 3.26e-02 NA
2. P Q9ZDV2 Uncharacterized protein RP222 7.14e-03 1.17e-03 NA
2. P O94658 60S ribosomal protein L36-B 1.47e-02 1.06e-02 NA
2. P Q8RCT2 Protein Tlp homolog 1.57e-02 2.24e-03 NA
2. P Q64VN9 50S ribosomal protein L20 1.53e-03 2.34e-02 NA
2. P B1LI03 Regulatory protein AriR 2.97e-03 6.28e-06 NA
2. P Q7UP74 50S ribosomal protein L20 1.22e-03 5.48e-03 NA
2. P P49630 60S ribosomal protein L36 2.00e-02 2.80e-03 NA
2. P P9WJ13 Toxin Rv2653c 1.41e-02 1.28e-03 NA
2. P Q9CQF8 Ribosomal protein 63, mitochondrial 1.64e-01 2.56e-02 NA
2. P A7ZKT2 Regulatory protein AriR 2.94e-03 3.77e-05 NA
2. P A9M0D3 Probable Fe(2+)-trafficking protein 4.63e-02 6.37e-04 NA
2. P C3PP50 50S ribosomal protein L20 1.24e-03 3.06e-02 NA
2. P P39032 60S ribosomal protein L36 1.53e-02 3.81e-03 NA
2. P B1IUC4 Regulatory protein AriR 2.90e-03 3.77e-05 NA
2. P P9WEU2 60S ribosomal protein L36 9.92e-04 3.16e-04 NA
2. P Q2JI02 50S ribosomal protein L20 2.09e-03 4.75e-02 NA
2. P Q819L5 UPF0223 protein BC_3961 5.71e-04 8.87e-03 NA
2. P Q5F553 Probable Fe(2+)-trafficking protein 5.42e-02 6.37e-04 NA
2. P P13313 Uncharacterized 10.9 kDa protein in regB-denV intergenic region NA 2.09e-04 NA
2. P P75991 Probable two-component-system connector protein YcgZ 4.00e-03 3.47e-03 NA
2. P C3P6W8 UPF0223 protein BAA_4196 5.59e-04 2.17e-02 NA
2. P Q751T1 Uncharacterized protein AFR743C-A 5.43e-03 3.38e-02 NA
2. P A8GSZ8 50S ribosomal protein L20 1.18e-03 7.21e-03 NA
2. P B3DYH9 50S ribosomal protein L20 4.25e-03 3.29e-02 NA
2. P Q92H37 50S ribosomal protein L20 1.23e-03 3.06e-02 NA
2. P Q1MRV6 50S ribosomal protein L20 3.06e-03 4.12e-02 NA
2. P Q66KU4 60S ribosomal protein L36 1.45e-02 1.34e-02 NA
2. P P67615 Probable Fe(2+)-trafficking protein 5.90e-02 6.37e-04 NA
2. P P04891 Probable regulatory protein N NA 3.15e-03 NA
2. P O67086 50S ribosomal protein L20 1.07e-03 3.27e-03 NA
2. P Q8TUH5 UPF0147 protein MA_0092 3.54e-03 2.06e-02 NA
2. P B2V6V1 50S ribosomal protein L20 9.08e-04 1.34e-02 NA
2. P B4U9B9 50S ribosomal protein L20 3.51e-03 4.75e-02 NA
2. P Q3T171 60S ribosomal protein L36 1.53e-02 1.31e-02 NA
2. P B3EKG6 50S ribosomal protein L20 3.61e-03 4.58e-02 NA
2. P Q58393 Uncharacterized protein MJ0986 1.59e-02 1.45e-02 NA
2. P B6JC05 UPF0335 protein OCAR_5086/OCA5_c28780 1.56e-02 1.09e-02 NA
2. P Q92365 60S ribosomal protein L36-A 1.49e-02 4.08e-02 NA
2. P Q5RAZ9 60S ribosomal protein L36 1.20e-02 4.24e-03 NA
2. P Q9BQC6 Ribosomal protein 63, mitochondrial 4.56e-02 3.40e-03 NA
2. P Q52278 Protein KleA 1.32e-02 5.64e-03 NA
2. P P18100 Protein Vpr NA 8.15e-03 NA
2. P A9IPU1 50S ribosomal protein L20 2.72e-03 3.83e-02 NA
2. P Q8SRP1 60S ribosomal protein L36 1.32e-02 1.90e-08 NA
2. P A6L7J5 50S ribosomal protein L20 1.60e-03 4.42e-02 NA
2. P Q81MS3 UPF0223 protein BA_4171/GBAA_4171/BAS3873 5.56e-04 2.17e-02 NA
2. P Q58729 Uncharacterized protein MJ1333 1.56e-03 1.49e-03 NA
2. P Q38WQ2 UPF0358 protein LCA_1078 1.90e-03 2.49e-02 NA
2. P Q9CEJ9 50S ribosomal protein L20 2.61e-03 3.29e-02 NA
2. P Q9VI60 Enhancer of yellow 2b transcription factor 9.65e-03 1.16e-02 NA
