Summary

P0CL80

Homolog: O76087.
Function: G antigen 7.

Statistics

Total GO Annotation: 2
Unique PROST Go: 0
Unique BLAST Go: 2

Total Homologs: 24
Unique PROST Homologs: 0
Unique BLAST Homologs: 4

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was O76087 (G antigen 7) with a FATCAT P-Value: 0.0 and RMSD of 1.88 angstrom. The sequence alignment identity is 100.0%.
Structural alignment shown in left. Query protein P0CL80 colored as red in alignment, homolog O76087 colored as blue. Query protein P0CL80 is also shown in right top, homolog O76087 showed in right bottom. They are colored based on secondary structures. 

  P0CL80 MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPP 100
  O76087 MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPP 100

  P0CL80 NPEEVKTPEEGEKQSQC 117
  O76087 NPEEVKTPEEGEKQSQC 117

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
3. B GO:0004222 metalloendopeptidase activity
3. B GO:0005618 cell wall

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q8WWM1 X antigen family member 5 1.57e-03 2.48e-08 1.15e-06
1. PB A6NGK3 G antigen 10 5.86e-12 7.45e-44 1.06e-64
1. PB A6NDE8 G antigen 12H 4.20e-10 3.81e-83 4.56e-77
1. PB P0CL82 G antigen 12I 8.07e-12 6.22e-156 6.96e-79
1. PB Q13069 G antigen 5 1.40e-13 3.36e-111 4.98e-77
1. PB Q96GT9 X antigen family member 2 1.72e-03 1.60e-03 3.49e-17
1. PB Q4V326 G antigen 2E 2.75e-11 1.10e-72 9.41e-74
1. PB Q8WTP9 X antigen family member 3 3.38e-03 3.68e-11 6.09e-13
1. PB Q13070 G antigen 6 2.03e-09 5.96e-98 1.90e-76
1. PB P0CL80 G antigen 12F 0 6.22e-156 6.96e-79
1. PB O76087 G antigen 7 0.00e+00 6.22e-156 6.96e-79
1. PB A6NER3 G antigen 12J 7.45e-08 1.52e-73 8.45e-76
1. PB P0DSO3 G antigen 4 1.29e-10 7.83e-116 1.39e-77
1. PB Q6NT46 G antigen 2A 3.12e-08 6.87e-65 1.13e-73
1. PB P0DTW1 G antigen 1 2.30e-11 6.04e-106 1.28e-76
1. PB Q4V321 G antigen 13 3.42e-10 2.75e-105 4.56e-77
1. PB P0CL81 G antigen 12G 4.97e-10 6.22e-156 6.96e-79
1. PB Q13066 G antigen 2B/2C 9.78e-10 1.47e-71 4.26e-74
1. PB A1L429 G antigen 12B/C/D/E 6.97e-14 2.76e-98 1.68e-77
1. PB Q9UEU5 G antigen 2D 5.46e-09 6.41e-69 7.55e-73
3. B Q9L7Q2 Zinc metalloprotease ZmpB 9.97e-01 NA 0.004
3. B Q8DQN5 Zinc metalloprotease ZmpB 9.98e-01 NA 0.020
3. B O75459 P antigen family member 1 2.34e-03 NA 3.49e-15
3. B Q5JRK9 Putative G antigen family E member 3 4.52e-02 NA 0.035