Summary

P0DKL9

Homolog: Q3UKZ7.
Function: ARL14 effector protein-like.

Statistics

Total GO Annotation: 20
Unique PROST Go: 14
Unique BLAST Go: 4

Total Homologs: 14
Unique PROST Homologs: 8
Unique BLAST Homologs: 3

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q3UKZ7 (ARL14 effector protein-like) with a FATCAT P-Value: 2.39e-11 and RMSD of 2.16 angstrom. The sequence alignment identity is 88.2%.
Structural alignment shown in left. Query protein P0DKL9 colored as red in alignment, homolog Q3UKZ7 colored as blue. Query protein P0DKL9 is also shown in right top, homolog Q3UKZ7 showed in right bottom. They are colored based on secondary structures. 

  P0DKL9 MNEQSEKNNSIQERHTDHSFPEKNCQIGQKQLQQIERQLKCLAFRNPGPQVADFNPETRQQKKKARMSKMNEYFSTKYKIMRKYDKSGRLICNDADLCDC 100
  Q3UKZ7 MTEPSQKNNSTQQELTNHLFPEKSSQIGQKQLQQIERQLKCLAFQNPGPQVADFNPETRQQKKKARMSKMNEYFSVKYKVMKKYDKSGRLICNDVDLCDC 100

  P0DKL9 LEKNCLGCFYPCPKCNSNKCGPECRCNRRWVYDAIVTESGEVISTLPFNVPD 152
  Q3UKZ7 LEKNCLGCFYPCPKCNSNKCGPECRCNRRWVYDAIVTESGEVINTLPFSVPD 152

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
1. PB GO:0005925 focal adhesion
1. PB GO:0005654 nucleoplasm
2. P GO:2000640 positive regulation of SREBP signaling pathway
2. P GO:0097193 intrinsic apoptotic signaling pathway
2. P GO:0046872 metal ion binding
2. P GO:0006924 activation-induced cell death of T cells
2. P GO:0051537 2 iron, 2 sulfur cluster binding
2. P GO:0000139 Golgi membrane
2. P GO:0001618 virus receptor activity
2. P GO:1901030 positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway
2. P GO:0097191 extrinsic apoptotic signaling pathway
2. P GO:0005758 mitochondrial intermembrane space
2. P GO:0016226 iron-sulfur cluster assembly
2. P GO:0005175 CD27 receptor binding
2. P GO:0032088 negative regulation of NF-kappaB transcription factor activity
2. P GO:0005164 tumor necrosis factor receptor binding
3. B GO:0005829 cytosol
3. B GO:0043231 intracellular membrane-bounded organelle
3. B GO:0005886 plasma membrane
3. B GO:0005730 nucleolus

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q3UKZ7 ARL14 effector protein-like 2.39e-11 4.25e-96 4.49e-99
1. PB Q8BIX3 ARL14 effector protein 1.20e-03 7.71e-03 1.04e-26
1. PB P0DKL9 ARL14 effector protein-like 0 5.56e-138 4.99e-112
2. P P59692 Apoptosis regulatory protein Siva 2.97e-01 1.59e-02 NA
2. P Q9H741 SREBP regulating gene protein 1.53e-01 2.50e-02 NA
2. P O15304 Apoptosis regulatory protein Siva 2.52e-01 4.85e-05 NA
2. P O10304 Uncharacterized 13.0 kDa protein NA 2.69e-03 NA
2. P A4HT41 Anamorsin homolog 7.99e-01 5.95e-03 NA
2. P A4H4W7 Anamorsin homolog 8.36e-01 1.00e-03 NA
2. P O54926 Apoptosis regulatory protein Siva 2.14e-01 1.62e-02 NA
2. P Q5ZJE4 SREBP regulating gene protein 1.62e-01 4.26e-02 NA
3. B Q5EA92 ARL14 effector protein 5.46e-05 NA 1.10e-27
3. B Q5FVK8 ARL14 effector protein 8.54e-04 NA 7.40e-27
3. B Q8N8R7 ARL14 effector protein 1.01e-03 NA 1.47e-27