Summary

P0CW27

Homolog: F4IMQ0.
Function: Protein FLC EXPRESSOR.

Statistics

Total GO Annotation: 266
Unique PROST Go: 264
Unique BLAST Go: 0

Total Homologs: 232
Unique PROST Homologs: 230
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was F4IMQ0 (Protein FLC EXPRESSOR) with a FATCAT P-Value: 9.33e-10 and RMSD of 3.43 angstrom. The sequence alignment identity is 18.3%.
Structural alignment shown in left. Query protein P0CW27 colored as red in alignment, homolog F4IMQ0 colored as blue. Query protein P0CW27 is also shown in right top, homolog F4IMQ0 showed in right bottom. They are colored based on secondary structures. 

  P0CW27 MAPKKKRGPSAGSQPGGAAAAGAEQPLSERAQYLQREHALLSEQLDTCEESVDQVLRENAFLDREALRLREENRLYASYV--SARAQRCAKAIVRLDE-- 96
  F4IMQ0 -----------------------------------------------------MAGRDR-YIPSSAVSTSSSSRLLESQLIESDR-NR-ARSVI-LEDRI 43

  P0CW27 --QNRVDLAQI--HWQRAELASLYH-GREDGV----R--AQLLEMEARA-AQMAQQVQELQPYK-VLQLEQLAR-IRALERELLHMRVEHTQLLHRV--K 180
  F4IMQ0 AIQHR-EIQSLLNDNQR--LA-VAHIGLKDQLNVAKRELERLLETAVKVKAEGEAKVREV--YQNALRMEAEARVIDGLGAELGQVRSD----VQRLGSD 133

  P0CW27 RRFLE-DKAAFERE-ARQRVQSLARRAEREAVRALVAHTQAIKADNGRLR--QELLLLLRRTQL--LHHTRRQLLEQR-EQLHRE----HEDTRDL---A 266
  F4IMQ0 RQELATELAMFDDEMAKAKPNS-----DR-AI-EVKLEIEILR---GEIRKGRAALELEKKTRASNLHHERG--MEKTIDHLNREIVKLEEELVDLETKA 221

  P0CW27 RVHGWLRRGPGGPPLWERPAFSQ--PTSRPGSLAAPISPSRAASQTPSVV--PSRAAPRASS----VVPSREASRVPSLVLSSMDSRVPSLATSKVGSRM 358
  F4IMQ0 R---------------EANAAAEAAPTPSPG-LAASY-----GNNTDDIYGGQGRQYPEANGTHELVL--REKSYVHRLV--SV-----QLVQVSVG--- 288

  P0CW27 PSLTASRAGSRALSLVQSLEGSGISSGSSPRVSSQDTLRSTKSGPKLLSGLSRDRDPALLPPQSEDSVNAEAAAEASPGRA 439
  F4IMQ0 --------------------------------------------------------------------------------- 288

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0036064 ciliary basal body
1. PB GO:0044458 motile cilium assembly
2. P GO:0140278 mitotic division septum assembly
2. P GO:0097539 ciliary transition fiber
2. P GO:0017134 fibroblast growth factor binding
2. P GO:0019904 protein domain specific binding
2. P GO:0007094 mitotic spindle assembly checkpoint signaling
2. P GO:1902410 mitotic cytokinetic process
2. P GO:0005874 microtubule
2. P GO:0099078 BORC complex
2. P GO:0005080 protein kinase C binding
2. P GO:0008286 insulin receptor signaling pathway
2. P GO:0047496 vesicle transport along microtubule
2. P GO:1903251 multi-ciliated epithelial cell differentiation
2. P GO:0031965 nuclear membrane
2. P GO:0043162 ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
2. P GO:2001237 negative regulation of extrinsic apoptotic signaling pathway
2. P GO:0030334 regulation of cell migration
2. P GO:0038007 netrin-activated signaling pathway
2. P GO:0019894 kinesin binding
2. P GO:0030426 growth cone
2. P GO:0008017 microtubule binding
2. P GO:0007020 microtubule nucleation
2. P GO:0008021 synaptic vesicle
2. P GO:0007405 neuroblast proliferation
2. P GO:0006997 nucleus organization
2. P GO:1900029 positive regulation of ruffle assembly
2. P GO:0042110 T cell activation
2. P GO:0070012 oligopeptidase activity
2. P GO:0010005 cortical microtubule, transverse to long axis
2. P GO:0072201 negative regulation of mesenchymal cell proliferation
2. P GO:0006397 mRNA processing
2. P GO:0005212 structural constituent of eye lens
2. P GO:0051301 cell division
2. P GO:0033157 regulation of intracellular protein transport
2. P GO:0031097 medial cortex
2. P GO:0080009 mRNA methylation
2. P GO:0043231 intracellular membrane-bounded organelle
2. P GO:0044565 dendritic cell proliferation
2. P GO:2000114 regulation of establishment of cell polarity
2. P GO:0061573 actin filament bundle retrograde transport
2. P GO:0043015 gamma-tubulin binding
