Summary

P0DMW3

Homolog: P0DMW5.
Function: Small integral membrane protein 10-like protein 2B.

Statistics

Total GO Annotation: 6
Unique PROST Go: 6
Unique BLAST Go: 0

Total Homologs: 32
Unique PROST Homologs: 28
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was P0DMW5 (Small integral membrane protein 10-like protein 2B) with a FATCAT P-Value: 1.13e-05 and RMSD of 1.63 angstrom. The sequence alignment identity is 60.3%.
Structural alignment shown in left. Query protein P0DMW3 colored as red in alignment, homolog P0DMW5 colored as blue. Query protein P0DMW3 is also shown in right top, homolog P0DMW5 showed in right bottom. They are colored based on secondary structures. 

  P0DMW3 ---------MAPAAAPSSLAVRASSPAATPTSYGVFCKGLSRTLLAFFELAWQLRMNFPYFYVAGSVILNIRLQVHI- 68
  P0DMW5 MAASAALSAAAAAAALSGLAVRLSRSAAARGSYGAFCKGLTRTLLTFFDLAWRLRMNFPYFYIVASVMLNVRLQVRIE 78

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
Source GO Description
2. P GO:0007218 neuropeptide signaling pathway
2. P GO:1900738 positive regulation of phospholipase C-activating G protein-coupled receptor signaling pathway
2. P GO:0090277 positive regulation of peptide hormone secretion
2. P GO:0005739 mitochondrion
2. P GO:0034774 secretory granule lumen
2. P GO:0005741 mitochondrial outer membrane

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Source Homolog Description FATCAT p-val PROST Evalue BLAST Evalue
1. PB Q96HG1 Small integral membrane protein 10 2.87e-04 6.80e-05 3.43e-24
1. PB P0DMW4 Small integral membrane protein 10-like protein 2A 1.04e-03 1.96e-07 1.14e-24
1. PB P0DMW5 Small integral membrane protein 10-like protein 2B 1.13e-05 1.96e-07 1.14e-24
1. PB P0DMW3 Small integral membrane protein 10-like protein 1 0 1.75e-125 6.27e-44
2. P Q9Y6Z2 Uncharacterized protein encoded by LINC01558 2.88e-01 2.01e-03 NA
2. P Q8WZB0 Putative uncharacterized protein encoded by LINC00476 5.64e-01 3.18e-06 NA
2. P A0A023PYF7 Putative uncharacterized protein YER172C-A 4.77e-01 1.91e-02 NA
2. P Q9MUM6 Uncharacterized 7.4 kDa protein in ndhF-psbD intergenic region 1.58e-03 2.73e-02 NA
2. P Q12394 Putative uncharacterized protein YDL152W 1.55e-03 1.37e-02 NA
2. P P0C8M9 Stress-related protein 1 5.26e-02 7.46e-05 NA
2. P P20566 Uncharacterized 8.4 kDa protein NA 1.52e-03 NA
2. P P92534 Uncharacterized mitochondrial protein AtMg01000 1.06e-02 2.03e-02 NA
2. P P10435 Uncharacterized immunity region protein 12 NA 6.40e-07 NA
2. P Q3E7A3 Uncharacterized protein YJL133C-A 1.12e-02 4.62e-05 NA
2. P P20542 Uncharacterized 7.9 kDa protein NA 3.71e-02 NA
2. P P34238 Putative uncharacterized protein YKL177W 3.06e-03 1.84e-03 NA
2. P P25640 Putative uncharacterized protein YCR064C 1.88e-01 4.77e-02 NA
2. P Q9ULZ0 TP53-target gene 3 protein 5.86e-01 2.30e-02 NA
2. P P19778 Insertion element IS2 uncharacterized 11.1 kDa protein 7.88e-03 1.26e-03 NA
2. P P47066 Putative uncharacterized protein YJL009W 8.26e-02 1.72e-02 NA
2. P Q6W349 Putative uncharacterized protein encoded by LINC00575 9.51e-03 8.86e-04 NA
2. P P19287 Uncharacterized 9.4 kDa protein NA 1.51e-03 NA
2. P P10304 Gene 19.3 protein NA 2.73e-02 NA
2. P P16825 Uncharacterized protein UL81 NA 3.52e-02 NA
2. P P56555 Down syndrome critical region protein 4 6.48e-02 3.71e-02 NA
2. P P31886 Gastrin-releasing peptide 4.64e-01 1.01e-02 NA
2. P Q3E806 Uncharacterized protein YOR316C-A 6.74e-01 1.12e-03 NA
2. P O29555 Uncharacterized protein AF_0703 2.31e-02 1.81e-02 NA
2. P P0DO27 Small polypeptide ROTUNDIFOLIA LIKE 1 5.28e-03 2.10e-04 NA
2. P O83592 Uncharacterized protein TP_0583 8.00e-01 2.24e-02 NA
2. P Q04923 Putative uncharacterized protein YDR220C 4.31e-01 1.12e-03 NA
2. P P03294 Uncharacterized protein F-121 NA 4.81e-02 NA