2. P A5VKX2 50S ribosomal protein L20 1.02e-03 4.62e-02 NA
2. P Q0TIL5 Regulatory protein AriR 2.91e-03 1.81e-04 NA
2. P P75993 Probable two-component-system connector protein AriR 2.95e-03 3.77e-05 NA
2. P B2G8A7 50S ribosomal protein L20 2.78e-03 4.62e-02 NA
2. P A1AA91 Regulatory protein AriR 2.96e-03 1.81e-04 NA
2. P Q189N4 50S ribosomal protein L20 1.22e-03 8.38e-03 NA
2. P Q02X10 50S ribosomal protein L20 2.66e-03 3.29e-02 NA
2. P Q5E739 UPF0253 protein VF_0662 8.63e-03 2.17e-02 NA
2. P A7ZZ97 Regulatory protein AriR 2.94e-03 3.77e-05 NA
2. P P67616 Probable Fe(2+)-trafficking protein 4.74e-02 6.37e-04 NA
2. P Q57778 Uncharacterized protein MJ0332 3.32e-02 9.50e-06 NA
2. P A6Q693 50S ribosomal protein L20 9.92e-04 2.00e-02 NA
2. P O34605 SPbeta prophage-derived uncharacterized protein YopM 5.65e-03 1.53e-02 NA
2. P Q8AAN9 50S ribosomal protein L20 1.48e-03 3.09e-02 NA
2. P Q9Y3U8 60S ribosomal protein L36 1.60e-02 4.24e-03 NA
2. P B2KB85 50S ribosomal protein L20 1.07e-03 3.29e-02 NA
2. P Q68WD0 50S ribosomal protein L20 1.25e-03 5.80e-03 NA
2. P Q24F59 60S ribosomal protein L36 5.12e-03 1.08e-02 NA
2. P O42659 Anaphase-promoting complex subunit 14 2.18e-02 8.46e-03 NA
2. P Q8FI39 Regulatory protein AriR 2.91e-03 1.81e-04 NA
2. P Q3STZ0 UPF0335 protein Nwi_0989 1.49e-02 4.67e-02 NA
2. P Q6Q415 60S ribosomal protein L36 1.54e-02 1.76e-02 NA
2. P A2RMR1 50S ribosomal protein L20 2.59e-03 3.29e-02 NA
2. P B0BUJ0 50S ribosomal protein L20 1.25e-03 7.21e-03 NA
2. P Q8UW19 60S ribosomal protein L36 1.51e-02 1.02e-02 NA
2. P C4K1L0 50S ribosomal protein L20 1.20e-03 1.31e-02 NA
2. P Q58552 Uncharacterized protein MJ1152 1.32e-02 1.31e-02 NA
2. P A2ST72 UPF0147 protein Mlab_1361 1.92e-03 1.83e-02 NA
2. P B3CLK2 50S ribosomal protein L20 3.52e-03 1.39e-02 NA
2. P Q5LZU9 UPF0223 protein str0998 1.84e-03 5.64e-03 NA
2. P Q02855 Elongation factor Ts, chloroplastic (Fragment) 4.66e-03 1.25e-02 NA
2. P B7H6U8 UPF0223 protein BCB4264_A4064 6.26e-04 3.44e-02 NA
2. P C1EPX5 UPF0223 protein BCA_4066 5.76e-04 3.54e-02 NA
2. P B1XA53 Regulatory protein AriR 2.92e-03 3.77e-05 NA
2. P A9H170 50S ribosomal protein L20 1.49e-03 4.12e-02 NA
2. P P9WJ12 Toxin MT2730 7.20e-03 1.28e-03 NA
2. P Q5FUA0 50S ribosomal protein L20 1.36e-03 1.65e-02 NA
2. P P0A243 Uncharacterized 9.1 kDa protein in spaS 3'region 3.03e-03 1.58e-03 NA
2. P P55420 Probable conjugal transfer protein TraD 5.47e-03 3.35e-02 NA
2. P B7JKT5 UPF0223 protein BCAH820_3976 5.62e-04 2.17e-02 NA
2. P Q73KR3 50S ribosomal protein L20 1.07e-02 4.27e-02 NA
2. P A1KW99 Probable Fe(2+)-trafficking protein 2.50e-02 6.37e-04 NA
2. P C3LI27 UPF0223 protein BAMEG_4214 5.68e-04 2.17e-02 NA
2. P Q5M4F9 UPF0223 protein stu0998 1.88e-03 5.64e-03 NA
2. P Q5LEQ3 50S ribosomal protein L20 1.42e-03 2.34e-02 NA
3. B P48778 Exonuclease GOR 1.01e-02 NA 1.40e-07
3. B Q8N1G1 RNA exonuclease 1 homolog 1.75e-01 NA 3.23e-16
3. B Q7TT28 RNA exonuclease 1 homolog 3.01e-01 NA 1.43e-16
3. B Q8IX06 Putative exonuclease GOR 1.00e-02 NA 1.68e-07