2. P GO:0000446 nucleoplasmic THO complex
2. P GO:0045098 type III intermediate filament
2. P GO:0007539 primary sex determination, soma
2. P GO:0010975 regulation of neuron projection development
2. P GO:0070732 spindle envelope
2. P GO:0016592 mediator complex
2. P GO:0048490 anterograde synaptic vesicle transport
2. P GO:0032204 regulation of telomere maintenance
2. P GO:0030479 actin cortical patch
2. P GO:0043506 regulation of JUN kinase activity
2. P GO:0009996 negative regulation of cell fate specification
2. P GO:0055015 ventricular cardiac muscle cell development
2. P GO:2000300 regulation of synaptic vesicle exocytosis
2. P GO:0060988 lipid tube assembly
2. P GO:0008298 intracellular mRNA localization
2. P GO:0016477 cell migration
2. P GO:0007100 mitotic centrosome separation
2. P GO:0031083 BLOC-1 complex
2. P GO:0021955 central nervous system neuron axonogenesis
2. P GO:0032488 Cdc42 protein signal transduction
2. P GO:0005819 spindle
2. P GO:0036158 outer dynein arm assembly
2. P GO:0044295 axonal growth cone
2. P GO:0030331 estrogen receptor binding
2. P GO:0071901 negative regulation of protein serine/threonine kinase activity
2. P GO:0016363 nuclear matrix
2. P GO:0007249 I-kappaB kinase/NF-kappaB signaling
2. P GO:1990619 histone H3-K9 deacetylation
2. P GO:0090201 negative regulation of release of cytochrome c from mitochondria
2. P GO:0043515 kinetochore binding
2. P GO:0051666 actin cortical patch localization
2. P GO:0007533 mating type switching
2. P GO:0070374 positive regulation of ERK1 and ERK2 cascade
2. P GO:0033504 floor plate development
2. P GO:0006366 transcription by RNA polymerase II
2. P GO:0000375 RNA splicing, via transesterification reactions
2. P GO:0005634 nucleus
2. P GO:0031647 regulation of protein stability
2. P GO:0045451 pole plasm oskar mRNA localization
2. P GO:0005930 axoneme
2. P GO:0045494 photoreceptor cell maintenance
2. P GO:0043203 axon hillock
2. P GO:0007010 cytoskeleton organization
2. P GO:0005789 endoplasmic reticulum membrane
2. P GO:1900114 positive regulation of histone H3-K9 trimethylation
2. P GO:0008157 protein phosphatase 1 binding
2. P GO:0034504 protein localization to nucleus
2. P GO:0005901 caveola
2. P GO:0000381 regulation of alternative mRNA splicing, via spliceosome
2. P GO:0001764 neuron migration
2. P GO:0090724 central region of growth cone
2. P GO:0043393 regulation of protein binding
2. P GO:2000394 positive regulation of lamellipodium morphogenesis
2. P GO:0005814 centriole
2. P GO:0048812 neuron projection morphogenesis
2. P GO:1903119 protein localization to actin cytoskeleton
2. P GO:2000574 obsolete regulation of microtubule motor activity
2. P GO:0060155 platelet dense granule organization
2. P GO:1904115 axon cytoplasm
2. P GO:0032391 photoreceptor connecting cilium
2. P GO:0045931 positive regulation of mitotic cell cycle
2. P GO:0021987 cerebral cortex development
2. P GO:2000223 regulation of BMP signaling pathway involved in heart jogging
2. P GO:0030866 cortical actin cytoskeleton organization
2. P GO:0072741 protein localization to cell division site
2. P GO:0042073 intraciliary transport
2. P GO:0007368 determination of left/right symmetry
2. P GO:0061371 determination of heart left/right asymmetry
2. P GO:0015630 microtubule cytoskeleton
2. P GO:0003712 transcription coregulator activity
2. P GO:0014069 postsynaptic density
2. P GO:0000137 Golgi cis cisterna
2. P GO:0060327 cytoplasmic actin-based contraction involved in cell motility
2. P GO:0016607 nuclear speck
2. P GO:0005801 cis-Golgi network
2. P GO:0051220 cytoplasmic sequestering of protein
2. P GO:0006469 negative regulation of protein kinase activity
