Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
P0DMW5
(Small integral membrane protein 10-like protein 2B) with a FATCAT P-Value: 1.13e-05 and RMSD of 1.63 angstrom. The sequence alignment identity is 60.3%.
Structural alignment shown in left. Query protein P0DMW3 colored as red in alignment, homolog P0DMW5 colored as blue.
Query protein P0DMW3 is also shown in right top, homolog P0DMW5 showed in right bottom. They are colored based on secondary structures.
P0DMW3 ---------MAPAAAPSSLAVRASSPAATPTSYGVFCKGLSRTLLAFFELAWQLRMNFPYFYVAGSVILNIRLQVHI- 68 P0DMW5 MAASAALSAAAAAAALSGLAVRLSRSAAARGSYGAFCKGLTRTLLTFFDLAWRLRMNFPYFYIVASVMLNVRLQVRIE 78
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 2. P | GO:0007218 | neuropeptide signaling pathway |
| 2. P | GO:1900738 | positive regulation of phospholipase C-activating G protein-coupled receptor signaling pathway |
| 2. P | GO:0090277 | positive regulation of peptide hormone secretion |
| 2. P | GO:0005739 | mitochondrion |
| 2. P | GO:0034774 | secretory granule lumen |
| 2. P | GO:0005741 | mitochondrial outer membrane |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q96HG1 | Small integral membrane protein 10 | 2.87e-04 | 6.80e-05 | 3.43e-24 |
| 1. PB | P0DMW4 | Small integral membrane protein 10-like protein 2A | 1.04e-03 | 1.96e-07 | 1.14e-24 |
| 1. PB | P0DMW5 | Small integral membrane protein 10-like protein 2B | 1.13e-05 | 1.96e-07 | 1.14e-24 |
| 1. PB | P0DMW3 | Small integral membrane protein 10-like protein 1 | 0 | 1.75e-125 | 6.27e-44 |
| 2. P | Q9Y6Z2 | Uncharacterized protein encoded by LINC01558 | 2.88e-01 | 2.01e-03 | NA |
| 2. P | Q8WZB0 | Putative uncharacterized protein encoded by LINC00476 | 5.64e-01 | 3.18e-06 | NA |
| 2. P | A0A023PYF7 | Putative uncharacterized protein YER172C-A | 4.77e-01 | 1.91e-02 | NA |
| 2. P | Q9MUM6 | Uncharacterized 7.4 kDa protein in ndhF-psbD intergenic region | 1.58e-03 | 2.73e-02 | NA |
| 2. P | Q12394 | Putative uncharacterized protein YDL152W | 1.55e-03 | 1.37e-02 | NA |
| 2. P | P0C8M9 | Stress-related protein 1 | 5.26e-02 | 7.46e-05 | NA |
| 2. P | P20566 | Uncharacterized 8.4 kDa protein | NA | 1.52e-03 | NA |
| 2. P | P92534 | Uncharacterized mitochondrial protein AtMg01000 | 1.06e-02 | 2.03e-02 | NA |
| 2. P | P10435 | Uncharacterized immunity region protein 12 | NA | 6.40e-07 | NA |
| 2. P | Q3E7A3 | Uncharacterized protein YJL133C-A | 1.12e-02 | 4.62e-05 | NA |
| 2. P | P20542 | Uncharacterized 7.9 kDa protein | NA | 3.71e-02 | NA |
| 2. P | P34238 | Putative uncharacterized protein YKL177W | 3.06e-03 | 1.84e-03 | NA |
| 2. P | P25640 | Putative uncharacterized protein YCR064C | 1.88e-01 | 4.77e-02 | NA |
| 2. P | Q9ULZ0 | TP53-target gene 3 protein | 5.86e-01 | 2.30e-02 | NA |
| 2. P | P19778 | Insertion element IS2 uncharacterized 11.1 kDa protein | 7.88e-03 | 1.26e-03 | NA |
| 2. P | P47066 | Putative uncharacterized protein YJL009W | 8.26e-02 | 1.72e-02 | NA |
| 2. P | Q6W349 | Putative uncharacterized protein encoded by LINC00575 | 9.51e-03 | 8.86e-04 | NA |
| 2. P | P19287 | Uncharacterized 9.4 kDa protein | NA | 1.51e-03 | NA |
| 2. P | P10304 | Gene 19.3 protein | NA | 2.73e-02 | NA |
| 2. P | P16825 | Uncharacterized protein UL81 | NA | 3.52e-02 | NA |
| 2. P | P56555 | Down syndrome critical region protein 4 | 6.48e-02 | 3.71e-02 | NA |
| 2. P | P31886 | Gastrin-releasing peptide | 4.64e-01 | 1.01e-02 | NA |
| 2. P | Q3E806 | Uncharacterized protein YOR316C-A | 6.74e-01 | 1.12e-03 | NA |
| 2. P | O29555 | Uncharacterized protein AF_0703 | 2.31e-02 | 1.81e-02 | NA |
| 2. P | P0DO27 | Small polypeptide ROTUNDIFOLIA LIKE 1 | 5.28e-03 | 2.10e-04 | NA |
| 2. P | O83592 | Uncharacterized protein TP_0583 | 8.00e-01 | 2.24e-02 | NA |
| 2. P | Q04923 | Putative uncharacterized protein YDR220C | 4.31e-01 | 1.12e-03 | NA |
| 2. P | P03294 | Uncharacterized protein F-121 | NA | 4.81e-02 | NA |