Summary

P0CF97

Homolog: Q49AG3.
Function: Zinc finger BED domain-containing protein 5.

Statistics

Total GO Annotation: 42
Unique PROST Go: 26
Unique BLAST Go: 7

Total Homologs: 40
Unique PROST Homologs: 24
Unique BLAST Homologs: 6

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q49AG3 (Zinc finger BED domain-containing protein 5) with a FATCAT P-Value: 0.0 and RMSD of 2.54 angstrom. The sequence alignment identity is 32.8%.
Structural alignment shown in left. Query protein P0CF97 colored as red in alignment, homolog Q49AG3 colored as blue. Query protein P0CF97 is also shown in right top, homolog Q49AG3 showed in right bottom. They are colored based on secondary structures. 

  P0CF97 -----------------------------------MDHFFIKRKRNSEVKY-TEA-C----S-SSSVESGIVNS-D-----NIEKNTDSNLQTSTSFEPH 52
  Q49AG3 MIAPLLCILSYNFNTFAILNVYSKLTMFCTTNSLPMD-LLLK---QGSLKQEVESFCYQIVSESNDQKVGILQSEDKQLQPSVSKKSEGEL-SRVKFISN 95

  P0CF97 FKK----KKVSARRYNEDYLKYGFIKCEKPFEN-DRP--QCVICNNILANESLKPSKLKRHLETQHAELIDKPLEYFQRKKKDI------KLSTQFLSCS 139
  Q49AG3 SNKITFSKKPKRRKYDESYLSFGFTY----FGNRDAPHAQCVLCKKILSNSSLAPSKLRRHLETKHAAYKDKDISFF---KQHLDSPENNKPPTPKI-VN 187

  P0CF97 TAVSEKALLSSYLVAYRVAKEKIANTAAEKIILPACL-DMVRTIFDD---KSADKLKTIPNDNTVSLRICTIAEHLETMLITRLQ--SGIDFAIQLDEST 233
  Q49AG3 TD-NESATEASYNVSYHIALSGEAHTIGELLIKP-CAKDVVMRMFDEQYSKKIDAVQ-LSN-STVARRIKDLAADIEEELVCRLKICDG--FSLQLDESA 281

  P0CF97 DIGSCTTLLVYVRYAWQDDFLED-FLCFLNLTSHLSGLDIFTELERRIVGQYKLNWKNCKGITSDGTATMTGKHSR---VIKKLL-EVTNNGAVWNHCFI 328
  Q49AG3 DVSGLAVLLVFVRYRFNKSIEEDLLLC-ESLQSNATGEEIFNCI-NSFMQKHEIEWEKCVDVCSDASRAVDGKIAEAVTLIKYVAPESTS-----SHCLL 374

  P0CF97 HREGLASREIPQNLMEVLKNAVKVVNFIKGSSLNSRLLETFCSEIGTNHTHLLYHTKIRWLSQGKILSRVYELRNEIHFFLIEKKSHLASIFEDDTWVTK 428
  Q49AG3 YRHALAVKIMPTSLKNVLDQAVQIINYIKARPHQSRLLKILCEEMGAQHTALLLNTEVRWLSRGKVLVRLFELRRELLVFM-DSAFRLSDCLTNSSWLLR 473

  P0CF97 LAYLTDIFSILNELSLKLQGKNSDVFQHVERIQG-FRKTLLLWQVRLKSNRPSYYMFPR---FLQHIEENIINENILKEIKLEILLHLTSLSQTFNHFFP 524
  Q49AG3 LAYLADIFTKLNEVNLSMQGKNVTVFTVFDKMSSLLRK-LEFWASSVE--EENFDCFPTLSDFLTE-----INSTVDKDICSAIVQHLRGLRATLLKYFP 565

  P0CF97 EEKFETLRENSWVKDPFAFR-HPESIIELNLVPEEENELLQLSSSYTLKNDYETLSLSAFWMKVKEDFPLLSRKSVLLLLPFTTTSLCELGFSILTQLKT 623
  Q49AG3 ----VTNDNNAWVRNPFTVTVKPAS-----LVARDYESLIDLTSDSQVKQNFSELSLNDFWSSLIQEYPSIARRAVRVLLPFATMHLCETGFSYYAATKT 656