2. P GO:0005934 cellular bud tip
2. P GO:0000776 kinetochore
2. P GO:0000077 DNA damage checkpoint signaling
2. P GO:0032410 negative regulation of transporter activity
2. P GO:0034453 microtubule anchoring
2. P GO:0060052 neurofilament cytoskeleton organization
2. P GO:0007315 pole plasm assembly
2. P GO:0005635 nuclear envelope
2. P GO:0030017 sarcomere
2. P GO:0005858 axonemal dynein complex
2. P GO:0006998 nuclear envelope organization
2. P GO:0061646 positive regulation of glutamate neurotransmitter secretion in response to membrane depolarization
2. P GO:0008090 retrograde axonal transport
2. P GO:0030951 establishment or maintenance of microtubule cytoskeleton polarity
2. P GO:0051081 nuclear membrane disassembly
2. P GO:0051028 mRNA transport
2. P GO:0030374 nuclear receptor coactivator activity
2. P GO:0007080 mitotic metaphase plate congression
2. P GO:0032922 circadian regulation of gene expression
2. P GO:0007060 male meiosis chromosome segregation
2. P GO:0007530 sex determination
2. P GO:0048469 cell maturation
2. P GO:0051049 regulation of transport
2. P GO:0036286 eisosome filament
2. P GO:0051898 negative regulation of protein kinase B signaling
2. P GO:1990893 mitotic chromosome centromere condensation
2. P GO:0010008 endosome membrane
2. P GO:1990483 Clr6 histone deacetylase complex I''
2. P GO:1990683 DNA double-strand break attachment to nuclear envelope
2. P GO:0061163 endoplasmic reticulum polarization
2. P GO:1903243 negative regulation of cardiac muscle hypertrophy in response to stress
2. P GO:0007399 nervous system development
2. P GO:0000132 establishment of mitotic spindle orientation
2. P GO:1904178 negative regulation of adipose tissue development
2. P GO:0030424 axon
2. P GO:0045109 intermediate filament organization
2. P GO:0034451 centriolar satellite
2. P GO:0007409 axonogenesis
2. P GO:0007030 Golgi organization
2. P GO:0007517 muscle organ development
2. P GO:0051311 meiotic metaphase plate congression
2. P GO:0098535 de novo centriole assembly involved in multi-ciliated epithelial cell differentiation
2. P GO:0048487 beta-tubulin binding
2. P GO:0009832 plant-type cell wall biogenesis
2. P GO:0007059 chromosome segregation
2. P GO:1905349 ciliary transition zone assembly
2. P GO:0033162 melanosome membrane
2. P GO:2001224 positive regulation of neuron migration
2. P GO:0048749 compound eye development
2. P GO:0090630 activation of GTPase activity
2. P GO:0005815 microtubule organizing center
2. P GO:0045184 establishment of protein localization
2. P GO:0060053 neurofilament cytoskeleton
2. P GO:0051642 centrosome localization
2. P GO:0008089 anterograde axonal transport
2. P GO:0031616 spindle pole centrosome
2. P GO:0060261 positive regulation of transcription initiation from RNA polymerase II promoter
2. P GO:0003341 cilium movement
2. P GO:0001833 inner cell mass cell proliferation
2. P GO:0036157 outer dynein arm
2. P GO:0031023 microtubule organizing center organization
2. P GO:0007297 ovarian follicle cell migration
2. P GO:0019099 female germ-line sex determination
2. P GO:0032880 regulation of protein localization
2. P GO:0033551 monopolin complex
2. P GO:0021532 neural tube patterning
2. P GO:0000922 spindle pole
2. P GO:0048309 endoplasmic reticulum inheritance
2. P GO:0060285 cilium-dependent cell motility
2. P GO:0031252 cell leading edge
2. P GO:0090343 positive regulation of cell aging
2. P GO:0007288 sperm axoneme assembly
2. P GO:0034506 chromosome, centromeric core domain
2. P GO:0070847 core mediator complex
2. P GO:0005652 nuclear lamina
2. P GO:0048813 dendrite morphogenesis
2. P GO:0070865 investment cone
2. P GO:0051298 centrosome duplication
