Summary

P0CH98

Homolog: Q4KMX7.
Function: Protein FAM106A.

Statistics

Total GO Annotation: 6
Unique PROST Go: 6
Unique BLAST Go: 0

Total Homologs: 12
Unique PROST Homologs: 10
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q4KMX7 (Protein FAM106A) with a FATCAT P-Value: 0.00996 and RMSD of 4.39 angstrom. The sequence alignment identity is 98.8%.
Structural alignment shown in left. Query protein P0CH98 colored as red in alignment, homolog Q4KMX7 colored as blue. Query protein P0CH98 is also shown in right top, homolog Q4KMX7 showed in right bottom. They are colored based on secondary structures. 

  P0CH98 MLPSTMFLVHLPLSTNRLHCLRNTSLESCLCSFVHLNHPLHISDPVILISLHEAVRFSFAFSFPRGTLSIAYCLMSSVSTSSEAIMSTELLANYCHSSLH 100
  Q4KMX7 MLPSTMFLVHLPLSTNRLHCLRNTSLESYLCSFVHLNHPLHISDRVILISLHEAVRFSFAFSFPRGTLSIAYCLMSSVSTSSEAIMSTELLANYCHSSLH 100

  P0CH98 VCICISSFPNETGNHDSFPGAVVSISDQPTDQCKLAAKELPLRNLLECRFFDCMGEEDLINLGVIGTER 169
  Q4KMX7 VCICISSFPNETGNHDSFPGAVVSISDQPTDQCKLAAKELPLRNLLECRFFDCMGEEDLINLGVIGTER 169

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0042025 host cell nucleus
2. P GO:0019079 viral genome replication
2. P GO:0016021 integral component of membrane
2. P GO:0039652 induction by virus of host NF-kappaB cascade
2. P GO:0033650 host cell mitochondrion
2. P GO:0039592 suppression by virus of G2/M transition of host mitotic cell cycle

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q4KMX7 Protein FAM106A 9.96e-03 6.18e-50 3.26e-118
1. PB P0CH98 Protein FAM106C 0 7.39e-158 6.26e-121
2. P P0C8Q9 Uncharacterized protein At5g19025 6.53e-01 3.30e-02 NA
2. P Q9PXA2 Protein X NA 7.49e-04 NA
2. P Q6ZTC4 Putative uncharacterized protein FLJ44790 8.06e-01 5.45e-03 NA
2. P P53245 Putative uncharacterized protein YGR069W 5.04e-01 7.08e-03 NA
2. P P53087 Putative uncharacterized protein YGL214W 7.14e-01 6.34e-03 NA
2. P P53071 Uncharacterized protein YGL235W 6.30e-01 9.05e-06 NA
2. P P0C6G1 Protein AC4 NA 1.21e-02 NA
2. P Q02659 Putative uncharacterized protein YPL025C 4.79e-01 3.00e-02 NA
2. P P03124 Probable protein E4 NA 4.59e-03 NA
2. P P0CV31 Secreted RxLR effector protein 86 3.01e-01 2.27e-03 NA