Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 2. P was
Q71F78
(Putative lung carcinoma-associated protein 10) with a FATCAT P-Value: 0.0243 and RMSD of 2.93 angstrom. The sequence alignment identity is 26.7%.
Structural alignment shown in left. Query protein P0C879 colored as red in alignment, homolog Q71F78 colored as blue.
Query protein P0C879 is also shown in right top, homolog Q71F78 showed in right bottom. They are colored based on secondary structures.
P0C879 -----MYN-P-WQVGASLAPARAGPRPFPTPRAR---PPDCSGGHA----PSGFPA-LGL-RTAQRPRPFSSSPR----SA-----SGR---LRGPRPVA 72 Q71F78 MSSCPVHDCPSWD-PERLEPVETGSR--GALRLRGGAPGSAAGFRASIWGPAGYPSPVGLGHPASLPRP-AYSPRCPEPDARHGWGSGSNAGYRGPDRAG 96 P0C879 RGPA-------HSSSPTGLPAYLPPAAALDSQTS-A---------PTV-----SPVTRPRVVARGKT--PRVSLAGLETLSSLLHQQQLFD 139 Q71F78 RTPCPAQDREGRSSSP--VP---PP--RLKAMTSQARKQNGGALIDTVDWTREAPDSDP-VMSMQKTQKPQTTV-GQ-------------- 164
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 3. B | GO:1902186 | obsolete regulation of viral release from host cell |
| 3. B | GO:1990830 | cellular response to leukemia inhibitory factor |
| 3. B | GO:0030433 | ubiquitin-dependent ERAD pathway |
| 3. B | GO:0046597 | negative regulation of viral entry into host cell |
| 3. B | GO:0010494 | cytoplasmic stress granule |
| 3. B | GO:0061630 | ubiquitin protein ligase activity |
| 3. B | GO:0051092 | positive regulation of NF-kappaB transcription factor activity |
| 3. B | GO:0039552 | RIG-I binding |
| 3. B | GO:1902187 | |
| 3. B | GO:0033280 | response to vitamin D |
| 3. B | GO:0006511 | ubiquitin-dependent protein catabolic process |
| 3. B | GO:0016604 | nuclear body |
| 3. B | GO:0032880 | regulation of protein localization |
| 3. B | GO:0003713 | transcription coactivator activity |
| 3. B | GO:0046596 | regulation of viral entry into host cell |
| 3. B | GO:0016874 | ligase activity |
| 3. B | GO:0043627 | response to estrogen |
| 3. B | GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB signaling |
| 3. B | GO:0051607 | defense response to virus |
| 3. B | GO:0006513 | protein monoubiquitination |
| 3. B | GO:0051091 | positive regulation of DNA-binding transcription factor activity |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | P0C879 | Putative uncharacterized protein FLJ43185 | 0 | 6.56e-141 | 9.73e-92 |
| 2. P | Q6ZRZ4 | Uncharacterized protein C9orf47 | 1.87e-02 | 8.07e-03 | NA |
| 2. P | P0C864 | Putative uncharacterized protein DANCR | 3.89e-02 | 1.04e-04 | NA |
| 2. P | P11300 | Probable protein E3 | NA | 2.27e-02 | NA |
| 2. P | Q8N7H1 | Putative uncharacterized protein encoded by LINC01465 | 2.78e-02 | 1.29e-04 | NA |
| 2. P | P59021 | Down syndrome critical region protein 9 | 1.60e-01 | 2.11e-03 | NA |
| 2. P | Q8N9T2 | Putative uncharacterized protein CXorf42 | 3.78e-02 | 6.62e-03 | NA |
| 2. P | Q6ZP68 | Putative protein ATP11AUN | 3.31e-01 | 3.79e-03 | NA |
| 2. P | Q71F78 | Putative lung carcinoma-associated protein 10 | 2.43e-02 | 3.53e-07 | NA |
| 2. P | Q95K60 | Putative uncharacterized protein FBXL19-AS1 homolog | 9.19e-01 | 1.38e-02 | NA |
| 2. P | Q5T4H9 | Putative uncharacterized protein encoded by MIR1915-HG | 4.28e-02 | 1.70e-02 | NA |
| 2. P | A0A1B0GUV1 | Uncharacterized protein C17orf114 | 1.06e-01 | 7.19e-04 | NA |
| 2. P | Q5T036 | Uncharacterized protein FAM120AOS | 1.43e-01 | 1.79e-02 | NA |
| 3. B | Q61510 | E3 ubiquitin/ISG15 ligase TRIM25 | 5.27e-01 | NA | 0.006 |