2. P GO:0032580 Golgi cisterna membrane
2. P GO:0000801 central element
2. P GO:0051225 spindle assembly
2. P GO:0032154 cleavage furrow
2. P GO:0097298 regulation of nucleus size
2. P GO:0060159 regulation of dopamine receptor signaling pathway
2. P GO:0034763 negative regulation of transmembrane transport
2. P GO:0005638 lamin filament
2. P GO:0097320 plasma membrane tubulation
2. P GO:1990138 neuron projection extension
2. P GO:0034501 protein localization to kinetochore
2. P GO:1990528 Rvs161p-Rvs167p complex
2. P GO:0061512 protein localization to cilium
2. P GO:0070286 axonemal dynein complex assembly
2. P GO:0043197 dendritic spine
2. P GO:0021799 cerebral cortex radially oriented cell migration
2. P GO:1904511 cytoplasmic microtubule plus-end
2. P GO:0003352 regulation of cilium movement
2. P GO:0000813 ESCRT I complex
2. P GO:0048680 positive regulation of axon regeneration
2. P GO:0051721 protein phosphatase 2A binding
2. P GO:0048920 posterior lateral line neuromast primordium migration
2. P GO:0071392 cellular response to estradiol stimulus
2. P GO:0030027 lamellipodium
2. P GO:0035861 site of double-strand break
2. P GO:0033365 protein localization to organelle
2. P GO:0010051 xylem and phloem pattern formation
2. P GO:0000212 meiotic spindle organization
2. P GO:1901003 negative regulation of fermentation
2. P GO:0001835 blastocyst hatching
2. P GO:0006930 substrate-dependent cell migration, cell extension
2. P GO:0007099 centriole replication
2. P GO:0001956 positive regulation of neurotransmitter secretion
2. P GO:0046966 thyroid hormone receptor binding
2. P GO:0043014 alpha-tubulin binding
2. P GO:0051303 establishment of chromosome localization
2. P GO:1900180 regulation of protein localization to nucleus
2. P GO:0097028 dendritic cell differentiation
2. P GO:0016528 sarcoplasm
2. P GO:0031532 actin cytoskeleton reorganization
2. P GO:0005871 kinesin complex
2. P GO:0030672 synaptic vesicle membrane
2. P GO:0070941 eisosome assembly
2. P GO:0007286 spermatid development
2. P GO:0000278 mitotic cell cycle
2. P GO:0060271 cilium assembly
2. P GO:0043332 mating projection tip
2. P GO:0031514 motile cilium
2. P GO:0031175 neuron projection development
2. P GO:0005875 microtubule associated complex
2. P GO:0032418 lysosome localization
2. P GO:0031262 Ndc80 complex
2. P GO:0000940 outer kinetochore
2. P GO:0005813 centrosome
2. P GO:0014059 regulation of dopamine secretion
2. P GO:0046872 metal ion binding
2. P GO:0036396 RNA N6-methyladenosine methyltransferase complex
2. P GO:0005882 intermediate filament
2. P GO:0007224 smoothened signaling pathway
2. P GO:0042770 signal transduction in response to DNA damage
2. P GO:0098686 hippocampal mossy fiber to CA3 synapse
2. P GO:0090443 FAR/SIN/STRIPAK complex
2. P GO:0045724 positive regulation of cilium assembly
2. P GO:0070307 lens fiber cell development
2. P GO:0042802 identical protein binding
2. P GO:0005938 cell cortex
2. P GO:0045773 positive regulation of axon extension
2. P GO:0005654 nucleoplasm
2. P GO:0070868 obsolete heterochromatin organization involved in chromatin silencing

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB A0JMY4 Basal body-orientation factor 1 3.21e-04 6.81e-03 0.021
1. PB P0CW27 Coiled-coil domain-containing protein 166 0 1.93e-140 0.0
2. P A6NI56 Coiled-coil domain-containing protein 154 1.19e-05 4.40e-02 NA
2. P Q3UPP8 Centrosomal protein of 63 kDa 1.93e-04 7.58e-03 NA
2. P Q06637 Filensin 7.56e-05 1.37e-02 NA
2. P P0DL09 Dynein regulatory complex protein 1 4.96e-05 2.95e-07 NA
2. P Q66IZ7 Nuclear distribution protein nudE-like 1-B 1.16e-04 8.13e-06 NA
2. P Q9P2B4 CTTNBP2 N-terminal-like protein 8.05e-05 3.24e-03 NA
