Summary

P0DI83

Homolog: Q9D226.
Function: Keratin-associated protein 5-3.

Statistics

Total GO Annotation: 10
Unique PROST Go: 9
Unique BLAST Go: 1

Total Homologs: 25
Unique PROST Homologs: 24
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was Q9D226 (Keratin-associated protein 5-3) with a FATCAT P-Value: 0.0331 and RMSD of 3.02 angstrom. The sequence alignment identity is 7.1%.
Structural alignment shown in left. Query protein P0DI83 colored as red in alignment, homolog Q9D226 colored as blue. Query protein P0DI83 is also shown in right top, homolog Q9D226 showed in right bottom. They are colored based on secondary structures. 

  P0DI83 ---------------------------------------------------------------------------------------------------- 0
  Q9D226 MSCCGCCGGCGSSCCKPVCCCVPVCSCSSCGGCKGGCSSCGGCGSCGGCKGGCGSCGGCGSCGGCKGGCGSCGGCGSCGGCKGGCGSCGGCGSCGGCKGG 100

  P0DI83 ---------MVGQPQPRDDVGSPRPRVIVGTIRPRVIVGTIRPRVIVGSARARPPPDGTPRP-QLAAEESPRPRVIFGTPRARVILGSPRPRVIVSSPWP 90
  Q9D226 CGSCGGCGSCGGCKGGCSSCGG------CGS------CGAASPSC-VSPAAASPAVQALLLPVQLLQA------LLL--P-AQLLL----VQLLLS---- 170

  P0DI83 AVVVASPRPRTPVGSP-WPRVVVGTPR--PRVIVGSPRARVADADPASAPSQGALQGRRQDEHSGTRAEGSRPGGAAPVPEEGGRFARAQRLPPPRHLRL 187
  Q9D226 LLLLHD------CGSSCCP-MSCSLPIYCQREI------------------------------------------------------------------- 196

  P0DI83 PGAPDRHRGQI 198
  Q9D226 ----------- 196

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0020003 symbiont-containing vacuole
2. P GO:0051015 actin filament binding
2. P GO:0048367 shoot system development
2. P GO:0051701 biological process involved in interaction with host
2. P GO:0008285 negative regulation of cell population proliferation
2. P GO:0016021 integral component of membrane
2. P GO:0030261 chromosome condensation
2. P GO:0005882 intermediate filament
2. P GO:0003677 DNA binding
3. B GO:0005730 nucleolus

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB P0DI83 Ras-related protein Rab-34, isoform NARR 0 4.37e-182 1.08e-126
2. P Q8LE84 Small polypeptide DEVIL 18 7.40e-01 9.04e-03 NA
2. P Q9HAA7 Putative uncharacterized protein FLJ11871 8.27e-01 5.06e-04 NA
2. P Q5SF96 Appendage-associated protein 6.91e-01 1.38e-02 NA
2. P Q54MW0 Putative uncharacterized transmembrane protein DDB_G0285779 9.88e-01 5.25e-04 NA
2. P Q9D226 Keratin-associated protein 5-3 3.31e-02 1.30e-02 NA
2. P P38020 Histone H1-like protein HC2 4.47e-01 2.37e-02 NA
2. P Q46397 Histone H1-like protein HC2 6.03e-01 2.32e-02 NA
2. P P16839 Uncharacterized protein US4 NA 4.13e-02 NA
2. P P0CL29 Putative uncharacterized protein YML133W-A 8.22e-02 2.27e-03 NA
2. P P0CL31 Putative uncharacterized protein YPL283W-A 5.77e-02 2.27e-03 NA
2. P Q9DH90 Uncharacterized gene 81 protein NA 1.08e-04 NA
2. P Q4VXF1 Putative protein FAM74A3 9.03e-01 2.29e-02 NA
2. P Q9Y6Z5 Putative uncharacterized protein AFDN-DT 3.02e-01 8.78e-06 NA
2. P Q5SDL7 Tick receptor for ospA 6.80e-01 1.85e-02 NA
2. P Q06280 Histone-like protein HC2 4.86e-01 1.09e-03 NA
2. P Q5UP11 Putative ankyrin repeat protein R848 NA 2.24e-03 NA
2. P Q8NHX4 Spermatogenesis-associated protein 3 3.29e-01 2.75e-02 NA
2. P O13530 Putative uncharacterized protein YLR198C 9.13e-01 5.00e-02 NA
2. P P0C758 Uncharacterized protein DP96R NA 2.88e-02 NA
2. P P0CL30 Putative uncharacterized protein YNL339W-A 6.34e-02 2.27e-03 NA
2. P P18128 Uncharacterized 26.4 kDa protein 3.59e-01 7.01e-06 NA
2. P P0CL28 Putative uncharacterized protein YGR296C-A 6.94e-02 2.27e-03 NA
2. P Q8N377 Putative uncharacterized protein LOC387726 6.28e-01 8.11e-06 NA
2. P P0CL27 Putative uncharacterized protein YER190C-A 8.19e-02 2.27e-03 NA