Summary

P0CF75

Homolog: Q6P2I7.
Function: Endogenous Bornavirus-like nucleoprotein 2.

Statistics

Total GO Annotation: 32
Unique PROST Go: 23
Unique BLAST Go: 0

Total Homologs: 34
Unique PROST Homologs: 30
Unique BLAST Homologs: 1

Structures and Sequence Alignment

The best structural homolog that predicted by 3. B was Q6P2I7 (Endogenous Bornavirus-like nucleoprotein 2) with a FATCAT P-Value: 1.76e-12 and RMSD of 1.87 angstrom. The sequence alignment identity is 39.5%.
Structural alignment shown in left. Query protein P0CF75 colored as red in alignment, homolog Q6P2I7 colored as blue. Query protein P0CF75 is also shown in right top, homolog Q6P2I7 showed in right bottom. They are colored based on secondary structures. 

  P0CF75 -----------------------------------------------MSRPRNNPQTSSPQDSTKDGSSFHYFQGRFELSGKSRQYPADALEPQPGIGDV 53
  Q6P2I7 MGYFLKLYAYVNSHSLFVWVCDRSYKRSFRPMILNKIKELSRNQFSTMSHLRKDSQPSSPGDDAMDRSGLPDLQGRFELSGKNRQYPLDALEPQPSIGDI 100

  P0CF75 KVIEKATKSMLDPAQRSHFYLVTPSLVFLCFIFDGLHKALLSVGVSKRSNIVIGNENKETGTLYASKFEDVLPTFTALEMSSILRHCCD-LIGIAAGSSD 152
  Q6P2I7 KDIKKAAKSMLDPAHKSHFHPVTPSLVFLCFIFDGLHQALLSVGVSKRSNTVVGNENEERGTPYASRFKD-MPNFIALEKSSVLRHCCDLLIGIAAGSSD 199

  P0CF75 PICTNSLQVQRQFKAMMISIGRPL-HSESADLLISYNAGPAIDWINSRPWVGGLMFTFLFGEFESPACELLDQVKVVASKAQMMTYYTVRMFLDQCVDGS 251
  Q6P2I7 KICTSSLQVQRRFKAMMASIGR-LSHGESADLLISCNAESAIGWISSRPWVGELMFTLLFGDFESP----LHKLR----KSS------------------ 272

  P0CF75 TALPAVVLEIPVFEQKKPLAKKVLGDFFEFGGVLRHPVIGVLSPQMFPNLATAANYWAKRRNSTFSGFEALDIIPGSTITFPVLQMASAQKISRGSDMDP 351
  Q6P2I7 ---------------------------------------------------------------------------------------------------- 272

  P0CF75 YTLNILRGYGISGFE 366
  Q6P2I7 --------------- 272

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0042025 host cell nucleus
1. PB GO:0019055 modification by virus of host cell cycle regulation
1. PB GO:0019029 helical viral capsid
1. PB GO:0046718 viral entry into host cell
1. PB GO:0039592 suppression by virus of G2/M transition of host mitotic cell cycle
1. PB GO:0039644 suppression by virus of host NF-kappaB cascade
1. PB GO:0030430 host cell cytoplasm
1. PB GO:0019013 viral nucleocapsid
1. PB GO:0075732 viral penetration into host nucleus
2. P GO:0019046 release from viral latency
2. P GO:0033645 host cell endomembrane system
2. P GO:0016020 membrane
2. P GO:0019031 viral envelope
2. P GO:0044201 host cell nuclear inner membrane
2. P GO:0039540 suppression by virus of host viral-induced cytoplasmic pattern recognition receptor signaling pathway via inhibition of host RIG-I activity
2. P GO:0004482 mRNA (guanine-N7-)-methyltransferase activity
2. P GO:0009307 DNA restriction-modification system
2. P GO:0019068 virion assembly
2. P GO:0039702 viral budding via host ESCRT complex
2. P GO:0020002 host cell plasma membrane
2. P GO:0039703 RNA replication
2. P GO:0009036 type II site-specific deoxyribonuclease activity
2. P GO:0006353 DNA-templated transcription, termination
2. P GO:0019033 viral tegument
2. P GO:0019083 viral transcription
2. P GO:0003723 RNA binding
2. P GO:0019028 viral capsid
2. P GO:0039660 structural constituent of virion
2. P GO:0044423 virion component
2. P GO:0044177 host cell Golgi apparatus
2. P GO:0019069 viral capsid assembly
2. P GO:0046765 viral budding from nuclear membrane

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB P0CF75 Endogenous Bornavirus-like nucleoprotein 1 0 3.08e-135 0.0
1. PB P0C797 Nucleoprotein NA 4.16e-03 1.44e-81
1. PB P0C796 Nucleoprotein NA 6.38e-03 3.21e-82
2. P P04881 Nucleoprotein NA 4.23e-02 NA
2. P P38780 Uncharacterized protein YHR054C 7.65e-02 5.38e-03 NA
2. P P16594 Suppressor of RNA-mediated gene silencing NA 1.53e-02 NA
2. P Q4VPH8 Uncharacterized protein VP7-1 NA 3.66e-06 NA
2. P Q77E03 Nucleoprotein NA 3.12e-02 NA
2. P P52349 Triplex capsid protein 1 NA 2.19e-02 NA
2. P P20980 mRNA-capping enzyme regulatory subunit NA 1.37e-02 NA
2. P P44999 Probable type-2 restriction enzyme HindVP 5.20e-01 3.24e-05 NA
2. P Q01051 Triplex capsid protein 1 NA 6.98e-04 NA
2. P Q01427 Matrix protein NA 1.23e-03 NA
2. P P09301 Cytoplasmic envelopment protein 1 NA 4.42e-02 NA
2. P Q8B0H9 Nucleoprotein NA 3.60e-02 NA
2. P P22046 Matrix protein NA 4.80e-03 NA
2. P Q5K2K7 Nucleoprotein NA 8.44e-04 NA
2. P Q10082 Uncharacterized protein C11D3.03c 9.39e-01 2.70e-02 NA
2. P P0DSQ5 mRNA-capping enzyme regulatory subunit NA 1.41e-02 NA
2. P P0DSQ6 mRNA-capping enzyme regulatory subunit NA 1.41e-02 NA
2. P P03521 Nucleoprotein NA 3.12e-02 NA
2. P Q2HR83 Protein ORF49 NA 2.85e-02 NA
2. P F5HAI6 Cytoplasmic envelopment protein 1 NA 2.03e-03 NA
2. P P36355 Matrix protein NA 2.57e-03 NA
2. P Q66651 Uncharacterized gene 49 protein NA 2.17e-02 NA
2. P Q88266 Matrix protein NA 5.08e-03 NA
2. P P21699 Non-structural protein NS-S NA 2.15e-05 NA
2. P P52361 Nuclear egress protein 1 NA 4.08e-02 NA
2. P O57215 mRNA-capping enzyme regulatory subunit NA 4.31e-02 NA
2. P Q6E0W8 Matrix protein NA 2.85e-02 NA
2. P P52548 Protein U52 NA 9.74e-03 NA
2. P P22119 Probable non-structural 41.0 kDa protein NA 6.56e-03 NA
2. P Q88428 Matrix protein NA 1.26e-02 NA
3. B Q6P2I7 Endogenous Bornavirus-like nucleoprotein 2 1.76e-12 NA 2.27e-108