2. P F7DP49 Deuterosome assembly protein 1 5.27e-07 1.75e-03 NA
2. P Q5ZMC9 Nuclear distribution protein nudE homolog 1 4.87e-05 7.32e-06 NA
2. P C7GY13 SWI5-dependent HO expression protein 3 6.16e-05 1.57e-05 NA
2. P Q9P6S3 Up-regulated during septation protein 1 1.71e-03 1.07e-03 NA
2. P D3YZP9 Coiled-coil domain-containing protein 6 2.12e-07 9.66e-04 NA
2. P Q28CJ6 Nuclear distribution protein nudE-like 1 7.89e-05 3.23e-05 NA
2. P P39743 Reduced viability upon starvation protein 167 1.10e-04 3.39e-04 NA
2. P Q5XIJ8 Dynein regulatory complex subunit 2 4.35e-08 2.86e-04 NA
2. P B3DLE8 Protein Spindly 5.71e-07 2.66e-02 NA
2. P Q91VJ2 Caveolae-associated protein 3 5.73e-03 1.72e-03 NA
2. P O43068 Monopolin complex subunit mde4 1.63e-06 3.84e-03 NA
2. P Q7SZK7 Oral-facial-digital syndrome 1 protein homolog 2.71e-04 6.68e-03 NA
2. P C5DLA5 SWI5-dependent HO expression protein 3 4.02e-06 3.99e-09 NA
2. P Q7QH62 Mediator of RNA polymerase II transcription subunit 4 5.32e-04 2.08e-02 NA
2. P Q08C53 Basal body-orientation factor 1 4.97e-06 8.13e-05 NA
2. P Q9VM65 FGFR1 oncogene partner 2 homolog 9.77e-05 4.77e-08 NA
2. P Q4R703 Centrosomal protein of 63 kDa 1.23e-04 3.58e-03 NA
2. P Q8IXS2 Dynein regulatory complex subunit 2 3.38e-07 2.35e-02 NA
2. P O46480 Nuclear distribution protein nudE-like 1 3.45e-07 7.95e-05 NA
2. P Q0VFX2 Cilia- and flagella-associated protein 157 8.50e-07 9.23e-08 NA
2. P P33441 THO complex subunit MFT1 9.20e-04 3.28e-04 NA
2. P Q6ZUS6 Coiled-coil domain-containing protein 149 7.82e-05 4.19e-04 NA
2. P Q96M63 Outer dynein arm-docking complex subunit 1 3.30e-05 4.96e-02 NA
2. P Q02435 Filensin (Fragment) 2.97e-06 5.63e-08 NA
2. P Q4R8G4 Centrosomal protein POC5 1.13e-04 2.54e-02 NA
2. P O14128 Probable sphingolipid long chain base-responsive protein pil2 2.19e-02 4.82e-02 NA
2. P Q04934 Protein IVY1 2.60e-04 4.08e-02 NA
2. P Q9ER69 Pre-mRNA-splicing regulator WTAP 5.61e-05 6.24e-13 NA
2. P Q6DH86 Coiled-coil domain-containing protein 149-B 5.44e-05 4.41e-03 NA
2. P Q4R3Q7 Lebercilin-like protein 2.33e-05 1.61e-02 NA
2. P Q10PZ6 Microtubule-associated protein 70-4 1.92e-05 3.76e-11 NA
2. P B0CM36 Lebercilin-like protein 8.50e-05 2.26e-03 NA
2. P Q3KR99 Protein Spindly 1.88e-05 8.98e-07 NA
2. P P49455 Tropomyosin-1, isoforms 33/34 7.86e-06 4.73e-02 NA
2. P Q95K40 Coiled-coil domain-containing protein 83 4.03e-07 1.98e-12 NA
2. P Q6DK98 Nuclear distribution protein nudE-like 1-A 4.32e-05 5.34e-05 NA
2. P A5E5U9 SWI5-dependent HO expression protein 3 8.56e-06 8.02e-04 NA
2. P Q6P4K5 Pre-mRNA-splicing regulator WTAP 3.88e-05 2.74e-12 NA
2. P Q4KLT6 Pre-mRNA-splicing regulator WTAP 6.42e-06 9.97e-10 NA
2. P Q86VQ0 Lebercilin 3.87e-04 1.33e-05 NA
2. P F8WBI6 Golgin subfamily A member 8N 4.63e-06 3.42e-06 NA
2. P Q8ND07 Basal body-orientation factor 1 3.69e-05 3.62e-05 NA
2. P A5D8S1 Leucine zipper protein 2 5.27e-06 7.06e-09 NA
2. P P32448 Anti-silencing protein 2 1.06e-06 1.15e-08 NA
2. P Q28XY0 Pre-mRNA-splicing regulator female-lethal(2)D 2.02e-05 4.60e-04 NA
2. P Q9QYP6 5-azacytidine-induced protein 2 2.90e-03 1.08e-08 NA
2. P Q3SYW5 5-azacytidine-induced protein 2 7.66e-07 1.31e-06 NA
2. P O95447 Lebercilin-like protein 2.22e-04 5.86e-04 NA
2. P Q6CQV5 Biogenesis of lysosome-related organelles complex 1 subunit VAB2 2.08e-04 8.61e-03 NA
2. P Q8SX68 CTTNBP2 N-terminal-like protein 3.05e-06 2.36e-04 NA
2. P D3UEM3 SWI5-dependent HO expression protein 3 2.33e-04 1.75e-05 NA
2. P Q75AC2 Biogenesis of lysosome-related organelles complex 1 subunit VAB2 1.25e-02 1.58e-03 NA
2. P Q9SAF6 Protein CROWDED NUCLEI 2 1.27e-03 3.55e-03 NA
2. P O45717 Protein nud-2 4.05e-07 1.07e-02 NA
2. P Q6NRJ5 Nuclear distribution protein nudE homolog 1-B 4.27e-05 2.13e-06 NA