  P0CF97 KERNGLNCAAVMRVALSSCVPDWNELMNR--QAHPS- 657
  Q49AG3 KYRKRLDAAPHMRIRLSNITPNIKRICDKKTQKHCSH 693

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
1. PB GO:0098554 cytoplasmic side of endoplasmic reticulum membrane
1. PB GO:0045787 positive regulation of cell cycle
1. PB GO:0005634 nucleus
1. PB GO:0032868 response to insulin
1. PB GO:0045725 positive regulation of glycogen biosynthetic process
1. PB GO:2000467 positive regulation of glycogen (starch) synthase activity
1. PB GO:0015074 DNA integration
1. PB GO:0003677 DNA binding
2. P GO:0006624 vacuolar protein processing
2. P GO:0061665 SUMO ligase activity
2. P GO:0000976 transcription cis-regulatory region binding
2. P GO:0007039 protein catabolic process in the vacuole
2. P GO:0060548 negative regulation of cell death
2. P GO:0007033 vacuole organization
2. P GO:0019789 SUMO transferase activity
2. P GO:0006357 regulation of transcription by RNA polymerase II
2. P GO:0044828 negative regulation by host of viral genome replication
2. P GO:0005773 vacuole
2. P GO:1990466 protein autosumoylation
2. P GO:0006313 transposition, DNA-mediated
2. P GO:0003309 type B pancreatic cell differentiation
2. P GO:0051148 negative regulation of muscle cell differentiation
2. P GO:0046872 metal ion binding
2. P GO:0032196 transposition
2. P GO:0003693 P-element binding
2. P GO:0001835 blastocyst hatching
2. P GO:0009791 post-embryonic development
2. P GO:0004803 transposase activity
2. P GO:0016925 protein sumoylation
2. P GO:0061178 regulation of insulin secretion involved in cellular response to glucose stimulus
2. P GO:0016740 transferase activity
2. P GO:0000785 chromatin
2. P GO:0046983 protein dimerization activity
2. P GO:0006310 DNA recombination
3. B GO:0007275 multicellular organism development
3. B GO:0022604 regulation of cell morphogenesis
3. B GO:0007010 cytoskeleton organization
3. B GO:0050679 positive regulation of epithelial cell proliferation
3. B GO:0042802 identical protein binding
3. B GO:0014883 transition between fast and slow fiber
3. B GO:0005654 nucleoplasm

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q8IZ13 Protein ZBED8 0.00e+00 4.33e-56 1.52e-100
1. PB Q7L775 EPM2A-interacting protein 1 2.07e-13 8.29e-39 1.16e-22
1. PB A4Z944 Zinc finger BED domain-containing protein 5 0.00e+00 3.03e-54 3.12e-110
1. PB Q8VEH5 EPM2A-interacting protein 1 2.10e-12 3.90e-39 5.86e-23
1. PB A4Z945 Protein ZBED8 0.00e+00 1.43e-59 3.40e-100
1. PB Q4R6P1 Protein FAM200A 0.00e+00 1.13e-35 0.0
1. PB Q49AG3 Zinc finger BED domain-containing protein 5 0.00e+00 8.22e-55 1.66e-109
1. PB Q8TCP9 Protein FAM200A 0.00e+00 3.52e-35 0.0
1. PB A4Z943 Zinc finger BED domain-containing protein 5 0.00e+00 2.56e-54 1.08e-108
1. PB P0CF97 Protein FAM200B 0 1.09e-145 0.0
2. P P08770 Putative AC transposase 3.09e-07 8.77e-24 NA
2. P Q6AVI0 Zinc finger BED domain-containing protein RICESLEEPER 2 9.90e-06 9.13e-24 NA
2. P Q05934 Vacuolar import and degradation protein 22 5.56e-05 2.07e-09 NA
2. P P03010 Putative AC9 transposase 1.53e-06 1.81e-10 NA
2. P Q7M3K2 Transposable element P transposase 5.94e-02 1.73e-09 NA
2. P O60290 Zinc finger protein 862 4.82e-07 2.47e-04 NA
2. P P53246 Late endosome and vacuole interface protein 11 1.21e-04 1.46e-16 NA
2. P Q0JMB2 Zinc finger BED domain-containing protein RICESLEEPER 4 2.31e-05 1.32e-24 NA
2. P O43422 52 kDa repressor of the inhibitor of the protein kinase 8.46e-08 4.05e-28 NA
2. P Q75HY5 Zinc finger BED domain-containing protein RICESLEEPER 3 5.05e-05 1.53e-16 NA
2. P Q9H5L6 DNA transposase THAP9 1.55e-02 2.32e-04 NA
2. P Q00128 Uncharacterized protein ORF68 NA 5.09e-04 NA
2. P P34418 Zinc finger BED domain-containing protein 39 1.35e-05 3.24e-04 NA
2. P Q9CUX1 52 kDa repressor of the inhibitor of the protein kinase 6.76e-08 4.89e-28 NA
2. P P12258 Transposable element Hobo transposase 1.65e-07 8.65e-29 NA
2. P B9FJG3 Zinc finger BED domain-containing protein RICESLEEPER 1 1.73e-04 9.07e-25 NA
2. P P25203 Uncharacterized 59.1 kDa protein in rpoA3 5'region 2.31e-02 1.31e-02 NA
2. P P34601 Uncharacterized protein ZK1098.2 4.43e-07 9.48e-32 NA
2. P Q9M2N5 Zinc finger BED domain-containing protein DAYSLEEPER 9.72e-06 7.03e-22 NA
2. P P86452 Zinc finger BED domain-containing protein 6 2.71e-06 1.47e-06 NA
2. P A0A1B0GUU1 Transmembrane protein C17orf113 2.80e-08 6.21e-32 NA
2. P O96006 E3 SUMO-protein ligase ZBED1 5.73e-07 4.33e-21 NA
2. P Q9HCI6 E3 SUMO-protein ligase KIAA1586 1.08e-08 4.72e-38 NA
2. P D2EAC2 Zinc finger BED domain-containing protein 6 3.54e-07 5.03e-07 NA
3. B A4IFA3 General transcription factor II-I repeat domain-containing protein 2 2.32e-07 NA 9.42e-33
3. B Q86UP8 General transcription factor II-I repeat domain-containing protein 2A 2.21e-08 NA 1.01e-31
3. B O95789 Zinc finger MYM-type protein 6 2.13e-14 NA 3.64e-126
3. B Q6EKJ0 General transcription factor II-I repeat domain-containing protein 2B 2.61e-07 NA 2.72e-32
3. B Q6R2W3 SCAN domain-containing protein 3 0.00e+00 NA 3.09e-127
3. B Q99NI3 General transcription factor II-I repeat domain-containing protein 2 2.23e-06 NA 2.67e-30