2. P A7E3D8 Lebercilin-like protein 2.12e-05 1.52e-02 NA
2. P A8JB22 Dynein regulatory complex subunit 2 4.22e-09 4.42e-05 NA
2. P Q6NRW2 Protein Spindly-B 1.98e-06 1.66e-03 NA
2. P Q5XG48 Mediator of RNA polymerase II transcription subunit 4 1.41e-03 2.38e-02 NA
2. P Q4KMA0 5-azacytidine-induced protein 2 1.94e-05 6.63e-07 NA
2. P Q9CQA5 Mediator of RNA polymerase II transcription subunit 4 4.87e-04 5.59e-07 NA
2. P A8MQT2 Golgin subfamily A member 8B 1.01e-04 5.90e-05 NA
2. P Q8C0X0 Lebercilin-like protein 1.43e-03 3.27e-06 NA
2. P Q6PHN1 Coiled-coil domain-containing protein 57 1.94e-04 1.15e-02 NA
2. P Q8IWF9 Coiled-coil domain-containing protein 83 1.99e-05 1.56e-13 NA
2. P Q75EN7 SWI5-dependent HO expression protein 3 1.20e-05 7.40e-07 NA
2. P Q59LF3 Regulator of cytoskeleton and endocytosis RVS167 5.47e-04 1.30e-02 NA
2. P Q3SZV2 KxDL motif-containing protein 1 6.64e-04 8.78e-03 NA
2. P Q5R8T7 Nuclear distribution protein nudE-like 1 8.19e-06 2.77e-04 NA
2. P Q3TY65 Islet cell autoantigen 1-like protein 6.17e-06 2.56e-02 NA
2. P Q96EA4 Protein Spindly 2.94e-03 2.12e-08 NA
2. P Q9D4V3 Coiled-coil domain-containing protein 83 2.86e-06 7.28e-05 NA
2. P Q6Z746 Microtubule-associated protein 70-2 6.13e-05 1.25e-07 NA
2. P Q5XJA2 Coiled-coil domain-containing protein 149-A 9.98e-04 2.23e-03 NA
2. P P48678 Prelamin-A/C 1.50e-06 3.18e-02 NA
2. P Q8N0S2 Synaptonemal complex central element protein 1 2.90e-06 2.42e-02 NA
2. P Q91WZ8 Dysbindin 3.32e-05 4.20e-03 NA
2. P Q5ABV6 SWI5-dependent HO expression protein 3 2.30e-04 1.20e-02 NA
2. P Q7T019 Zinc finger protein Dzip1 7.59e-05 1.70e-02 NA
2. P B5VE90 SWI5-dependent HO expression protein 3 7.85e-05 2.28e-05 NA
2. P P48679 Prelamin-A/C 2.36e-05 1.37e-02 NA
2. P Q5JU67 Cilia- and flagella-associated protein 157 2.74e-05 1.18e-10 NA
2. P Q2YDE5 Putative coiled-coil domain-containing protein 196 1.27e-03 8.80e-04 NA
2. P Q32KY1 Dynein regulatory complex protein 1 4.30e-05 1.72e-04 NA
2. P Q2NL98 Vimentin-type intermediate filament-associated coiled-coil protein 2.98e-06 1.89e-02 NA
2. P P97817 Cerebellar degeneration-related protein 2 1.13e-05 1.75e-02 NA
2. P F4HRT5 Protein CROWDED NUCLEI 1 1.05e-02 1.63e-03 NA
2. P Q78PB6 Nuclear distribution protein nudE-like 1 3.44e-07 1.25e-05 NA
2. P Q24522 Protein bunched, class 1/class 3/D/E isoforms 8.44e-03 9.49e-03 NA
2. P Q5ZKH4 Nuclear distribution protein nudE-like 1 9.85e-06 2.95e-07 NA
2. P Q95JM8 Dynein regulatory complex protein 1 8.09e-05 5.29e-06 NA
2. P Q9H6S1 5-azacytidine-induced protein 2 1.42e-04 6.01e-11 NA
2. P Q28BZ7 Centrosomal protein cep57l1 1.23e-03 1.21e-02 NA
2. P Q96MT8 Centrosomal protein of 63 kDa 7.74e-05 4.51e-04 NA
2. P P38272 SWI5-dependent HO expression protein 3 5.92e-05 2.55e-05 NA
2. P Q96MC2 Dynein regulatory complex protein 1 4.64e-04 1.55e-04 NA
2. P Q66J96 Nuclear distribution protein nudE homolog 1-A 1.04e-06 1.44e-06 NA
2. P Q08DR9 Protein Spindly 4.07e-08 5.56e-04 NA
2. P H3BSY2 Golgin subfamily A member 8M 8.79e-07 3.72e-06 NA
2. P Q803Q2 Nuclear distribution protein nudE-like 1-B 7.68e-06 1.36e-05 NA
2. P A0A166B1A6 Nuclear matrix constituent protein 1 3.12e-03 3.49e-02 NA
2. P Q8BGY3 Leucine zipper protein 2 1.18e-05 9.41e-12 NA
2. P A4FV37 Caveolae-associated protein 3 1.16e-03 5.01e-04 NA
2. P Q9NYA3 Golgin subfamily A member 6A 4.05e-07 1.55e-03 NA
2. P A6NMD2 Golgin subfamily A member 8J 4.91e-04 1.19e-06 NA
2. P Q06568 Nuclear distribution protein nudE homolog 1 1.11e-02 7.87e-05 NA
2. P Q53HC0 Coiled-coil domain-containing protein 92 2.72e-04 1.07e-05 NA
2. P Q4R7Y8 Basal body-orientation factor 1 1.16e-06 1.55e-04 NA
2. P Q9NXR1 Nuclear distribution protein nudE homolog 1 1.28e-05 1.82e-03 NA
2. P Q9C9X0 Microtubule-associated protein 70-1 4.67e-06 2.01e-08 NA
2. P A6NDN3 Golgin subfamily A member 6B 1.20e-05 6.11e-04 NA
2. P B3LN26 SWI5-dependent HO expression protein 3 5.49e-05 1.75e-05 NA
2. P Q86TE4 Leucine zipper protein 2 5.51e-05 1.24e-11 NA
2. P Q80HV0 17 kDa A-type inclusion protein NA 7.61e-04 NA
2. P Q8IYY4 Zinc finger protein DZIP1L 6.95e-03 1.25e-05 NA
2. P Q9GZM8 Nuclear distribution protein nudE-like 1 2.17e-06 2.41e-04 NA
2. P Q5WN60 Intermediate filament protein ifc-2 4.51e-04 3.65e-03 NA
2. P Q2TA00 Coiled-coil domain-containing protein 83 5.68e-07 4.83e-14 NA
2. P Q8GYX3 Microtubule-associated protein 70-5 2.34e-07 1.18e-03 NA
2. P D6RF30 Golgin subfamily A member 8K 2.90e-05 1.79e-08 NA
2. P P11048 Lamin-A 4.86e-07 1.69e-02 NA
2. P H3BQL2 Golgin subfamily A member 8T 1.92e-06 8.06e-07 NA
2. P Q8CB62 Centrobin 1.43e-03 1.21e-02 NA
2. P Q6NZK5 Protein hinderin 2.43e-03 2.61e-02 NA
2. P Q4V7B0 Cilia- and flagella-associated protein 157 7.87e-05 5.28e-08 NA
2. P A6NCC3 Golgin subfamily A member 8O 2.99e-04 5.41e-06 NA
2. P Q8BMD2 Zinc finger protein DZIP1 2.90e-05 3.14e-04 NA
2. P Q9ES39 Nuclear distribution protein nudE homolog 1 5.87e-05 6.80e-07 NA
2. P Q7ZWE6 Dysbindin-A 5.50e-05 8.50e-05 NA
2. P Q9LQU7 Microtubule-associated protein 70-4 5.72e-05 1.02e-07 NA
2. P Q12934 Filensin 4.46e-05 1.16e-05 NA
2. P A0MZ67 Shootin-1 1.19e-02 1.12e-02 NA
2. P Q9VT70 Nuclear distribution protein nudE homolog 2.31e-06 1.29e-04 NA
2. P Q7T0Y4 Dynein regulatory complex protein 1 2.33e-06 3.63e-06 NA
2. P Q4R7G7 Dynein regulatory complex subunit 2 1.13e-07 1.22e-02 NA
2. P Q06002 Filensin 7.02e-04 1.80e-02 NA
2. P Q66JL0 Nuclear distribution protein nudE homolog 1 1.50e-05 2.54e-07 NA
2. P A6NDK9 Golgin subfamily A member 6C 1.87e-06 2.98e-04 NA
2. P Q9NPJ6 Mediator of RNA polymerase II transcription subunit 4 2.89e-03 2.26e-04 NA
2. P A2CEM9 Coiled-coil domain-containing protein 85B 6.56e-05 5.56e-04 NA
2. P A7E2F4 Golgin subfamily A member 8A 4.48e-03 6.95e-03 NA
2. P Q9I969 Beta-taxilin 2.22e-05 9.49e-03 NA
2. P Q8L7S4 Microtubule-associated protein 70-2 5.95e-05 2.38e-08 NA
2. P Q32PN7 Zinc finger protein DZIP1L 1.97e-07 3.11e-03 NA
2. P Q4R4S6 Nuclear distribution protein nudE-like 1 2.30e-07 1.58e-04 NA
2. P Q5RD40 5-azacytidine-induced protein 2 1.08e-05 7.75e-09 NA
2. P A2BDR7 Cilia- and flagella-associated protein 157 1.20e-09 8.66e-07 NA
2. P A6NC78 Putative golgin subfamily A member 8I 8.38e-04 7.58e-07 NA
2. P Q810I0 Vacuolar protein sorting-associated protein 37D 9.78e-04 9.13e-06 NA
2. P Q6DBR9 KxDL motif-containing protein 1 7.02e-02 3.39e-04 NA
2. P Q499E4 Zinc finger protein DZIP1L 3.03e-05 3.08e-04 NA
2. P P0CB05 Centrosomal protein of 63 kDa 1.06e-05 1.87e-02 NA
2. P Q9C117 Uncharacterized protein C16E8.12c 1.03e-04 2.33e-02 NA
2. P Q8VBT1 Beta-taxilin 1.27e-04 2.63e-02 NA
2. P Q923A2 Protein Spindly 2.92e-05 2.64e-05 NA
2. P Q21194 Guanine nucleotide exchange factor rei-2 1.03e-05 1.28e-08 NA
2. P Q3V079 Basal body-orientation factor 1 1.20e-04 8.22e-05 NA
2. P Q2QLI6 Microtubule-associated protein 70-1 1.73e-06 5.77e-08 NA
2. P C5MH60 SWI5-dependent HO expression protein 3 2.64e-05 1.62e-05 NA
2. P A0A125S9M6 Cytotardin 4.11e-06 2.05e-04 NA
2. P Q5RDH2 CTTNBP2 N-terminal-like protein 2.83e-06 4.20e-03 NA
2. P A7YWC8 Vimentin-type intermediate filament-associated coiled-coil protein 1.35e-05 1.51e-02 NA
2. P Q3SYZ9 Mediator of RNA polymerase II transcription subunit 4 2.21e-03 1.18e-02 NA
2. P E9PVD1 Coiled-coil domain-containing protein 62 6.30e-05 1.66e-06 NA
2. P Q5R8Y4 Leucine zipper protein 2 9.56e-06 6.36e-11 NA
2. P I6L899 Golgin subfamily A member 8R 3.62e-04 6.09e-07 NA
2. P F1QRC1 Dynein regulatory complex protein 1 1.17e-06 3.42e-06 NA
2. P Q8IYX8 Centrosomal protein CEP57L1 9.94e-05 2.71e-03 NA
2. P Q99LJ0 CTTNBP2 N-terminal-like protein 1.29e-06 3.15e-03 NA
2. P Q9Y091 Pre-mRNA-splicing regulator female-lethal(2)D 8.39e-06 5.54e-03 NA
2. P A3LXM3 SWI5-dependent HO expression protein 3 4.23e-05 1.15e-02 NA
2. P Q9W3J8 Dynein regulatory complex protein 1 homolog 6.92e-04 1.29e-04 NA
2. P Q7SXI6 Nuclear distribution protein nudE-like 1-A 5.40e-05 4.56e-04 NA
2. P Q2HJA5 Dysbindin 4.93e-06 1.60e-03 NA
2. P H3BV12 Golgin subfamily A member 8Q 2.73e-05 2.80e-06 NA
2. P P0CG33 Golgin subfamily A member 6D 8.10e-05 7.15e-03 NA
2. P Q9ZUA3 Microtubule-associated protein 70-3 5.13e-06 1.23e-08 NA
2. P Q15007 Pre-mRNA-splicing regulator WTAP 1.10e-06 9.14e-12 NA
2. P Q0VFN8 Cilia- and flagella-associated protein 157 9.40e-06 2.16e-06 NA
2. P A6ZL74 SWI5-dependent HO expression protein 3 7.43e-05 1.57e-05 NA
2. P Q969G5 Caveolae-associated protein 3 1.22e-03 4.10e-04 NA
2. P Q6P0R8 Shootin-1 2.10e-06 1.70e-03 NA
2. P Q96EV8 Dysbindin 2.00e-06 5.82e-03 NA
2. P Q561Q8 Mediator of RNA polymerase II transcription subunit 4 2.85e-04 2.84e-07 NA
2. P H3BPF8 Golgin subfamily A member 8S 8.54e-04 6.99e-06 NA
2. P A6NN73 Golgin subfamily A member 8C 1.21e-05 1.57e-05 NA
2. P F4IMQ0 Protein FLC EXPRESSOR 9.33e-10 1.44e-02 NA
2. P O74352 Protein hob1 1.20e-03 3.65e-02 NA
2. P C5DUI8 SWI5-dependent HO expression protein 3 2.06e-05 2.71e-02 NA
2. P Q6P9F0 Coiled-coil domain-containing protein 62 2.83e-07 8.68e-05 NA
2. P Q9ERR1 Nuclear distribution protein nudE-like 1 3.10e-05 1.25e-05 NA
2. P O94452 Meiotic coiled-coil protein 1 6.26e-03 1.09e-03 NA
2. P Q86YF9 Zinc finger protein DZIP1 1.03e-05 1.42e-02 NA
2. P B4F7A7 Centrosomal protein of 57 kDa 1.62e-03 2.15e-03 NA
2. P Q64EV9 Kinetochore protein Spc25 3.40e-03 3.61e-04 NA
2. P Q8VDN4 Coiled-coil domain-containing protein 92 1.71e-05 9.78e-06 NA
2. P P02545 Prelamin-A/C 2.15e-06 1.95e-02 NA
2. P A7TJJ7 SWI5-dependent HO expression protein 3 1.50e-04 2.39e-07 NA
2. P Q5XI65 Dynein regulatory complex protein 1 7.27e-04 2.99e-03 NA
2. P A7MD70 Protein Spindly 1.00e-05 1.36e-04 NA
2. P Q6FMH8 SWI5-dependent HO expression protein 3 7.80e-06 3.42e-02 NA
2. P B1H228 Outer dynein arm-docking complex subunit 1 1.04e-03 4.32e-04 NA
2. P Q6NRH3 Coiled-coil domain-containing protein 149 3.13e-03 1.70e-02 NA
2. P Q8CEE0 Centrosomal protein of 57 kDa 5.94e-07 5.88e-03 NA
2. P Q2TAC2 Coiled-coil domain-containing protein 57 1.96e-03 4.01e-02 NA
2. P Q4R7H3 Protein Spindly 3.73e-04 3.51e-07 NA
2. P Q86XT2 Vacuolar protein sorting-associated protein 37D 8.97e-03 7.01e-03 NA
2. P B4G5J0 Kinetochore protein Spc25 2.65e-06 4.28e-03 NA
2. P Q653N3 Microtubule-associated protein 70-3 5.19e-06 1.09e-07 NA
2. P Q3USS3 Dynein regulatory complex protein 1 6.02e-03 2.55e-03 NA
2. P Q9CZA6 Nuclear distribution protein nudE homolog 1 5.45e-05 1.47e-08 NA
2. P Q5BIX7 Protein Spindly-A 3.61e-06 1.19e-04 NA
2. P Q2TA16 Dynein regulatory complex subunit 2 2.78e-07 3.49e-02 NA
2. P Q80ST9 Lebercilin 4.43e-04 2.99e-05 NA
2. P Q9Z1H9 Caveolae-associated protein 3 3.65e-03 1.37e-02 NA
2. P A2AMT1 Filensin 1.59e-03 1.06e-05 NA
2. P Q03252 Lamin-B2 5.31e-06 5.99e-03 NA
2. P Q5ZKM0 Dysbindin 2.14e-05 6.31e-05 NA
2. P Q4R3X1 5-azacytidine-induced protein 2 1.14e-03 6.53e-12 NA
2. P P13648 Lamin-A 1.37e-04 4.78e-02 NA
2. P Q5XIA0 Zinc finger protein DZIP1L 1.73e-05 2.11e-06 NA
2. P Q3V2A7 Glutamine-rich protein 2 1.73e-03 3.62e-02 NA
2. P P0CJ92 Golgin subfamily A member 8H 1.45e-03 5.56e-08 NA
2. P Q7SXL7 Pre-mRNA-splicing regulator WTAP 6.80e-06 1.40e-12 NA